diff --git a/Makefile b/Makefile new file mode 100644 index 00000000..75b38698 --- /dev/null +++ b/Makefile @@ -0,0 +1,278 @@ +ARCH = win64 +PREFIX = gcc +TARGET_NAME = program +TARGET_EXTENSION = exe +TARGET_LIB_EXTENSION = dll + +include makefiles/$(ARCH).$(PREFIX).make + + .PHONY: $(ARCH)-$(PREFIX) + +BIN_DIR += ./bin + +ENGINE_SRC_DIR += ./engine/src +ENGINE_INC_DIR += ./engine/inc +ENGINE_LIB_DIR += ./engine/lib + +EXT_SRC_DIR += ./ext +CLIENT_SRC_DIR += ./client + +UF_LIBS += +EXT_LIBS += +FLAGS += -Wno-pointer-arith +LIB_NAME += uf +EXT_LIB_NAME += ext + +#VULKAN_SDK_PATH += /c/VulkanSDK/1.2.154.0/ +VULKAN_SDK_PATH += /c/VulkanSDK/1.2.162.0/ +GLSL_VALIDATOR += $(VULKAN_SDK_PATH)/Bin32/glslangValidator +# Base Engine's DLL +INC_DIR += $(ENGINE_INC_DIR)/$(ARCH)/$(PREFIX) +DEPS += + +ifneq (,$(findstring win64,$(ARCH))) + REQ_DEPS += vulkan json:nlohmann png openal ogg freetype ncurses curl luajit bullet meshoptimizer # draco discord + FLAGS += + DEPS += -lgdi32 +else ifneq (,$(findstring dreamcast,$(ARCH))) + REQ_DEPS += opengl gldc json:nlohmann png meshoptimizer bullet freetype # lua ogg openal draco luajit ultralight-ux ncurses curl openvr discord + FLAGS += $(KOS_CPPFLAGS) -frtti -DUF_NO_EXCEPTIONS + INCS += $(KOS_INC_PATHS) -I/opt/dreamcast/sh-elf/sh-elf/include + LIBS += $(KOS_LIB_PATHS) -L/opt/dreamcast/sh-elf/sh-elf/lib +endif +ifneq (,$(findstring vulkan,$(REQ_DEPS))) + FLAGS += -DVK_USE_PLATFORM_WIN32_KHR -DUF_USE_VULKAN + DEPS += -lvulkan -lspirv-cross +endif +ifneq (,$(findstring opengl,$(REQ_DEPS))) + FLAGS += -DUF_USE_OPENGL -DUF_USE_GLEW -DUF_USE_OPENGL_FIXED_FUNCTION + ifneq (,$(findstring dreamcast,$(ARCH))) + ifneq (,$(findstring gldc,$(REQ_DEPS))) + DEPS += -lGLdc + FLAGS += -DUF_USE_OPENGL_GLDC + else + DEPS += -lGL #-lGLdc + endif + else + DEPS += -lglew32 -lopengl32 -lglu32 + endif +endif +ifneq (,$(findstring json,$(REQ_DEPS))) + FLAGS += -DUF_USE_JSON + DEPS += + ifneq (,$(findstring nlohmann,$(REQ_DEPS))) + FLAGS += -DUF_JSON_USE_NLOHMANN + endif +endif +ifneq (,$(findstring png,$(REQ_DEPS))) + FLAGS += -DUF_USE_PNG + DEPS += -lpng -lz -lbz2 +endif +ifneq (,$(findstring openal,$(REQ_DEPS))) + FLAGS += -DUF_USE_OPENAL + ifneq (,$(findstring dreamcast,$(ARCH))) + DEPS += -lAL + else + FLAGS += -DUF_USE_ALUT + DEPS += -lopenal -lalut + endif +endif +ifneq (,$(findstring ogg,$(REQ_DEPS))) + FLAGS += -DUF_USE_VORBIS + ifneq (,$(findstring dreamcast,$(ARCH))) + DEPS += -lvorbis -logg + else + DEPS += -lvorbis -lvorbisfile -logg + endif +endif +ifneq (,$(findstring freetype,$(REQ_DEPS))) + FLAGS += -DUF_USE_FREETYPE + DEPS += -lfreetype + ifneq (,$(findstring dreamcast,$(ARCH))) + DEPS += -lbrotlicommon-static -lbrotlidec-static + endif +endif +ifneq (,$(findstring ncurses,$(REQ_DEPS))) + FLAGS += -DUF_USE_NCURSES + DEPS += -lncursesw +endif +ifneq (,$(findstring curl,$(REQ_DEPS))) + FLAGS += -DUF_USE_CURL + DEPS += -lcurl +endif +ifneq (,$(findstring discord,$(REQ_DEPS))) + FLAGS += -DUF_USE_DISCORD + DEPS += -ldiscord_game_sdk +endif +ifneq (,$(findstring openvr,$(REQ_DEPS))) + FLAGS += -DUF_USE_OPENVR -DUSE_OPENVR_MINGW + DEPS += -lopenvr_api +endif +ifneq (,$(findstring lua,$(REQ_DEPS))) + FLAGS += -DUF_USE_LUA + ifneq (,$(findstring luajit,$(REQ_DEPS))) + FLAGS += -DUF_USE_LUAJIT + DEPS += -lluajit-5.1 + INCS += -I/mingw64/include/luajit-2.1 + else + ifneq (,$(findstring dreamcast,$(ARCH))) + DEPS += -llua + INCS += -I/opt/dreamcast/kos-ports/include/lua + endif + endif +endif +ifneq (,$(findstring ultralight-ux,$(REQ_DEPS))) + FLAGS += -DUF_USE_ULTRALIGHT_UX + DEPS += -lUltralight -lUltralightCore -lWebCore -lAppCore +endif +ifneq (,$(findstring bullet,$(REQ_DEPS))) + FLAGS += -DUF_USE_BULLET + ifneq (,$(findstring dreamcast,$(ARCH))) + DEPS += -lbulletdynamics -lbulletcollision -lbulletlinearmath + else + DEPS += -lBulletDynamics -lBulletCollision -lLinearMath + INCS += -I$(ENGINE_INC_DIR)/bullet/ + endif +endif +ifneq (,$(findstring simd,$(REQ_DEPS))) + FLAGS += -DUF_USE_SIMD #-march=native + +endif +ifneq (,$(findstring meshoptimizer,$(REQ_DEPS))) + FLAGS += -DUF_USE_MESHOPTIMIZER + DEPS += -lmeshoptimizer +endif +ifneq (,$(findstring draco,$(REQ_DEPS))) + FLAGS += -DUF_USE_DRACO + DEPS += -ldraco +endif + +#DEPS += -lvulkan -lncursesw +LINKS += $(UF_LIBS) $(EXT_LIBS) $(DEPS) +#-Wl,-subsystem,windows + +LIB_DIR += $(ENGINE_LIB_DIR)/$(ARCH) +INCS += -I$(ENGINE_INC_DIR) -I$(INC_DIR) -I$(VULKAN_SDK_PATH)/include -I/mingw64/include +LIBS += -L$(ENGINE_LIB_DIR) -L$(LIB_DIR) -L$(LIB_DIR)/$(PREFIX) -L$(VULKAN_SDK_PATH)/Lib + +SRCS_DLL += $(wildcard $(ENGINE_SRC_DIR)/*.cpp) $(wildcard $(ENGINE_SRC_DIR)/*/*.cpp) $(wildcard $(ENGINE_SRC_DIR)/*/*/*.cpp) $(wildcard $(ENGINE_SRC_DIR)/*/*/*/*.cpp) $(wildcard $(ENGINE_SRC_DIR)/*/*/*/*/*.cpp) +OBJS_DLL += $(patsubst %.cpp,%.$(ARCH).$(PREFIX).o,$(SRCS_DLL)) +BASE_DLL += lib$(LIB_NAME) +IM_DLL += $(ENGINE_LIB_DIR)/$(ARCH)/$(PREFIX)/$(BASE_DLL).$(TARGET_LIB_EXTENSION).a +EX_DLL += $(BIN_DIR)/exe/lib/$(ARCH)/$(PREFIX)/$(BASE_DLL).$(TARGET_LIB_EXTENSION) +# External Engine's DLL +EXT_INC_DIR += $(INC_DIR) +EXT_LB_FLAGS += $(LIB_DIR) +EXT_DEPS += -l$(LIB_NAME) $(DEPS) +EXT_LINKS += $(UF_LIBS) $(EXT_LIBS) $(EXT_DEPS) +#-Wl,-subsystem,windows + +EXT_LIB_DIR += $(ENGINE_LIB_DIR)/$(ARCH) +EXT_INCS += -I$(ENGINE_INC_DIR) -I$(EXT_INC_DIR) -I$(VULKAN_SDK_PATH)/include -I/mingw64/include +EXT_LIBS += -L$(ENGINE_LIB_DIR) -L$(EXT_LIB_DIR) -L$(EXT_LIB_DIR)/$(PREFIX) -L$(VULKAN_SDK_PATH)/Lib -L/mingw64/lib + +SRCS_EXT_DLL += $(wildcard $(EXT_SRC_DIR)/*.cpp) $(wildcard $(EXT_SRC_DIR)/*/*.cpp) $(wildcard $(EXT_SRC_DIR)/*/*/*.cpp) $(wildcard $(EXT_SRC_DIR)/*/*/*/*.cpp) $(wildcard $(EXT_SRC_DIR)/*/*/*/*/*.cpp) +OBJS_EXT_DLL += $(patsubst %.cpp,%.$(ARCH).$(PREFIX).o,$(SRCS_EXT_DLL)) +BASE_EXT_DLL += lib$(EXT_LIB_NAME) +EXT_IM_DLL += $(ENGINE_LIB_DIR)/$(ARCH)/$(PREFIX)/$(BASE_EXT_DLL).$(TARGET_LIB_EXTENSION).a +EXT_EX_DLL += $(BIN_DIR)/exe/lib/$(ARCH)/$(PREFIX)/$(BASE_EXT_DLL).$(TARGET_LIB_EXTENSION) +# Client EXE +SRCS += $(wildcard $(CLIENT_SRC_DIR)/*.cpp) $(wildcard $(CLIENT_SRC_DIR)/*/*.cpp) +OBJS += $(patsubst %.cpp,%.$(ARCH).$(PREFIX).o,$(SRCS)) +TARGET += $(BIN_DIR)/exe/$(TARGET_NAME).$(PREFIX).$(TARGET_EXTENSION) +# Shaders +SRCS_SHADERS += $(wildcard bin/data/shaders/*.glsl) $(wildcard bin/data/shaders/*/*.glsl) +TARGET_SHADERS += $(patsubst %.glsl,%.spv,$(SRCS_SHADERS)) + +ifneq (,$(findstring dreamcast,$(ARCH))) +$(ARCH): $(EX_DLL) $(EXT_EX_DLL) $(TARGET) ./bin/dreamcast/$(TARGET_NAME).cdi +#$(ARCH): $(TARGET) ./bin/dreamcast/$(TARGET_NAME).cdi +OBJS = $(patsubst %.cpp,%.$(ARCH).$(PREFIX).o,$(SRCS_DLL)) $(patsubst %.cpp,%.$(ARCH).$(PREFIX).o,$(SRCS_EXT_DLL)) $(patsubst %.cpp,%.$(ARCH).$(PREFIX).o,$(SRCS)) + +DEPS += -lkallisti -lc -lm -lgcc -lstdc++ # -l$(LIB_NAME) -l$(EXT_LIB_NAME) + +%.$(ARCH).$(PREFIX).o: %.cpp + $(CC) $(FLAGS) $(INCS) -c $< -o $@ + +$(EX_DLL): FLAGS += -DUF_EXPORTS -DJSON_DLL_BUILD +$(EX_DLL): $(OBJS_DLL) + $(KOS_AR) cru $@ $^ + $(KOS_RANLIB) $@ + cp $@ $(ENGINE_LIB_DIR)/$(ARCH)/$(PREFIX)/$(BASE_DLL).a + +$(EXT_EX_DLL): FLAGS += -DEXT_EXPORTS -DJSON_DLL_BUILD +$(EXT_EX_DLL): $(OBJS_EXT_DLL) + $(KOS_AR) cru $@ $^ + $(KOS_RANLIB) $@ + cp $@ $(ENGINE_LIB_DIR)/$(ARCH)/$(PREFIX)/$(BASE_EXT_DLL).a + +./bin/dreamcast/romdisk.img: + $(KOS_GENROMFS) -f ./bin/dreamcast/romdisk.img -d ./bin/dreamcast/romdisk/ -v + +./bin/dreamcast/romdisk.o: ./bin/dreamcast/romdisk.img + $(KOS_BASE)/utils/bin2o/bin2o ./bin/dreamcast/romdisk.img romdisk ./bin/dreamcast/romdisk.o + +$(TARGET): $(OBJS) ./bin/dreamcast/romdisk.o + $(CC) -O2 -fomit-frame-pointer -ml -m4-single-only -ffunction-sections -fdata-sections $(KOS_INC_PATHS) $(INCS) -D_arch_dreamcast -D_arch_sub_pristine -Wall -g -fno-builtin -ml -m4-single-only -Wl,-Ttext=0x8c010000 -Wl,--gc-sections -T/opt/dreamcast/kos/utils/ldscripts/shlelf.xc -nodefaultlibs $(KOS_LIB_PATHS) $(LIBS) -o $(TARGET) $(OBJS) ./bin/dreamcast/romdisk.o -Wl,--start-group $(DEPS) -Wl,--end-group + +./bin/dreamcast/$(TARGET_NAME).cdi: $(TARGET) + cd ./bin/dreamcast/; ./elf2cdi.sh $(TARGET_NAME) + +else +$(ARCH): $(EX_DLL) $(EXT_EX_DLL) $(TARGET) $(TARGET_SHADERS) + +%.$(ARCH).$(PREFIX).o: %.cpp + $(CC) $(FLAGS) $(INCS) -c $< -o $@ + +$(EX_DLL): FLAGS += -DUF_EXPORTS -DJSON_DLL_BUILD +$(EX_DLL): $(OBJS_DLL) + $(CC) -shared -o $(EX_DLL) -g -Wl,--out-implib=$(IM_DLL) $(OBJS_DLL) $(LIBS) $(INCS) $(LINKS) + cp $(ENGINE_LIB_DIR)/$(ARCH)/$(PREFIX)/$(BASE_DLL).$(TARGET_LIB_EXTENSION).a $(ENGINE_LIB_DIR)/$(ARCH)/$(PREFIX)/$(BASE_DLL).a + +$(EXT_EX_DLL): FLAGS += -DEXT_EXPORTS -DJSON_DLL_BUILD +$(EXT_EX_DLL): $(OBJS_EXT_DLL) + $(CC) -shared -o $(EXT_EX_DLL) -g -Wl,--out-implib=$(EXT_IM_DLL) $(OBJS_EXT_DLL) $(EXT_LIBS) $(EXT_INCS) $(EXT_LINKS) + cp $(ENGINE_LIB_DIR)/$(ARCH)/$(PREFIX)/$(BASE_EXT_DLL).$(TARGET_LIB_EXTENSION).a $(ENGINE_LIB_DIR)/$(ARCH)/$(PREFIX)/$(BASE_EXT_DLL).a + +$(TARGET): $(OBJS) + $(CC) $(FLAGS) $(OBJS) $(LIBS) $(INCS) $(LINKS) -l$(LIB_NAME) -l$(EXT_LIB_NAME) -o $(TARGET) +endif + +%.spv: %.glsl + $(GLSL_VALIDATOR) -V $< -o $@ +ifneq (,$(findstring dreamcast,$(ARCH))) +clean: + @-rm $(EX_DLL) + @-rm $(EXT_EX_DLL) + @-rm $(TARGET) + + @-rm -f $(OBJS_DLL) + @-rm -f $(OBJS_EXT_DLL) + @-rm -f $(OBJS) + + @-rm ./bin/dreamcast/build/* + @-rm ./bin/dreamcast/romdisk.* + @-rm ./bin/dreamcast/$(TARGET_NAME).* +else +clean: + @-rm $(EX_DLL) + @-rm $(EXT_EX_DLL) + @-rm $(TARGET) + + @-rm -f $(OBJS_DLL) + @-rm -f $(OBJS_EXT_DLL) + @-rm -f $(OBJS) +endif +clean-uf: + @-rm $(EX_DLL) + @-rm -f $(OBJS_DLL) + +clean-exf: + @-rm $(EXT_EX_DLL) + @-rm -f $(OBJS_EXT_DLL) + +clean-exe: + -rm $(EX_DLL) + -rm $(EXT_EX_DLL) + -rm $(TARGET) + -rm $(TARGET_SHADERS) \ No newline at end of file diff --git a/bin/data/shaders/base/colored.vert.glsl b/bin/data/shaders/base/colored.vert.glsl new file mode 100644 index 00000000..f2d96b4a --- /dev/null +++ b/bin/data/shaders/base/colored.vert.glsl @@ -0,0 +1,44 @@ +#version 450 + +layout (constant_id = 0) const uint PASSES = 6; +layout (location = 0) in vec3 inPos; +layout (location = 1) in vec2 inUv; +layout (location = 2) in vec3 inNormal; +layout (location = 3) in vec4 inColor; + +layout( push_constant ) uniform PushBlock { + uint pass; + uint draw; +} PushConstant; + +struct Matrices { + mat4 model; + mat4 view[PASSES]; + mat4 projection[PASSES]; +}; + +layout (binding = 0) uniform UBO { + Matrices matrices; + vec4 color; +} ubo; + +layout (location = 0) out vec2 outUv; +layout (location = 1) out vec4 outColor; +layout (location = 2) out vec3 outNormal; +layout (location = 3) out vec3 outPosition; + +out gl_PerVertex { + vec4 gl_Position; +}; + + +void main() { + outUv = inUv; + outColor = inColor.rgba; + + outPosition = vec3(ubo.matrices.view[PushConstant.pass] * ubo.matrices.model * vec4(inPos.xyz, 1.0)); + outNormal = vec3(ubo.matrices.view[PushConstant.pass] * ubo.matrices.model * vec4(inNormal.xyz, 0.0)); + outNormal = normalize(outNormal); + + gl_Position = ubo.matrices.projection[PushConstant.pass] * ubo.matrices.view[PushConstant.pass] * ubo.matrices.model * vec4(inPos.xyz, 1.0); +} \ No newline at end of file diff --git a/bin/data/shaders/base/frag.glsl b/bin/data/shaders/base/frag.glsl new file mode 100644 index 00000000..177d0217 --- /dev/null +++ b/bin/data/shaders/base/frag.glsl @@ -0,0 +1,49 @@ +#version 450 + +#define UF_DEFERRED_SAMPLING 0 +#define UF_CAN_DISCARD 1 + +layout (binding = 1) uniform sampler2D samplerTexture; + +layout (location = 0) in vec2 inUv; +layout (location = 1) in vec4 inColor; +layout (location = 2) in vec3 inNormal; +layout (location = 3) in vec3 inPosition; + +layout (location = 0) out uvec2 outId; +layout (location = 1) out vec2 outNormals; +#if UF_DEFERRED_SAMPLING + layout (location = 2) out vec2 outUvs; +#else + layout (location = 2) out vec4 outAlbedo; +#endif + +vec2 encodeNormals( vec3 n ) { + float p = sqrt(n.z*8+8); + return n.xy/p + 0.5; +} +float mipLevel( in vec2 uv ) { + vec2 dx_vtc = dFdx(uv); + vec2 dy_vtc = dFdy(uv); + return 0.5 * log2(max(dot(dx_vtc, dx_vtc), dot(dy_vtc, dy_vtc))); +} + +void main() { + float mip = mipLevel(inUv.xy); + vec2 uv = inUv.xy; + vec4 C = vec4(1, 1, 1, 1); + vec3 P = inPosition; + vec3 N = inNormal; +#if UF_DEFERRED_SAMPLING + outUvs = wrap(inUv.xy); + vec4 outAlbedo = vec4(0,0,0,0); +#endif +#if !UF_DEFERRED_SAMPLING || UF_CAN_DISCARD + C = textureLod( samplerTexture, uv, mip ); +#endif +#if !UF_DEFERRED_SAMPLING + outAlbedo = C * inColor; +#endif + outNormals = encodeNormals( N ); + //outId = ivec2(0, 0); +} \ No newline at end of file diff --git a/bin/data/shaders/base/vert.glsl b/bin/data/shaders/base/vert.glsl new file mode 100644 index 00000000..0c83f290 --- /dev/null +++ b/bin/data/shaders/base/vert.glsl @@ -0,0 +1,43 @@ +#version 450 + +layout (constant_id = 0) const uint PASSES = 6; +layout (location = 0) in vec3 inPos; +layout (location = 1) in vec2 inUv; +layout (location = 2) in vec3 inNormal; + +layout( push_constant ) uniform PushBlock { + uint pass; + uint draw; +} PushConstant; + +struct Matrices { + mat4 model; + mat4 view[PASSES]; + mat4 projection[PASSES]; +}; + +layout (binding = 0) uniform UBO { + Matrices matrices; + vec4 color; +} ubo; + +layout (location = 0) out vec2 outUv; +layout (location = 1) out vec4 outColor; +layout (location = 2) out vec3 outNormal; +layout (location = 3) out vec3 outPosition; + +out gl_PerVertex { + vec4 gl_Position; +}; + + +void main() { + outUv = inUv; + outColor = ubo.color; + + outPosition = vec3(ubo.matrices.view[PushConstant.pass] * ubo.matrices.model * vec4(inPos.xyz, 1.0)); + outNormal = vec3(ubo.matrices.view[PushConstant.pass] * ubo.matrices.model * vec4(inNormal.xyz, 0.0)); + outNormal = normalize(outNormal); + + gl_Position = ubo.matrices.projection[PushConstant.pass] * ubo.matrices.view[PushConstant.pass] * ubo.matrices.model * vec4(inPos.xyz, 1.0); +} \ No newline at end of file diff --git a/bin/data/shaders/display/blit.frag.glsl b/bin/data/shaders/display/blit.frag.glsl new file mode 100644 index 00000000..64e61a6a --- /dev/null +++ b/bin/data/shaders/display/blit.frag.glsl @@ -0,0 +1,23 @@ +#version 450 +#extension GL_EXT_samplerless_texture_functions : require + +layout (binding = 1) uniform sampler samp; +layout (binding = 2) uniform texture2D albedoLeftTexture; +layout (binding = 3) uniform texture2D albedoRightTexture; + +layout (location = 0) in vec2 inUv; + +layout (location = 0) out vec4 outAlbedoSpecular; + +layout( push_constant ) uniform PushBlock { + uint pass; +} PushConstant; + +void main() { + if ( PushConstant.pass == 0 ) { + outAlbedoSpecular.rgb = texture(sampler2D(albedoLeftTexture, samp), inUv).rgb; + } else { + outAlbedoSpecular.rgb = texture(sampler2D(albedoRightTexture, samp), inUv).rgb; + } + outAlbedoSpecular.a = 1; +} \ No newline at end of file diff --git a/bin/data/shaders/display/blit.vert.glsl b/bin/data/shaders/display/blit.vert.glsl new file mode 100644 index 00000000..e9638741 --- /dev/null +++ b/bin/data/shaders/display/blit.vert.glsl @@ -0,0 +1,16 @@ +#version 450 + +layout (location = 0) in vec2 inPos; +layout (location = 1) in vec2 inUv; + +layout (location = 0) out vec2 outUv; + +out gl_PerVertex { + vec4 gl_Position; +}; + +void main() { + outUv = inUv; + + gl_Position = vec4(inPos.xy, 0.0, 1.0); +} \ No newline at end of file diff --git a/bin/data/shaders/display/rendertarget.frag.glsl b/bin/data/shaders/display/rendertarget.frag.glsl new file mode 100644 index 00000000..c46eec2a --- /dev/null +++ b/bin/data/shaders/display/rendertarget.frag.glsl @@ -0,0 +1,75 @@ +#version 450 +#extension GL_EXT_samplerless_texture_functions : require + +#define MULTISAMPLING 1 +#define UF_DEFERRED_SAMPLING 0 +#define UF_CAN_DISCARD 1 + +#if !MULTISAMPLING + layout (binding = 1) uniform usampler2D textureId; + layout (binding = 2) uniform sampler2D textureNormals; + #if UF_DEFERRED_SAMPLING + layout (binding = 3) uniform sampler2D textureUvs; + #else + layout (binding = 3) uniform sampler2D textureAlbedo; + #endif +#else + layout (binding = 1) uniform usampler2DMS textureId; + layout (binding = 2) uniform sampler2DMS textureNormals; + #if UF_DEFERRED_SAMPLING + layout (binding = 3) uniform sampler2DMS textureUvs; + #else + layout (binding = 3) uniform sampler2DMS textureAlbedo; + #endif +#endif + +struct Cursor { + vec2 position; + vec2 radius; + vec4 color; +}; + +vec4 resolve( sampler2DMS t, ivec2 uv ) { + vec4 resolved = vec4(0); + int samples = textureSamples(t); + for ( int i = 0; i < samples; ++i ) { + resolved += texelFetch(t, uv, i); + } + resolved /= float(samples); + return resolved; +} + +layout (location = 0) in vec2 inUv; +layout (location = 1) in float inAlpha; +layout (location = 2) in Cursor inCursor; + +layout (location = 0) out vec4 outAlbedo; +void main() { +#if !MULTISAMPLING + ivec2 screenSize = textureSize(textureId, 0); +#else + ivec2 screenSize = textureSize(textureId); +#endif + ivec2 uv = ivec2(inUv * screenSize); + if ( inCursor.radius.x <= 0 || inCursor.radius.y <= 0 ) { + #if !MULTISAMPLING + outAlbedo = texture(textureAlbedo, uv).rgba; + #else + outAlbedo = resolve( textureAlbedo, uv ); + #endif + return; + } + float dist = pow(inUv.x - inCursor.position.x, 2) / pow(inCursor.radius.x, 2) + pow(inUv.y - inCursor.position.y, 2) / pow(inCursor.radius.y, 2); + +#if !MULTISAMPLING + outAlbedo = texture(textureAlbedo, inUv); +#else + outAlbedo = resolve( textureAlbedo, uv ); +#endif + + if ( dist <= 1 ) { + float attenuation = dist; + outAlbedo.rgb = mix( inCursor.color.rgb * inCursor.color.a, outAlbedo.rgb, attenuation ); + } + if ( inAlpha < 1.0 ) outAlbedo.a = inAlpha; +} \ No newline at end of file diff --git a/bin/data/shaders/display/rendertarget.vert.glsl b/bin/data/shaders/display/rendertarget.vert.glsl new file mode 100644 index 00000000..c90a0fb3 --- /dev/null +++ b/bin/data/shaders/display/rendertarget.vert.glsl @@ -0,0 +1,41 @@ +#version 450 + +layout (location = 0) in vec2 inPos; +layout (location = 1) in vec2 inUv; + +struct Cursor { + vec2 position; + vec2 radius; + vec4 color; +}; + +layout (location = 0) out vec2 outUv; +layout (location = 1) out float outAlpha; +layout (location = 2) out flat Cursor outCursor; + +layout( push_constant ) uniform PushBlock { + uint pass; + uint draw; +} PushConstant; + +out gl_PerVertex { + vec4 gl_Position; +}; + +struct Matrices { + mat4 model[2]; +}; +layout (binding = 0) uniform UBO { + Matrices matrices; + Cursor cursor; +// float alpha; +// float padding; +} ubo; + +void main() { + outUv = inUv; + outCursor = ubo.cursor; + outAlpha = 1; + + gl_Position = ubo.matrices.model[PushConstant.pass] * vec4(inPos.xy, 0.0, 1.0); +} \ No newline at end of file diff --git a/bin/data/shaders/display/subpass.frag.glsl b/bin/data/shaders/display/subpass.frag.glsl new file mode 100644 index 00000000..65c864c8 --- /dev/null +++ b/bin/data/shaders/display/subpass.frag.glsl @@ -0,0 +1,741 @@ +#version 450 +#extension GL_EXT_samplerless_texture_functions : require + +#define MULTISAMPLING 1 +#define RAY_MARCH_FOG 1 +#define UF_DEFERRED_SAMPLING 0 + +layout (constant_id = 0) const uint TEXTURES = 256; + +struct Matrices { + mat4 view[2]; + mat4 projection[2]; + mat4 iView[2]; + mat4 iProjection[2]; + mat4 iProjectionView[2]; +}; + +struct Space { + vec3 eye; + vec3 world; +} position, normal, view; + +struct Fog { + vec3 color; + float stepScale; + + vec3 offset; + float densityScale; + + float densityThreshold; + float densityMultiplier; + float absorbtion; + float padding1; + + vec2 range; + float padding2; + float padding3; +}; + +struct Mode { + uint type; + uint scalar; + vec2 padding; + vec4 parameters; +}; + +struct Light { + vec3 position; + float radius; + + vec3 color; + float power; + + int type; + int mapIndex; + float depthBias; + float padding; + + mat4 view; + mat4 projection; +}; + +struct Material { + vec4 colorBase; + vec4 colorEmissive; + + float factorMetallic; + float factorRoughness; + float factorOcclusion; + float factorAlphaCutoff; + + int indexAlbedo; + int indexNormal; + int indexEmissive; + int indexOcclusion; + + int indexMetallicRoughness; + int modeAlpha; + int padding1; + int padding2; +}; +struct Texture { + int index; + int samp; + int remap; + float blend; + + vec4 lerp; +}; +struct DrawCall { + int materialIndex; + uint materials; + int textureIndex; + uint textures; +}; + +#if !MULTISAMPLING + layout (input_attachment_index = 0, binding = 0) uniform usubpassInput samplerId; + layout (input_attachment_index = 1, binding = 1) uniform subpassInput samplerNormal; + #if UF_DEFERRED_SAMPLING + layout (input_attachment_index = 2, binding = 2) uniform subpassInput samplerUv; + #else + layout (input_attachment_index = 2, binding = 2) uniform subpassInput samplerAlbedo; + #endif + layout (input_attachment_index = 3, binding = 3) uniform subpassInput samplerDepth; +#else + layout (input_attachment_index = 0, binding = 0) uniform usubpassInputMS samplerId; + layout (input_attachment_index = 1, binding = 1) uniform subpassInputMS samplerNormal; + #if UF_DEFERRED_SAMPLING + layout (input_attachment_index = 2, binding = 2) uniform subpassInputMS samplerUv; + #else + layout (input_attachment_index = 2, binding = 2) uniform subpassInputMS samplerAlbedo; + #endif + layout (input_attachment_index = 3, binding = 3) uniform subpassInputMS samplerDepth; +#endif +layout (binding = 4) uniform sampler3D samplerNoise; +layout (binding = 5) uniform samplerCube samplerSkybox; +layout (binding = 6) uniform sampler2D samplerTextures[TEXTURES]; + +layout (binding = 7) uniform UBO { + Matrices matrices; + + Mode mode; + Fog fog; + + uint lights; + uint materials; + uint textures; + uint drawCalls; + + vec3 ambient; + float kexp; + + uint msaa; + uint poissonSamples; + uint padding1; + uint padding2; +} ubo; + +layout (std140, binding = 8) readonly buffer Lights { + Light lights[]; +}; +layout (std140, binding = 9) readonly buffer Materials { + Material materials[]; +}; +layout (std140, binding = 10) readonly buffer Textures { + Texture textures[]; +}; +layout (std140, binding = 11) readonly buffer DrawCalls { + DrawCall drawCalls[]; +}; + + +layout (location = 0) in vec2 inUv; +layout (location = 1) in flat uint inPushConstantPass; + +layout (location = 0) out vec4 outFragColor; + +vec2 poissonDisk[16] = vec2[]( + vec2( -0.94201624, -0.39906216 ), + vec2( 0.94558609, -0.76890725 ), + vec2( -0.094184101, -0.92938870 ), + vec2( 0.34495938, 0.29387760 ), + vec2( -0.91588581, 0.45771432 ), + vec2( -0.81544232, -0.87912464 ), + vec2( -0.38277543, 0.27676845 ), + vec2( 0.97484398, 0.75648379 ), + vec2( 0.44323325, -0.97511554 ), + vec2( 0.53742981, -0.47373420 ), + vec2( -0.26496911, -0.41893023 ), + vec2( 0.79197514, 0.19090188 ), + vec2( -0.24188840, 0.99706507 ), + vec2( -0.81409955, 0.91437590 ), + vec2( 0.19984126, 0.78641367 ), + vec2( 0.14383161, -0.14100790 ) +); + +void phong( Light light, vec4 albedoSpecular, inout vec3 i ) { + vec3 Ls = vec3(1.0, 1.0, 1.0); // light specular + vec3 Ld = light.color; // light color + vec3 La = vec3(1.0, 1.0, 1.0); + + vec3 Ks = vec3(albedoSpecular.a); // material specular + vec3 Kd = albedoSpecular.rgb; // material diffuse + vec3 Ka = vec3(1.0, 1.0, 1.0); + + float Kexp = ubo.kexp; + + vec3 V = position.eye; + vec3 N = normal.eye; + vec3 L = light.position.xyz - V; + float dist = length(L); +// if ( light.radius > 0.001 && light.radius < dist ) return; + + vec3 D = normalize(L); + float d_dot = max(dot( D, N ), 0.0); + + vec3 R = reflect( -D, N ); + vec3 S = normalize(-V); + float s_factor = pow( max(dot( R, S ), 0.0), Kexp ); + if ( Kexp < 0.0001 ) s_factor = 0; + + float radiance = light.power / (dist * dist); + + vec3 Ia = La * Ka; + vec3 Id = Ld * Kd * d_dot * radiance; + vec3 Is = Ls * Ks * s_factor * radiance; + + i += Id + Is; +} + +const float PI = 3.14159265359; +float DistributionGGX(vec3 N, vec3 H, float roughness) { + float a = roughness*roughness; + float a2 = a*a; + float NdotH = max(dot(N, H), 0.0); + float NdotH2 = NdotH*NdotH; + + float num = a2; + float denom = (NdotH2 * (a2 - 1.0) + 1.0); + denom = PI * denom * denom; + + return num / denom; +} + +float GeometrySchlickGGX(float NdotV, float roughness) { + float r = (roughness + 1.0); + float k = (r*r) / 8.0; + + float num = NdotV; + float denom = NdotV * (1.0 - k) + k; + + return num / denom; +} +float GeometrySmith(vec3 N, vec3 V, vec3 L, float roughness) { + float NdotV = max(dot(N, V), 0.0); + float NdotL = max(dot(N, L), 0.0); + float ggx2 = GeometrySchlickGGX(NdotV, roughness); + float ggx1 = GeometrySchlickGGX(NdotL, roughness); + + return ggx1 * ggx2; +} +vec3 fresnelSchlick(float cosTheta, vec3 F0) { + return F0 + (1.0 - F0) * pow(1.0 - cosTheta, 5.0); +} + +float random(vec3 seed, int i){ + vec4 seed4 = vec4(seed,i); + float dot_product = dot(seed4, vec4(12.9898,78.233,45.164,94.673)); + return fract(sin(dot_product) * 43758.5453); +} + +float shadowFactor( Light light, uint shadowMap ) { + vec4 positionClip = light.projection * light.view * vec4(position.world, 1.0); + positionClip.xyz /= positionClip.w; + + if ( positionClip.x < -1 || positionClip.x >= 1 ) return 0.0; + if ( positionClip.y < -1 || positionClip.y >= 1 ) return 0.0; + if ( positionClip.z <= 0 || positionClip.z >= 1 ) return 0.0; + + float factor = 1.0; + + // spot light + if ( light.type == 2 || light.type == 3 ) { + float dist = length( positionClip.xy ); + if ( dist > 0.5 ) return 0.0; + + // spot light with attenuation + if ( light.type == 3 ) { + factor = 1.0 - (pow(dist * 2,2.0)); + } + } + + vec2 uv = positionClip.xy * 0.5 + 0.5; + float bias = light.depthBias; +/* + if ( true ) { + float cosTheta = clamp(dot(normal.eye, normalize(light.position.xyz - position.eye)), 0, 1); + bias = clamp(bias * tan(acos(cosTheta)), 0, 0.01); + } else if ( true ) { + bias = max(bias * 10 * (1.0 - dot(normal.eye, normalize(light.position.xyz - position.eye))), bias); + } +*/ + + float eyeDepth = positionClip.z; + + int samples = int(ubo.poissonSamples); + if ( samples <= 1 ) { + return eyeDepth < texture(samplerTextures[shadowMap], uv).r - bias ? 0.0 : factor; + } + for ( int i = 0; i < samples; ++i ) { + // int index = i; + // int index = int( float(samples) * random(gl_FragCoord.xyy, i) ) % samples; + int index = int( float(samples) * random(floor(position.world.xyz * 1000.0), i)) % samples; + float lightDepth = texture(samplerTextures[shadowMap], uv + poissonDisk[index] / 700.0 ).r; + if ( eyeDepth < lightDepth - bias ) factor -= 1.0 / samples; + } + return factor; +} +vec3 hslToRgb(vec3 HSL) { + vec3 RGB; { + float H = HSL.x; + float R = abs(H * 6 - 3) - 1; + float G = 2 - abs(H * 6 - 2); + float B = 2 - abs(H * 6 - 4); + RGB = clamp(vec3(R,G,B), 0, 1); + } + float C = (1 - abs(2 * HSL.z - 1)) * HSL.y; + return (RGB - 0.5) * C + HSL.z; +} +vec3 rgbToHsl(vec3 RGB) { + float Epsilon = 1e-10; + vec3 HCV; { + vec4 P = (RGB.g < RGB.b) ? vec4(RGB.bg, -1.0, 2.0/3.0) : vec4(RGB.gb, 0.0, -1.0/3.0); + vec4 Q = (RGB.r < P.x) ? vec4(P.xyw, RGB.r) : vec4(RGB.r, P.yzx); + float C = Q.x - min(Q.w, Q.y); + float H = abs((Q.w - Q.y) / (6 * C + Epsilon) + Q.z); + HCV = vec3(H, C, Q.x); + } + float L = HCV.z - HCV.y * 0.5; + float S = HCV.y / (1 - abs(L * 2 - 1) + Epsilon); + return vec3(HCV.x, S, L); +} + +float hueDistance(float h1, float h2) { + float diff = abs((h1 - h2)); + return min(abs((1.0 - diff)), diff); +} +const float lightnessSteps = 4.0; +float lightnessStep(float l) { + return floor((0.5 + l * lightnessSteps)) / lightnessSteps; +} +const int indexMatrix16x16[256] = int[](0,192, 48,240, 12,204, 60,252, 3,195, 51,243, 15,207, 63,255, + 128, 64,176,112,140, 76,188,124,131, 67,179,115,143, 79,191,127, + 32,224, 16,208, 44,236, 28,220, 35,227, 19,211, 47,239, 31,223, + 160, 96,144, 80,172,108,156, 92,163, 99,147, 83,175,111,159, 95, + 8,200, 56,248, 4,196, 52,244, 11,203, 59,251, 7,199, 55,247, + 136, 72,184,120,132, 68,180,116,139, 75,187,123,135, 71,183,119, + 40,232, 24,216, 36,228, 20,212, 43,235, 27,219, 39,231, 23,215, + 168,104,152, 88,164,100,148, 84,171,107,155, 91,167,103,151, 87, + 2,194, 50,242, 14,206, 62,254, 1,193, 49,241, 13,205, 61,253, + 130, 66,178,114,142, 78,190,126,129, 65,177,113,141, 77,189,125, + 34,226, 18,210, 46,238, 30,222, 33,225, 17,209, 45,237, 29,221, + 162, 98,146, 82,174,110,158, 94,161, 97,145, 81,173,109,157, 93, + 10,202, 58,250, 6,198, 54,246, 9,201, 57,249, 5,197, 53,245, + 138, 74,186,122,134, 70,182,118,137, 73,185,121,133, 69,181,117, + 42,234, 26,218, 38,230, 22,214, 41,233, 25,217, 37,229, 21,213, + 170,106,154, 90,166,102,150, 86,169,105,153, 89,165,101,149, 85); +float indexValue16x16( float scale ) { + int x = int(mod(gl_FragCoord.x * scale, 16)); + int y = int(mod(gl_FragCoord.y * scale, 16)); + return indexMatrix16x16[(x + y * 16)] / 256.0; +} +const int indexMatrix8x8[64] = int[](0, 32, 8, 40, 2, 34, 10, 42, + 48, 16, 56, 24, 50, 18, 58, 26, + 12, 44, 4, 36, 14, 46, 6, 38, + 60, 28, 52, 20, 62, 30, 54, 22, + 3, 35, 11, 43, 1, 33, 9, 41, + 51, 19, 59, 27, 49, 17, 57, 25, + 15, 47, 7, 39, 13, 45, 5, 37, + 63, 31, 55, 23, 61, 29, 53, 21); +float indexValue8x8( float scale ) { + int x = int(mod(gl_FragCoord.x * scale, 8)); + int y = int(mod(gl_FragCoord.y * scale, 8)); + return indexMatrix8x8[(x + y * 8)] / 64.0; +} +const int indexMatrix4x4[16] = int[](0, 8, 2, 10, + 12, 4, 14, 6, + 3, 11, 1, 9, + 15, 7, 13, 5); +float indexValue4x4( float scale ) { + int x = int(mod(gl_FragCoord.x * scale, 4)); + int y = int(mod(gl_FragCoord.y * scale, 4)); + return indexMatrix4x4[(x + y * 4)] / 16.0; +} +vec3[2] closestColors(float hue) { + vec3 ret[2]; + vec3 closest = vec3(-2, 0, 0); + vec3 secondClosest = vec3(-2, 0, 0); + vec3 temp; +/* + for (int i = 0; i < palette.length(); ++i) { + temp = rgbToHsl(palette[i].rgb); + float tempDistance = hueDistance(temp.x, hue); + if (tempDistance < hueDistance(closest.x, hue)) { + secondClosest = closest; + closest = temp; + } else { + if (tempDistance < hueDistance(secondClosest.x, hue)) { + secondClosest = temp; + } + } + } +*/ + ret[0] = closest; + ret[1] = secondClosest; + return ret; +} +float dither(float color) { + float closestColor = (color < 0.5) ? 0 : 1; + float secondClosestColor = 1 - closestColor; + float d = 1; // -0.5 - fract(ubo.mode.parameters.w / 8.0); + if ( ubo.mode.scalar == 16 ) { + d = indexValue16x16(1); + } else if ( ubo.mode.scalar == 8 ) { + d = indexValue8x8(1); + } else if ( ubo.mode.scalar == 4 ) { + d = indexValue4x4(1); + } + float distance = abs(closestColor - color); + return (distance < d) ? closestColor : secondClosestColor; +} +void dither(inout vec3 color) { + vec3 hsl = rgbToHsl(color); + hsl.x = dither(hsl.x); + color = hslToRgb(hsl); +} +void dither1(inout vec3 color) { + vec3 hsl = rgbToHsl(color); + + float d = 0; + vec3 cs[2] = { hsl, hsl }; // closestColors(hsl.x); + float scale = 1; + if ( ubo.mode.scalar == 16 ) { + d = indexValue16x16(scale); + } else if ( ubo.mode.scalar == 8 ) { + d = indexValue8x8(scale); + } else if ( ubo.mode.scalar == 4 ) { + d = indexValue4x4(scale); + } + float hueDiff = hueDistance(hsl.x, cs[0].x) / hueDistance(cs[1].x, cs[0].x); + float l1 = lightnessStep(max((hsl.z - 0.125), 0.0)); + float l2 = lightnessStep(min((hsl.z + 0.124), 1.0)); + float lightnessDiff = (hsl.z - l1) / (l2 - l1); + + vec3 resultColor = (hueDiff < d) ? cs[0] : cs[1]; + resultColor.z = (lightnessDiff < d) ? l1 : l2; + color = hslToRgb(resultColor); +} +vec3 dither2() { + vec3 vDither = dot( vec2( 171.0, 231.0 ), inUv.xy + ubo.mode.parameters.w ).xxx; + vDither.rgb = fract( vDither.rgb / vec3( 103.0, 71.0, 97.0 ) ) - vec3( 0.5, 0.5, 0.5 ); + return ( vDither.rgb / 255.0 ) * 0.375; +} + +float rand2(vec2 co){ + return fract(sin(dot(co.xy ,vec2(12.9898,78.233))) * 143758.5453); +} +float rand3(vec3 co){ + return fract(sin(dot(co.xyz ,vec3(12.9898,78.233, 37.719))) * 143758.5453); +} +void whitenoise(inout vec3 color) { + float flicker = ubo.mode.parameters.x; + float pieces = ubo.mode.parameters.y; + float blend = ubo.mode.parameters.z; + float time = ubo.mode.parameters.w; + if ( blend < 0.0001 ) return; + float freq = sin(pow(mod(time, flicker) + flicker, 1.9)); +// float whiteNoise = rand3( floor(position.world / pieces) + floor(time * 2) ); + float whiteNoise = rand2( floor(gl_FragCoord.xy / pieces) + mod(time, freq) ); + color = mix( color, vec3(whiteNoise), blend ); +} + +void pbr( Light light, vec3 albedo, float metallic, float roughness, vec3 lightPositionWorld, inout vec3 i ) { + vec3 F0 = vec3(0.04); + F0 = mix(F0, albedo, metallic); + + vec3 N = normalize(normal.eye); + vec3 L = light.position.xyz - position.eye; + float dist = length(L); + + L = normalize(L); + vec3 V = normalize(-position.eye); + vec3 H = normalize(V + L); + + float NdotL = max(dot(N, L), 0.0); + float NdotV = max(dot(N, V), 0.0); + float attenuation = light.power / (dist * dist); + vec3 radiance = light.color.rgb * attenuation; + + // cook-torrance brdf + float NDF = DistributionGGX(N, H, roughness); + float G = GeometrySmith(N, V, L, roughness); + vec3 F = fresnelSchlick(max(dot(H, V), 0.0), F0); + + vec3 kD = vec3(1.0) - F; + kD *= 1.0 - metallic; + + vec3 numerator = NDF * G * F; + float denominator = 4.0 * NdotV * NdotL; + vec3 specular = numerator / max(denominator, 0.001); + + // add to outgoing radiance Lo + i += (kD * albedo / PI + specular) * radiance * NdotL; +} + +vec2 rayBoxDst( vec3 boundsMin, vec3 boundsMax, vec3 rayO, vec3 rayD ) { + vec3 t0 = (boundsMin - rayO) / rayD; + vec3 t1 = (boundsMax - rayO) / rayD; + vec3 tmin = min(t0, t1); + vec3 tmax = max(t0, t1); + float dstA = max( max(tmin.x, tmin.y), tmin.z ); + float dstB = min( tmax.x, min(tmax.y, tmax.z) ); + float dstToBox = max(0, dstA); + float dstInsideBox = max(0, dstB - dstToBox); + return vec2(dstToBox, dstInsideBox); +} + +float sampleDensity( vec3 position ) { + vec3 uvw = position * ubo.fog.densityScale * 0.001 + ubo.fog.offset * 0.01; + return max(0, texture(samplerNoise, uvw).r - ubo.fog.densityThreshold) * ubo.fog.densityMultiplier; +} + +void fog( vec3 rayO, vec3 rayD, inout vec3 i, float scale ) { + if ( ubo.fog.stepScale <= 0 ) return; + if ( ubo.fog.range.x == 0 || ubo.fog.range.y == 0 ) return; + +#if RAY_MARCH_FOG + float range = ubo.fog.range.y; + vec3 boundsMin = vec3(-range,-range,-range) + rayO; + vec3 boundsMax = vec3(range,range,range) + rayO; + int numSteps = int(length(boundsMax - boundsMin) * ubo.fog.stepScale ); + + vec2 rayBoxInfo = rayBoxDst( boundsMin, boundsMax, rayO, rayD ); + float dstToBox = rayBoxInfo.x; + float dstInsideBox = rayBoxInfo.y; + float depth = position.eye.z; + + float lightEnergy = 0; + // march + if ( 0 <= dstInsideBox && dstToBox <= depth ) { + float dstTravelled = 0; + float stepSize = dstInsideBox / numSteps; + float dstLimit = min( depth - dstToBox, dstInsideBox ); + float totalDensity = 0; + float transmittance = 1; + while ( dstTravelled < dstLimit ) { + vec3 rayPos = rayO + rayD * (dstToBox + dstTravelled); + float density = sampleDensity(rayPos); + if ( density > 0 ) { + transmittance *= exp(-density * stepSize * ubo.fog.absorbtion); + if ( transmittance < 0.01 ) break; + } + dstTravelled += stepSize; + } + i.rgb = mix(ubo.fog.color.rgb, i.rgb, transmittance); + } +#endif + + vec3 color = ubo.fog.color.rgb; + float inner = ubo.fog.range.x; + float outer = ubo.fog.range.y * scale; + float distance = length(-position.eye); + float factor = (distance - inner) / (outer - inner); + factor = clamp( factor, 0.0, 1.0 ); + + i.rgb = mix(i.rgb, color, factor); +} + +vec3 decodeNormals( vec2 enc ) { + vec2 fenc = enc*4-2; + float f = dot(fenc,fenc); + float g = sqrt(1-f/4); + vec3 n; + n.xy = fenc*g; + n.z = 1-f/2; + return normalize(n); +} +float wrap( float i ) { + return fract(i); +} +vec2 wrap( vec2 uv ) { + return vec2( wrap( uv.x ), wrap( uv.y ) ); +} +float mipLevel( in vec2 uv ) { + vec2 dx_vtc = dFdx(uv); + vec2 dy_vtc = dFdy(uv); + return 0.5 * log2(max(dot(dx_vtc, dx_vtc), dot(dy_vtc, dy_vtc))); +} +bool validTextureIndex( int textureIndex ) { + return 0 <= textureIndex && textureIndex < ubo.textures; +} +vec4 sampleTexture( uint drawId, int textureIndex, in vec2 uv, vec4 base ) { + if ( !validTextureIndex( textureIndex ) ) return base; + Texture t = textures[textureIndex+1]; + float mip = mipLevel( uv ); + return texture( samplerTextures[drawId], mix( t.lerp.xy, t.lerp.zw, wrap( uv ) ), mip ); +} + +vec4 resolve( subpassInputMS t ) { + int samples = int(ubo.msaa); + vec4 resolved = vec4(0); + for ( int i = 0; i < samples; ++i ) { + resolved += subpassLoad(t, i); + } + resolved /= vec4(samples); + return resolved; +} +uvec4 resolve( usubpassInputMS t ) { + int samples = int(ubo.msaa); + uvec4 resolved = uvec4(0); + for ( int i = 0; i < samples; ++i ) { + resolved += subpassLoad(t, i); + } + resolved /= uvec4(samples); + return resolved; +} + +void main() { + vec3 rayO = vec3(0); + vec3 rayD = vec3(0); + vec3 fragColor = vec3(0); + + { + #if !MULTISAMPLING + float depth = subpassLoad(samplerDepth).r; + #else + float depth = resolve( samplerDepth ).r; + #endif + + vec4 positionClip = vec4(inUv * 2.0 - 1.0, depth, 1.0); + vec4 positionEye = ubo.matrices.iProjection[inPushConstantPass] * positionClip; + positionEye /= positionEye.w; + position.eye = positionEye.xyz; + + vec4 positionWorld = ubo.matrices.iView[inPushConstantPass] * positionEye; + position.world = positionWorld.xyz; + } + { + vec4 near4 = ubo.matrices.iProjectionView[inPushConstantPass] * (vec4(2.0 * inUv - 1.0, -1.0, 1.0)); + vec4 far4 = ubo.matrices.iProjectionView[inPushConstantPass] * (vec4(2.0 * inUv - 1.0, 1.0, 1.0)); + vec3 near3 = near4.xyz / near4.w; + vec3 far3 = far4.xyz / far4.w; + + rayO = near3; + } + { + mat4 iProjectionView = inverse( ubo.matrices.projection[inPushConstantPass] * mat4(mat3(ubo.matrices.view[inPushConstantPass])) ); + vec4 near4 = iProjectionView * (vec4(2.0 * inUv - 1.0, -1.0, 1.0)); + vec4 far4 = iProjectionView * (vec4(2.0 * inUv - 1.0, 1.0, 1.0)); + vec3 near3 = near4.xyz / near4.w; + vec3 far3 = far4.xyz / far4.w; + + rayD = normalize( far3 - near3 ); + } +#if !MULTISAMPLING + normal.eye = decodeNormals( subpassLoad(samplerNormal).xy ); + uvec2 ID = subpassLoad(samplerId).xy; +#else + normal.eye = decodeNormals( resolve(samplerNormal).xy ); + uvec2 ID = resolve(samplerId).xy; +#endif + uint drawId = ID.x; + uint materialId = ID.y; + if ( drawId == 0 || materialId == 0 ) { + fragColor.rgb = texture( samplerSkybox, rayD ).rgb; + fog(rayO, rayD, fragColor, 0.0); + outFragColor = vec4(fragColor,1); + return; + } + --drawId; + --materialId; + + DrawCall drawCall = drawCalls[drawId]; + materialId += drawCall.materialIndex; + + Material material = materials[materialId]; + vec4 C = material.colorBase; + +#if UF_DEFERRED_SAMPLING +#if !MULTISAMPLING + vec2 uv = subpassLoad(samplerUv).xy; +#else + vec2 uv = resolve(samplerUv).xy; +#endif + C = sampleTexture( drawId, drawCall.textureIndex + material.indexAlbedo, uv, C ); + // OPAQUE + if ( material.modeAlpha == 0 ) { + C.a = 1; + // BLEND + } else if ( material.modeAlpha == 1 ) { + + // MASK + } else if ( material.modeAlpha == 2 ) { + + } +#else +#if !MULTISAMPLING + C = subpassLoad(samplerAlbedo); +#else + C = resolve(samplerAlbedo); +#endif +#endif + + float M = material.factorMetallic; + float R = material.factorRoughness * 4.0; + float AO = material.factorOcclusion; + + bool usePbr = true; + bool gammaCorrect = false; + float litFactor = 1.0; + fragColor = C.rgb * ubo.ambient.rgb * AO; + for ( uint i = 0; i < ubo.lights; ++i ) { + Light light = lights[i]; + + if ( light.power <= 0.001 ) continue; + + vec3 lightPositionWorld = light.position.xyz; + light.position.xyz = vec3(ubo.matrices.view[inPushConstantPass] * vec4(light.position.xyz, 1)); + + if ( 0 <= light.mapIndex && light.mapIndex < TEXTURES ) { + float factor = shadowFactor( light, light.mapIndex ); + // if ( factor <= 0.0001 ) continue; + light.power *= factor; + litFactor += light.power; + } + if ( light.power <= 0.0001 ) continue; + + if ( usePbr ) { + pbr( light, C.rgb, M, R, lightPositionWorld, fragColor ); + } else + phong( light, C, fragColor ); + } + if ( gammaCorrect ) { + fragColor = fragColor / (fragColor + vec3(1.0)); + fragColor = pow(fragColor, vec3(1.0/2.2)); + } + + fog(rayO, rayD, fragColor, litFactor); + +/* + if ( (ubo.mode.type & (0x1 << 0)) == (0x1 << 0) ) { + //dither1(fragColor); + fragColor += dither2(); + } +*/ + if ( (ubo.mode.type & (0x1 << 1)) == (0x1 << 1) ) { + whitenoise(fragColor); + } + outFragColor = vec4(fragColor,1); +} \ No newline at end of file diff --git a/bin/data/shaders/display/subpass.old.frag.glsl b/bin/data/shaders/display/subpass.old.frag.glsl new file mode 100644 index 00000000..705a45d0 --- /dev/null +++ b/bin/data/shaders/display/subpass.old.frag.glsl @@ -0,0 +1,559 @@ +#version 450 +#extension GL_EXT_samplerless_texture_functions : require + +layout (constant_id = 0) const uint LIGHTS = 256; + +layout (input_attachment_index = 0, binding = 1) uniform subpassInput samplerAlbedoMetallic; +layout (input_attachment_index = 0, binding = 2) uniform subpassInput samplerNormalRoughness; +layout (input_attachment_index = 0, binding = 3) uniform subpassInput samplerDepth; + +layout (binding = 5) uniform sampler3D samplerNoise; +layout (binding = 6) uniform sampler2D samplerShadows[LIGHTS]; + +layout (location = 0) in vec2 inUv; +layout (location = 1) in flat uint inPushConstantPass; + +layout (location = 0) out vec4 outFragColor; + +/* +const vec2 poissonDisk[4] = vec2[]( + vec2( -0.94201624, -0.39906216 ), + vec2( 0.94558609, -0.76890725 ), + vec2( -0.094184101, -0.92938870 ), + vec2( 0.34495938, 0.29387760 ) +); +*/ +vec2 poissonDisk[16] = vec2[]( + vec2( -0.94201624, -0.39906216 ), + vec2( 0.94558609, -0.76890725 ), + vec2( -0.094184101, -0.92938870 ), + vec2( 0.34495938, 0.29387760 ), + vec2( -0.91588581, 0.45771432 ), + vec2( -0.81544232, -0.87912464 ), + vec2( -0.38277543, 0.27676845 ), + vec2( 0.97484398, 0.75648379 ), + vec2( 0.44323325, -0.97511554 ), + vec2( 0.53742981, -0.47373420 ), + vec2( -0.26496911, -0.41893023 ), + vec2( 0.79197514, 0.19090188 ), + vec2( -0.24188840, 0.99706507 ), + vec2( -0.81409955, 0.91437590 ), + vec2( 0.19984126, 0.78641367 ), + vec2( 0.14383161, -0.14100790 ) +); + +struct Light { + vec3 position; + float radius; + + vec3 color; + float power; + + int type; + float depthBias; + float padding1; + float padding2; + + mat4 view; + mat4 projection; +}; + +struct Matrices { + mat4 view[2]; + mat4 projection[2]; +}; + +struct Space { + vec3 eye; + vec3 world; +} position, normal, view; + +struct Fog { + vec3 color; + float stepScale; + + vec3 offset; + float densityScale; + + float densityThreshold; + float densityMultiplier; + float absorbtion; + float padding1; + + vec2 range; + float padding2; + float padding3; +}; + +struct Mode { + uint type; + uint scalar; + vec2 padding; + vec4 parameters; +}; + +layout (binding = 0) uniform UBO { + Matrices matrices; + vec3 ambient; + float kexp; + Mode mode; + Fog fog; + Light lights[LIGHTS]; +} ubo; + +void phong( Light light, vec4 albedoSpecular, inout vec3 i ) { + vec3 Ls = vec3(1.0, 1.0, 1.0); // light specular + vec3 Ld = light.color; // light color + vec3 La = vec3(1.0, 1.0, 1.0); + + vec3 Ks = vec3(albedoSpecular.a); // material specular + vec3 Kd = albedoSpecular.rgb; // material diffuse + vec3 Ka = vec3(1.0, 1.0, 1.0); + + float Kexp = ubo.kexp; + + vec3 V = position.eye; + vec3 N = normal.eye; + vec3 L = light.position.xyz - V; + float dist = length(L); +// if ( light.radius > 0.001 && light.radius < dist ) return; + + vec3 D = normalize(L); + float d_dot = max(dot( D, N ), 0.0); + + vec3 R = reflect( -D, N ); + vec3 S = normalize(-V); + float s_factor = pow( max(dot( R, S ), 0.0), Kexp ); + if ( Kexp < 0.0001 ) s_factor = 0; + + float radiance = light.power / (dist * dist); + + vec3 Ia = La * Ka; + vec3 Id = Ld * Kd * d_dot * radiance; + vec3 Is = Ls * Ks * s_factor * radiance; + + i += Id + Is; +} + +const float PI = 3.14159265359; +float DistributionGGX(vec3 N, vec3 H, float roughness) { + float a = roughness*roughness; + float a2 = a*a; + float NdotH = max(dot(N, H), 0.0); + float NdotH2 = NdotH*NdotH; + + float num = a2; + float denom = (NdotH2 * (a2 - 1.0) + 1.0); + denom = PI * denom * denom; + + return num / denom; +} + +float GeometrySchlickGGX(float NdotV, float roughness) { + float r = (roughness + 1.0); + float k = (r*r) / 8.0; + + float num = NdotV; + float denom = NdotV * (1.0 - k) + k; + + return num / denom; +} +float GeometrySmith(vec3 N, vec3 V, vec3 L, float roughness) { + float NdotV = max(dot(N, V), 0.0); + float NdotL = max(dot(N, L), 0.0); + float ggx2 = GeometrySchlickGGX(NdotV, roughness); + float ggx1 = GeometrySchlickGGX(NdotL, roughness); + + return ggx1 * ggx2; +} +vec3 fresnelSchlick(float cosTheta, vec3 F0) { + return F0 + (1.0 - F0) * pow(1.0 - cosTheta, 5.0); +} + +float random(vec3 seed, int i){ + vec4 seed4 = vec4(seed,i); + float dot_product = dot(seed4, vec4(12.9898,78.233,45.164,94.673)); + return fract(sin(dot_product) * 43758.5453); +} + +float shadowFactor( Light light, uint shadowMap ) { + vec4 positionClip = light.projection * light.view * vec4(position.world, 1.0); + positionClip.xyz /= positionClip.w; + + if ( positionClip.x < -1 || positionClip.x >= 1 ) return 0.0; + if ( positionClip.y < -1 || positionClip.y >= 1 ) return 0.0; + if ( positionClip.z <= 0 || positionClip.z >= 1 ) return 0.0; + + float factor = 1.0; + + // spot light + if ( light.type == -2 || light.type == -3 ) { + float dist = length( positionClip.xy ); + if ( dist > 0.5 ) return 0.0; + + // spot light with attenuation + if ( light.type == -3 ) { + factor = 1.0 - (pow(dist * 2,2.0)); + } + } + + vec2 uv = positionClip.xy * 0.5 + 0.5; + float bias = light.depthBias; + if ( !true ) { + float cosTheta = clamp(dot(normal.eye, normalize(light.position.xyz - position.eye)), 0, 1); + bias = clamp(bias * tan(acos(cosTheta)), 0, 0.01); + } else if ( true ) { + bias = max(bias * 10 * (1.0 - dot(normal.eye, normalize(light.position.xyz - position.eye))), bias); + } + + float eyeDepth = positionClip.z; + int samples = poissonDisk.length(); + if ( samples <= 1 ) { + return eyeDepth < texture(samplerShadows[shadowMap], uv).r - bias ? 0.0 : factor; + } + for ( int i = 0; i < samples; ++i ) { + // int index = i; + // int index = int( float(samples) * random(gl_FragCoord.xyy, i) ) % samples; + int index = int( float(samples) * random(floor(position.world.xyz * 1000.0), i)) % samples; + float lightDepth = texture(samplerShadows[shadowMap], uv + poissonDisk[index] / 700.0 ).r; + if ( eyeDepth < lightDepth - bias ) factor -= 1.0 / samples; + } + return factor; +} +vec3 hslToRgb(vec3 HSL) { + vec3 RGB; { + float H = HSL.x; + float R = abs(H * 6 - 3) - 1; + float G = 2 - abs(H * 6 - 2); + float B = 2 - abs(H * 6 - 4); + RGB = clamp(vec3(R,G,B), 0, 1); + } + float C = (1 - abs(2 * HSL.z - 1)) * HSL.y; + return (RGB - 0.5) * C + HSL.z; +} +vec3 rgbToHsl(vec3 RGB) { + float Epsilon = 1e-10; + vec3 HCV; { + vec4 P = (RGB.g < RGB.b) ? vec4(RGB.bg, -1.0, 2.0/3.0) : vec4(RGB.gb, 0.0, -1.0/3.0); + vec4 Q = (RGB.r < P.x) ? vec4(P.xyw, RGB.r) : vec4(RGB.r, P.yzx); + float C = Q.x - min(Q.w, Q.y); + float H = abs((Q.w - Q.y) / (6 * C + Epsilon) + Q.z); + HCV = vec3(H, C, Q.x); + } + float L = HCV.z - HCV.y * 0.5; + float S = HCV.y / (1 - abs(L * 2 - 1) + Epsilon); + return vec3(HCV.x, S, L); +} + +float hueDistance(float h1, float h2) { + float diff = abs((h1 - h2)); + return min(abs((1.0 - diff)), diff); +} +const float lightnessSteps = 4.0; +float lightnessStep(float l) { + return floor((0.5 + l * lightnessSteps)) / lightnessSteps; +} +const int indexMatrix16x16[256] = int[](0,192, 48,240, 12,204, 60,252, 3,195, 51,243, 15,207, 63,255, + 128, 64,176,112,140, 76,188,124,131, 67,179,115,143, 79,191,127, + 32,224, 16,208, 44,236, 28,220, 35,227, 19,211, 47,239, 31,223, + 160, 96,144, 80,172,108,156, 92,163, 99,147, 83,175,111,159, 95, + 8,200, 56,248, 4,196, 52,244, 11,203, 59,251, 7,199, 55,247, + 136, 72,184,120,132, 68,180,116,139, 75,187,123,135, 71,183,119, + 40,232, 24,216, 36,228, 20,212, 43,235, 27,219, 39,231, 23,215, + 168,104,152, 88,164,100,148, 84,171,107,155, 91,167,103,151, 87, + 2,194, 50,242, 14,206, 62,254, 1,193, 49,241, 13,205, 61,253, + 130, 66,178,114,142, 78,190,126,129, 65,177,113,141, 77,189,125, + 34,226, 18,210, 46,238, 30,222, 33,225, 17,209, 45,237, 29,221, + 162, 98,146, 82,174,110,158, 94,161, 97,145, 81,173,109,157, 93, + 10,202, 58,250, 6,198, 54,246, 9,201, 57,249, 5,197, 53,245, + 138, 74,186,122,134, 70,182,118,137, 73,185,121,133, 69,181,117, + 42,234, 26,218, 38,230, 22,214, 41,233, 25,217, 37,229, 21,213, + 170,106,154, 90,166,102,150, 86,169,105,153, 89,165,101,149, 85); +float indexValue16x16( float scale ) { + int x = int(mod(gl_FragCoord.x * scale, 16)); + int y = int(mod(gl_FragCoord.y * scale, 16)); + return indexMatrix16x16[(x + y * 16)] / 256.0; +} +const int indexMatrix8x8[64] = int[](0, 32, 8, 40, 2, 34, 10, 42, + 48, 16, 56, 24, 50, 18, 58, 26, + 12, 44, 4, 36, 14, 46, 6, 38, + 60, 28, 52, 20, 62, 30, 54, 22, + 3, 35, 11, 43, 1, 33, 9, 41, + 51, 19, 59, 27, 49, 17, 57, 25, + 15, 47, 7, 39, 13, 45, 5, 37, + 63, 31, 55, 23, 61, 29, 53, 21); +float indexValue8x8( float scale ) { + int x = int(mod(gl_FragCoord.x * scale, 8)); + int y = int(mod(gl_FragCoord.y * scale, 8)); + return indexMatrix8x8[(x + y * 8)] / 64.0; +} +const int indexMatrix4x4[16] = int[](0, 8, 2, 10, + 12, 4, 14, 6, + 3, 11, 1, 9, + 15, 7, 13, 5); +float indexValue4x4( float scale ) { + int x = int(mod(gl_FragCoord.x * scale, 4)); + int y = int(mod(gl_FragCoord.y * scale, 4)); + return indexMatrix4x4[(x + y * 4)] / 16.0; +} +vec3[2] closestColors(float hue) { + vec3 ret[2]; + vec3 closest = vec3(-2, 0, 0); + vec3 secondClosest = vec3(-2, 0, 0); + vec3 temp; +/* + for (int i = 0; i < palette.length(); ++i) { + temp = rgbToHsl(palette[i].rgb); + float tempDistance = hueDistance(temp.x, hue); + if (tempDistance < hueDistance(closest.x, hue)) { + secondClosest = closest; + closest = temp; + } else { + if (tempDistance < hueDistance(secondClosest.x, hue)) { + secondClosest = temp; + } + } + } +*/ + ret[0] = closest; + ret[1] = secondClosest; + return ret; +} +float dither(float color) { + float closestColor = (color < 0.5) ? 0 : 1; + float secondClosestColor = 1 - closestColor; + float d = 1; // -0.5 - fract(ubo.mode.parameters.w / 8.0); + if ( ubo.mode.scalar == 16 ) { + d = indexValue16x16(1); + } else if ( ubo.mode.scalar == 8 ) { + d = indexValue8x8(1); + } else if ( ubo.mode.scalar == 4 ) { + d = indexValue4x4(1); + } + float distance = abs(closestColor - color); + return (distance < d) ? closestColor : secondClosestColor; +} +void dither(inout vec3 color) { + vec3 hsl = rgbToHsl(color); + hsl.x = dither(hsl.x); + color = hslToRgb(hsl); +} +void dither1(inout vec3 color) { + vec3 hsl = rgbToHsl(color); + + float d = 0; + vec3 cs[2] = { hsl, hsl }; // closestColors(hsl.x); + float scale = 1; + if ( ubo.mode.scalar == 16 ) { + d = indexValue16x16(scale); + } else if ( ubo.mode.scalar == 8 ) { + d = indexValue8x8(scale); + } else if ( ubo.mode.scalar == 4 ) { + d = indexValue4x4(scale); + } + float hueDiff = hueDistance(hsl.x, cs[0].x) / hueDistance(cs[1].x, cs[0].x); + float l1 = lightnessStep(max((hsl.z - 0.125), 0.0)); + float l2 = lightnessStep(min((hsl.z + 0.124), 1.0)); + float lightnessDiff = (hsl.z - l1) / (l2 - l1); + + vec3 resultColor = (hueDiff < d) ? cs[0] : cs[1]; + resultColor.z = (lightnessDiff < d) ? l1 : l2; + color = hslToRgb(resultColor); +} +vec3 dither2() { + vec3 vDither = dot( vec2( 171.0, 231.0 ), inUv.xy + ubo.mode.parameters.w ).xxx; + vDither.rgb = fract( vDither.rgb / vec3( 103.0, 71.0, 97.0 ) ) - vec3( 0.5, 0.5, 0.5 ); + return ( vDither.rgb / 255.0 ) * 0.375; +} + +float rand2(vec2 co){ + return fract(sin(dot(co.xy ,vec2(12.9898,78.233))) * 143758.5453); +} +float rand3(vec3 co){ + return fract(sin(dot(co.xyz ,vec3(12.9898,78.233, 37.719))) * 143758.5453); +} +void whitenoise(inout vec3 color) { + float flicker = ubo.mode.parameters.x; + float pieces = ubo.mode.parameters.y; + float blend = ubo.mode.parameters.z; + float time = ubo.mode.parameters.w; + if ( blend < 0.0001 ) return; + float freq = sin(pow(mod(time, flicker) + flicker, 1.9)); +// float whiteNoise = rand3( floor(position.world / pieces) + floor(time * 2) ); + float whiteNoise = rand2( floor(gl_FragCoord.xy / pieces) + mod(time, freq) ); + color = mix( color, vec3(whiteNoise), blend ); +} + +void pbr( Light light, vec3 albedo, float metallic, float roughness, vec3 lightPositionWorld, inout vec3 i ) { + vec3 F0 = vec3(0.04); + F0 = mix(F0, albedo, metallic); + + vec3 N = normalize(normal.eye); + vec3 L = light.position.xyz - position.eye; + float dist = length(L); +// if ( light.radius > 0.001 && light.radius < dist ) return; + + vec3 D = normalize(L); + vec3 V = normalize(-position.eye); + vec3 H = normalize(V + D); + + float NdotD = max(dot(N, D), 0.0); + float NdotV = max(dot(N, V), 0.0); + + vec3 radiance = light.color.rgb * light.power / (dist * dist); +/* + if ( light.radius > 0.0001 ) { + radiance *= clamp( light.radius / (pow(dist, 2.0) + 1.0), 0.0, 1.0 ); + } else if ( false ) { + radiance /= dist * dist; + } +*/ + + // cook-torrance brdf + float NDF = DistributionGGX(N, H, roughness); + float G = GeometrySmith(N, V, D, roughness); + vec3 F = fresnelSchlick(max(dot(H, V), 0.0), F0); + + vec3 kS = F; + vec3 kD = vec3(1.0) - kS; + kD *= 1.0 - metallic; + + vec3 numerator = NDF * G * F; + float denominator = 4.0 * NdotV * NdotD; + vec3 specular = numerator / max(denominator, 0.001); + + // add to outgoing radiance Lo + i += (kD * albedo / PI + specular) * radiance * NdotD; +} + +vec2 rayBoxDst( vec3 boundsMin, vec3 boundsMax, vec3 rayOrigin, vec3 rayDir ) { + vec3 t0 = (boundsMin - rayOrigin) / rayDir; + vec3 t1 = (boundsMax - rayOrigin) / rayDir; + vec3 tmin = min(t0, t1); + vec3 tmax = max(t0, t1); + float dstA = max( max(tmin.x, tmin.y), tmin.z ); + float dstB = min( tmax.x, min(tmax.y, tmax.z) ); + float dstToBox = max(0, dstA); + float dstInsideBox = max(0, dstB - dstToBox); + return vec2(dstToBox, dstInsideBox); +} + +float sampleDensity( vec3 position ) { + vec3 uvw = position * ubo.fog.densityScale * 0.001 + ubo.fog.offset * 0.01; + return max(0, texture(samplerNoise, uvw).r - ubo.fog.densityThreshold) * ubo.fog.densityMultiplier; +} + +void fog( inout vec3 i, float scale ) { + if ( ubo.fog.stepScale <= 0 ) return; + if ( ubo.fog.range.x == 0 || ubo.fog.range.y == 0 ) return; + + mat4 iProjView = inverse( ubo.matrices.projection[inPushConstantPass] * ubo.matrices.view[inPushConstantPass] ); + vec4 near4 = iProjView * (vec4(2.0 * inUv - 1.0, -1.0, 1.0)); + vec4 far4 = iProjView * (vec4(2.0 * inUv - 1.0, 1.0, 1.0)); + vec3 near3 = near4.xyz / near4.w; + vec3 far3 = far4.xyz / far4.w; + + vec3 rayOrigin = near3; + vec3 rayDir = normalize( far3 - near3 ); + + float range = ubo.fog.range.y; + vec3 boundsMin = vec3(-range,-range,-range) + rayOrigin; + vec3 boundsMax = vec3(range,range,range) + rayOrigin; + int numSteps = int(length(boundsMax - boundsMin) * ubo.fog.stepScale ); + + vec2 rayBoxInfo = rayBoxDst( boundsMin, boundsMax, rayOrigin, rayDir ); + float dstToBox = rayBoxInfo.x; + float dstInsideBox = rayBoxInfo.y; + float depth = position.eye.z; + + float lightEnergy = 0; + // march + if ( 0 <= dstInsideBox && dstToBox <= depth ) { + float dstTravelled = 0; + float stepSize = dstInsideBox / numSteps; + float dstLimit = min( depth - dstToBox, dstInsideBox ); + float totalDensity = 0; + float transmittance = 1; + while ( dstTravelled < dstLimit ) { + vec3 rayPos = rayOrigin + rayDir * (dstToBox + dstTravelled); + float density = sampleDensity(rayPos); + if ( density > 0 ) { + transmittance *= exp(-density * stepSize * ubo.fog.absorbtion); + if ( transmittance < 0.01 ) break; + } + dstTravelled += stepSize; + } + i.rgb = mix(ubo.fog.color.rgb, i.rgb, transmittance); + } + + vec3 color = ubo.fog.color.rgb; + float inner = ubo.fog.range.x; + float outer = ubo.fog.range.y * scale; + float distance = length(-position.eye); + float factor = (distance - inner) / (outer - inner); + factor = clamp( factor, 0.0, 1.0 ); + + i.rgb = mix(i.rgb, color, factor); +} + +void main() { + vec4 albedoMetallic = subpassLoad(samplerAlbedoMetallic); + vec4 normalRoughness = subpassLoad(samplerNormalRoughness); +// vec4 positionAO = subpassLoad(samplerPositionAO); + + normal.eye = normalRoughness.rgb; + { + mat4 iProj = inverse( ubo.matrices.projection[inPushConstantPass] ); + mat4 iView = inverse( ubo.matrices.view[inPushConstantPass] ); + float depth = subpassLoad(samplerDepth).r; + + vec4 positionClip = vec4(inUv * 2.0 - 1.0, depth, 1.0); + vec4 positionEye = iProj * positionClip; + positionEye /= positionEye.w; + position.eye = positionEye.xyz; + + vec4 positionWorld = iView * positionEye; + position.world = positionWorld.xyz; + } + + bool usePbr = true; + bool gammaCorrect = false; + float litFactor = 1.0; + float ao = 1; // positionAO.a; + vec3 fragColor = albedoMetallic.rgb * ubo.ambient.rgb * ao; + for ( uint i = 0; i < LIGHTS; ++i ) { + Light light = ubo.lights[i]; + + if ( light.power <= 0.001 ) continue; + vec3 lightPositionWorld = light.position.xyz; + light.position.xyz = vec3(ubo.matrices.view[inPushConstantPass] * vec4(light.position.xyz, 1)); + if ( light.type < 0 ) { + float factor = shadowFactor( light, i ); + if ( factor <= 0.0001 ) continue; + light.power *= factor; + litFactor += light.power; + } + if ( usePbr ) { + pbr( light, albedoMetallic.rgb, albedoMetallic.a, normalRoughness.a, lightPositionWorld, fragColor ); + } else + phong( light, albedoMetallic, fragColor ); + } + + if ( gammaCorrect ) { + fragColor = fragColor / (fragColor + vec3(1.0)); + fragColor = pow(fragColor, vec3(1.0/2.2)); + } + + fog(fragColor, litFactor); + +/* + if ( (ubo.mode.type & (0x1 << 0)) == (0x1 << 0) ) { + //dither1(fragColor); + fragColor += dither2(); + } + if ( (ubo.mode.type & (0x1 << 1)) == (0x1 << 1) ) { + whitenoise(fragColor); + } +*/ + outFragColor = vec4(fragColor,1); +} \ No newline at end of file diff --git a/bin/data/shaders/display/subpass.vert.glsl b/bin/data/shaders/display/subpass.vert.glsl new file mode 100644 index 00000000..72ebf0a1 --- /dev/null +++ b/bin/data/shaders/display/subpass.vert.glsl @@ -0,0 +1,24 @@ +#version 450 + +layout (location = 0) in vec2 inPos; +layout (location = 1) in vec2 inUv; + +layout (location = 0) out vec2 outUv; +layout (location = 1) out flat uint outPushConstantPass; + +layout( push_constant ) uniform PushBlock { + uint pass; + uint draw; +} PushConstant; + +out gl_PerVertex { + vec4 gl_Position; +}; + + +void main() { + outUv = inUv; + outPushConstantPass = PushConstant.pass; + + gl_Position = vec4(inPos.xy, 0.0, 1.0); +} \ No newline at end of file diff --git a/bin/data/shaders/display/vert.glsl b/bin/data/shaders/display/vert.glsl new file mode 100644 index 00000000..9d3a6de8 --- /dev/null +++ b/bin/data/shaders/display/vert.glsl @@ -0,0 +1,17 @@ +#version 450 + +layout (location = 0) in vec2 inPos; +layout (location = 1) in vec2 inUv; + +layout (location = 0) out vec2 outUv; + +out gl_PerVertex { + vec4 gl_Position; +}; + + +void main() { + outUv = inUv; + + gl_Position = vec4(inPos.xy, 0.0, 1.0); +} \ No newline at end of file diff --git a/bin/data/shaders/gltf/frag.glsl b/bin/data/shaders/gltf/frag.glsl new file mode 100644 index 00000000..d96ffad7 --- /dev/null +++ b/bin/data/shaders/gltf/frag.glsl @@ -0,0 +1,138 @@ +#version 450 + +#define UF_DEFERRED_SAMPLING 0 +#define UF_CAN_DISCARD 1 + +layout (constant_id = 0) const uint TEXTURES = 1; +layout (binding = 0) uniform sampler2D samplerTextures[TEXTURES]; + +struct Material { + vec4 colorBase; + vec4 colorEmissive; + + float factorMetallic; + float factorRoughness; + float factorOcclusion; + float factorAlphaCutoff; + + int indexAlbedo; + int indexNormal; + int indexEmissive; + int indexOcclusion; + + int indexMetallicRoughness; + int modeAlpha; + int padding1; + int padding2; +}; +struct Texture { + int index; + int samp; + int remap; + float blend; + + vec4 lerp; +}; +layout (std140, binding = 1) readonly buffer Materials { + Material materials[]; +}; +layout (std140, binding = 2) readonly buffer Textures { + Texture textures[]; +}; + +layout (location = 0) in vec2 inUv; +layout (location = 1) in vec4 inColor; +layout (location = 2) in vec3 inNormal; +layout (location = 3) in mat3 inTBN; +layout (location = 6) in vec3 inPosition; +layout (location = 7) flat in ivec4 inId; + +layout (location = 0) out uvec2 outId; +layout (location = 1) out vec2 outNormals; +#if UF_DEFERRED_SAMPLING + layout (location = 2) out vec2 outUvs; +#else + layout (location = 2) out vec4 outAlbedo; +#endif + +vec2 encodeNormals( vec3 n ) { + float p = sqrt(n.z*8+8); + return n.xy/p + 0.5; +} + +float wrap( float i ) { + return fract(i); +} +vec2 wrap( vec2 uv ) { + return vec2( wrap( uv.x ), wrap( uv.y ) ); +} +float mipLevel( in vec2 uv ) { + vec2 dx_vtc = dFdx(uv); + vec2 dy_vtc = dFdy(uv); + return 0.5 * log2(max(dot(dx_vtc, dx_vtc), dot(dy_vtc, dy_vtc))); +} +bool validTextureIndex( int textureIndex ) { + return 0 <= textureIndex && textureIndex < TEXTURES; +} +void main() { + float mip = mipLevel(inUv.xy); + vec2 uv = wrap(inUv.xy); + vec4 C = vec4(0, 0, 0, 0); + vec3 P = inPosition; + vec3 N = inNormal; +#if UF_DEFERRED_SAMPLING + outUvs = wrap(inUv.xy); + vec4 outAlbedo = vec4(0,0,0,0); +#endif +#if !UF_DEFERRED_SAMPLING || UF_CAN_DISCARD + int materialId = int(inId.y); + Material material = materials[materialId]; + + float M = material.factorMetallic; + float R = material.factorRoughness; + float AO = material.factorOcclusion; + + // sample albedo + if ( !validTextureIndex( material.indexAlbedo ) ) discard; { + Texture t = textures[material.indexAlbedo + 1]; + C = textureLod( samplerTextures[0], mix( t.lerp.xy, t.lerp.zw, uv ), mip ); + // alpha mode OPAQUE + if ( material.modeAlpha == 0 ) { + C.a = 1; + // alpha mode BLEND + } else if ( material.modeAlpha == 1 ) { + + // alpha mode MASK + } else if ( material.modeAlpha == 2 ) { + if ( C.a < abs(material.factorAlphaCutoff) ) discard; + C.a = 1; + } + if ( C.a == 0 ) discard; + } +#endif +#if !UF_DEFERRED_SAMPLING + // sample normal + if ( validTextureIndex( material.indexNormal ) ) { + Texture t = textures[material.indexNormal + 1]; + N = inTBN * normalize( textureLod( samplerTextures[0], mix( t.lerp.xy, t.lerp.zw, uv ), mip ).xyz * 2.0 - vec3(1.0)); + } + #if 0 + // sample metallic/roughness + if ( validTextureIndex( material.indexMetallicRoughness ) ) { + Texture t = textures[material.indexMetallicRoughness + 1]; + vec4 sampled = texture( samplerTextures[0], mix( t.lerp.xy, t.lerp.zw, uv ), mip ); + M = sampled.b; + R = sampled.g; + } + // sample ao + AO = material.factorOcclusion; + if ( validTextureIndex( material.indexOcclusion ) ) { + Texture t = textures[material.indexMetallicRoughness + 1]; + AO = texture( samplerTextures[0], mix( t.lerp.xy, t.lerp.zw, uv ) ).r; + } + #endif + outAlbedo = C * inColor; +#endif + outNormals = encodeNormals( N ); + outId = ivec2(inId.w+1, inId.y+1); +} \ No newline at end of file diff --git a/bin/data/shaders/gltf/instanced.vert.glsl b/bin/data/shaders/gltf/instanced.vert.glsl new file mode 100644 index 00000000..8af8a834 --- /dev/null +++ b/bin/data/shaders/gltf/instanced.vert.glsl @@ -0,0 +1,62 @@ +#version 450 + +layout (constant_id = 0) const uint PASSES = 6; +layout (location = 0) in vec3 inPos; +layout (location = 1) in vec2 inUv; +layout (location = 2) in vec3 inNormal; +layout (location = 3) in vec4 inTangent; +layout (location = 4) in ivec2 inId; + +layout( push_constant ) uniform PushBlock { + uint pass; + uint draw; +} PushConstant; + +layout (binding = 3) uniform UBO { + mat4 view[PASSES]; + mat4 projection[PASSES]; +} ubo; + +layout (std140, binding = 4) readonly buffer Models { + mat4 models[]; +}; + +layout (location = 0) out vec2 outUv; +layout (location = 1) out vec4 outColor; +layout (location = 2) out vec3 outNormal; +layout (location = 3) out mat3 outTBN; +layout (location = 6) out vec3 outPosition; +layout (location = 7) out ivec4 outId; + +out gl_PerVertex { + vec4 gl_Position; +}; + +vec4 snap(vec4 vertex, vec2 resolution) { + vec4 snappedPos = vertex; + snappedPos.xyz = vertex.xyz / vertex.w; + snappedPos.xy = floor(resolution * snappedPos.xy) / resolution; + snappedPos.xyz *= vertex.w; + return snappedPos; +} + +void main() { + outUv = inUv; + outColor = vec4(1.0); + outId = ivec4(inId, PushConstant.pass, PushConstant.draw); + + mat4 model = models.length() <= 0 ? mat4(1.0) : models[int(inId.x)]; + outPosition = vec3(ubo.view[PushConstant.pass] * model * vec4(inPos.xyz, 1.0)); + outNormal = vec3(ubo.view[PushConstant.pass] * model * vec4(inNormal.xyz, 0.0)); + outNormal = normalize(outNormal); + + { + vec3 T = vec3(ubo.view[PushConstant.pass] * model * vec4(inTangent.xyz, 0.0)); + vec3 N = outNormal; + vec3 B = cross(N, T) * inTangent.w; + outTBN = mat3( T, B, N ); + } + + gl_Position = ubo.projection[PushConstant.pass] * ubo.view[PushConstant.pass] * model * vec4(inPos.xyz, 1.0); +// gl_Position = snap( gl_Position, vec2(256.0, 224.0) ); +} \ No newline at end of file diff --git a/bin/data/shaders/gltf/skinned.instanced.vert.glsl b/bin/data/shaders/gltf/skinned.instanced.vert.glsl new file mode 100644 index 00000000..9b777ee0 --- /dev/null +++ b/bin/data/shaders/gltf/skinned.instanced.vert.glsl @@ -0,0 +1,74 @@ +#version 450 + +layout (constant_id = 0) const uint PASSES = 6; +layout (location = 0) in vec3 inPos; +layout (location = 1) in vec2 inUv; +layout (location = 2) in vec3 inNormal; +layout (location = 3) in vec4 inTangent; +layout (location = 4) in ivec2 inId; +layout (location = 5) in ivec4 inJoints; +layout (location = 6) in vec4 inWeights; + +layout( push_constant ) uniform PushBlock { + uint pass; + uint draw; +} PushConstant; + +layout (binding = 3) uniform UBO { + mat4 view[PASSES]; + mat4 projection[PASSES]; +} ubo; + +layout (std140, binding = 4) readonly buffer Models { + mat4 models[]; +}; + +layout (std140, binding = 5) readonly buffer Joints { + mat4 joints[]; +}; + +layout (location = 0) out vec2 outUv; +layout (location = 1) out vec4 outColor; +layout (location = 2) out vec3 outNormal; +layout (location = 3) out mat3 outTBN; +layout (location = 6) out vec3 outPosition; +layout (location = 7) out ivec4 outId; + +out gl_PerVertex { + vec4 gl_Position; +}; + +vec4 snap(vec4 vertex, vec2 resolution) { + vec4 snappedPos = vertex; + snappedPos.xyz = vertex.xyz / vertex.w; + snappedPos.xy = floor(resolution * snappedPos.xy) / resolution; + snappedPos.xyz *= vertex.w; + return snappedPos; +} + +void main() { + outUv = inUv; + outColor = vec4(1.0); + outId = ivec4(inId, PushConstant.pass, PushConstant.draw); + + mat4 model = models.length() <= 0 ? mat4(1.0) : models[int(inId.x)]; + mat4 skinnedMatrix = joints.length() <= 0 ? mat4(1.0) : + inWeights.x * joints[int(inJoints.x)] + + inWeights.y * joints[int(inJoints.y)] + + inWeights.z * joints[int(inJoints.z)] + + inWeights.w * joints[int(inJoints.w)]; + + outPosition = vec3(ubo.view[PushConstant.pass] * model * skinnedMatrix * vec4(inPos.xyz, 1.0)); + outNormal = vec3(ubo.view[PushConstant.pass] * model * vec4(inNormal.xyz, 0.0)); + outNormal = normalize(outNormal); + + + { + vec3 T = vec3(ubo.view[PushConstant.pass] * model * vec4(inTangent.xyz, 0.0)); + vec3 N = outNormal; + vec3 B = cross(N, T) * inTangent.w; + outTBN = mat3( T, B, N ); + } + + gl_Position = ubo.projection[PushConstant.pass] * ubo.view[PushConstant.pass] * model * skinnedMatrix * vec4(inPos.xyz, 1.0); +} \ No newline at end of file diff --git a/bin/data/shaders/gltf/skinned.vert.glsl b/bin/data/shaders/gltf/skinned.vert.glsl new file mode 100644 index 00000000..8d03d1ec --- /dev/null +++ b/bin/data/shaders/gltf/skinned.vert.glsl @@ -0,0 +1,78 @@ +#version 450 + +layout (constant_id = 0) const uint PASSES = 6; +layout (location = 0) in vec3 inPos; +layout (location = 1) in vec2 inUv; +layout (location = 2) in vec3 inNormal; +layout (location = 3) in vec4 inTangent; +layout (location = 4) in ivec2 inId; +layout (location = 5) in ivec4 inJoints; +layout (location = 6) in vec4 inWeights; + +layout( push_constant ) uniform PushBlock { + uint pass; + uint draw; +} PushConstant; + +struct Matrices { + mat4 model; + mat4 view[PASSES]; + mat4 projection[PASSES]; +}; +layout (binding = 3) uniform UBO { + Matrices matrices; + vec4 color; +} ubo; + +layout (std140, binding = 4) readonly buffer Joints { + mat4 joints[]; +}; + + +layout (location = 0) out vec2 outUv; +layout (location = 1) out vec4 outColor; +layout (location = 2) out vec3 outNormal; +layout (location = 3) out mat3 outTBN; +layout (location = 6) out vec3 outPosition; +layout (location = 7) out ivec4 outId; + +out gl_PerVertex { + vec4 gl_Position; +}; + +vec4 snap(vec4 vertex, vec2 resolution) { + vec4 snappedPos = vertex; + snappedPos.xyz = vertex.xyz / vertex.w; + snappedPos.xy = floor(resolution * snappedPos.xy) / resolution; + snappedPos.xyz *= vertex.w; + return snappedPos; +} + +void main() { + outUv = inUv; + outColor = ubo.color; + outId = ivec4(inId, PushConstant.pass, PushConstant.draw); + + mat4 skinnedMatrix = joints.length() <= 0 ? mat4(1.0) : + inWeights.x * joints[int(inJoints.x)] + + inWeights.y * joints[int(inJoints.y)] + + inWeights.z * joints[int(inJoints.z)] + + inWeights.w * joints[int(inJoints.w)]; + + outPosition = vec3(ubo.matrices.view[PushConstant.pass] * ubo.matrices.model * skinnedMatrix * vec4(inPos.xyz, 1.0)); + outNormal = vec3(ubo.matrices.view[PushConstant.pass] * ubo.matrices.model * vec4(inNormal.xyz, 0.0)); + outNormal = normalize(outNormal); + + + { + vec3 T = vec3(ubo.matrices.view[PushConstant.pass] * ubo.matrices.model * vec4(inTangent.xyz, 0.0)); + vec3 N = outNormal; + vec3 B = cross(N, T) * inTangent.w; + outTBN = mat3( T, B, N ); + } + + gl_Position = ubo.matrices.projection[PushConstant.pass] * ubo.matrices.view[PushConstant.pass] * ubo.matrices.model * skinnedMatrix * vec4(inPos.xyz, 1.0); +// gl_Position = snap( gl_Position, vec2(320.0, 240.0) ); +// gl_Position = snap( gl_Position, vec2(480.0, 270.0) ); +// gl_Position = snap( gl_Position, vec2(640.0, 480.0) ); +} \ No newline at end of file diff --git a/bin/data/shaders/gltf/vert.glsl b/bin/data/shaders/gltf/vert.glsl new file mode 100644 index 00000000..f868b307 --- /dev/null +++ b/bin/data/shaders/gltf/vert.glsl @@ -0,0 +1,64 @@ +#version 450 + +layout (constant_id = 0) const uint PASSES = 6; +layout (location = 0) in vec3 inPos; +layout (location = 1) in vec2 inUv; +layout (location = 2) in vec3 inNormal; +layout (location = 3) in vec4 inTangent; +layout (location = 4) in ivec2 inId; + +layout( push_constant ) uniform PushBlock { + uint pass; + uint draw; +} PushConstant; + +struct Matrices { + mat4 model; + mat4 view[PASSES]; + mat4 projection[PASSES]; +}; + +layout (binding = 3) uniform UBO { + Matrices matrices; + vec4 color; +} ubo; + +layout (location = 0) out vec2 outUv; +layout (location = 1) out vec4 outColor; +layout (location = 2) out vec3 outNormal; +layout (location = 3) out mat3 outTBN; +layout (location = 6) out vec3 outPosition; +layout (location = 7) out ivec4 outId; + +out gl_PerVertex { + vec4 gl_Position; +}; + +vec4 snap(vec4 vertex, vec2 resolution) { + vec4 snappedPos = vertex; + snappedPos.xyz = vertex.xyz / vertex.w; + snappedPos.xy = floor(resolution * snappedPos.xy) / resolution; + snappedPos.xyz *= vertex.w; + return snappedPos; +} + +void main() { + outUv = inUv; + outColor = ubo.color; + outId = ivec4(inId, PushConstant.pass, PushConstant.draw); + + outPosition = vec3(ubo.matrices.view[PushConstant.pass] * ubo.matrices.model * vec4(inPos.xyz, 1.0)); + outNormal = vec3(ubo.matrices.view[PushConstant.pass] * ubo.matrices.model * vec4(inNormal.xyz, 0.0)); + outNormal = normalize(outNormal); + + + { + vec3 T = vec3(ubo.matrices.view[PushConstant.pass] * ubo.matrices.model * vec4(inTangent.xyz, 0.0)); + vec3 N = outNormal; + vec3 B = cross(N, T) * inTangent.w; + outTBN = mat3( T, B, N ); + } + + gl_Position = ubo.matrices.projection[PushConstant.pass] * ubo.matrices.view[PushConstant.pass] * ubo.matrices.model * vec4(inPos.xyz, 1.0); +// gl_Position = snap( gl_Position, vec2(320.0, 240.0) ); +} \ No newline at end of file diff --git a/bin/data/shaders/gui/frag.glsl b/bin/data/shaders/gui/frag.glsl new file mode 100644 index 00000000..1dc5485a --- /dev/null +++ b/bin/data/shaders/gui/frag.glsl @@ -0,0 +1,66 @@ +#version 450 + +#define UF_DEFERRED_SAMPLING 0 +#define UF_CAN_DISCARD 1 + +layout (binding = 1) uniform sampler2D samplerTexture; + +struct Gui { + vec4 offset; + vec4 color; + int mode; + float depth; + vec2 padding; +}; + +layout (location = 0) in vec2 inUv; +layout (location = 1) in flat Gui inGui; + +layout (location = 0) out uvec2 outId; +layout (location = 1) out vec2 outNormals; +#if UF_DEFERRED_SAMPLING + layout (location = 2) out vec2 outUvs; +#else + layout (location = 2) out vec4 outAlbedo; +#endif + +vec2 encodeNormals( vec3 n ) { + float p = sqrt(n.z*8+8); + return n.xy/p + 0.5; +} +float mipLevel( in vec2 uv ) { + vec2 dx_vtc = dFdx(uv); + vec2 dy_vtc = dFdy(uv); + return 0.5 * log2(max(dot(dx_vtc, dx_vtc), dot(dy_vtc, dy_vtc))); +} + +void main() { + if ( inUv.x < inGui.offset.x ) discard; + if ( inUv.y < inGui.offset.y ) discard; + if ( inUv.x > inGui.offset.z ) discard; + if ( inUv.y > inGui.offset.w ) discard; + + float mip = mipLevel(inUv.xy); + vec2 uv = inUv.xy; + vec4 C = vec4(1, 1, 1, 1); + //vec3 N = inNormal; +#if UF_DEFERRED_SAMPLING + outUvs = wrap(inUv.xy); + vec4 outAlbedo = vec4(0,0,0,0); +#endif +#if !UF_DEFERRED_SAMPLING || UF_CAN_DISCARD + C = textureLod( samplerTexture, uv, mip ); +#endif +#if !UF_DEFERRED_SAMPLING + if ( inGui.mode == 1 ) { + C = inGui.color; + } else { + C *= inGui.color; + } + outAlbedo = C; +#endif +/* + outNormals = encodeNormals( N ); + outId = ivec2(0, 0); +*/ +} \ No newline at end of file diff --git a/bin/data/shaders/gui/text.frag.glsl b/bin/data/shaders/gui/text.frag.glsl new file mode 100644 index 00000000..520220cd --- /dev/null +++ b/bin/data/shaders/gui/text.frag.glsl @@ -0,0 +1,62 @@ +#version 450 + +#define UF_DEFERRED_SAMPLING 0 +#define UF_CAN_DISCARD 1 + +layout (binding = 1) uniform sampler2D samplerTexture; + +struct Gui { + vec4 offset; + vec4 color; + int mode; + float depth; + int sdf; + int shadowbox; + vec4 stroke; + float weight; + int spread; + float scale; + float padding; +}; + +layout (location = 0) in vec2 inUv; +layout (location = 1) in flat Gui inGui; + +layout (location = 0) out uvec2 outId; +layout (location = 1) out vec2 outNormals; +#if UF_DEFERRED_SAMPLING + layout (location = 2) out vec2 outUvs; +#else + layout (location = 2) out vec4 outAlbedo; +#endif + +void main() { + if ( inUv.x < inGui.offset.x ) discard; + if ( inUv.y < inGui.offset.y ) discard; + if ( inUv.x > inGui.offset.z ) discard; + if ( inUv.y > inGui.offset.w ) discard; + +#if UF_DEFERRED_SAMPLING + vec4 outAlbedo = vec4(0,0,0,0); +#endif + + if ( inGui.shadowbox == 1 ) { + outAlbedo = inGui.color; + return; + } + float dist = texture(samplerTexture, inUv).r; + if ( inGui.sdf == 1 ) { + float smoothing = ( inGui.spread > 0 && inGui.scale > 0 ) ? 0.25 / (inGui.spread * inGui.scale) : 0.25 / (4 * 1.5); + float outlining = smoothstep(0.5 - smoothing, 0.5 + smoothing, dist); + float alpha = smoothstep(inGui.weight - smoothing, inGui.weight + smoothing, dist); + vec4 c = inGui.color; + outAlbedo = mix(inGui.stroke, c, outlining); + outAlbedo.a = inGui.color.a * alpha; + if ( alpha < 0.001 ) discard; + if ( alpha > 1 ) discard; + } else { + outAlbedo = vec4(inGui.color) * dist; + if ( dist < 0.001 ) discard; + if ( dist > 1 ) discard; + } +} \ No newline at end of file diff --git a/bin/data/shaders/gui/text.vert.glsl b/bin/data/shaders/gui/text.vert.glsl new file mode 100644 index 00000000..487894d2 --- /dev/null +++ b/bin/data/shaders/gui/text.vert.glsl @@ -0,0 +1,47 @@ +#version 450 + +layout (constant_id = 0) const uint PASSES = 6; +layout (location = 0) in vec2 inPos; +layout (location = 1) in vec2 inUv; + +layout( push_constant ) uniform PushBlock { + uint pass; + uint draw; +} PushConstant; + +struct Matrices { + mat4 model[PASSES]; +}; +struct Gui { + vec4 offset; + vec4 color; + int mode; + float depth; + int sdf; + int shadowbox; + vec4 stroke; + float weight; + int spread; + float scale; + float padding; +}; + +layout (binding = 0) uniform UBO { + Matrices matrices; + Gui gui; +} ubo; + +layout (location = 0) out vec2 outUv; +layout (location = 1) out flat Gui outGui; + +out gl_PerVertex { + vec4 gl_Position; +}; + + +void main() { + outUv = inUv; + outGui = ubo.gui; + + gl_Position = ubo.matrices.model[PushConstant.pass] * vec4(inPos.xy, ubo.gui.depth, 1.0); +} \ No newline at end of file diff --git a/bin/data/shaders/gui/vert.glsl b/bin/data/shaders/gui/vert.glsl new file mode 100644 index 00000000..9828ff94 --- /dev/null +++ b/bin/data/shaders/gui/vert.glsl @@ -0,0 +1,41 @@ +#version 450 + +layout (constant_id = 0) const uint PASSES = 6; +layout (location = 0) in vec2 inPos; +layout (location = 1) in vec2 inUv; + +layout( push_constant ) uniform PushBlock { + uint pass; + uint draw; +} PushConstant; + +struct Matrices { + mat4 model[PASSES]; +}; +struct Gui { + vec4 offset; + vec4 color; + int mode; + float depth; + vec2 padding; +}; + +layout (binding = 0) uniform UBO { + Matrices matrices; + Gui gui; +} ubo; + +layout (location = 0) out vec2 outUv; +layout (location = 1) out flat Gui outGui; + +out gl_PerVertex { + vec4 gl_Position; +}; + + +void main() { + outUv = inUv; + outGui = ubo.gui; + + gl_Position = ubo.matrices.model[PushConstant.pass] * vec4(inPos.xy, ubo.gui.depth, 1.0); +} \ No newline at end of file diff --git a/bin/data/shaders/heightmap/frag.glsl b/bin/data/shaders/heightmap/frag.glsl new file mode 100644 index 00000000..7aa5d840 --- /dev/null +++ b/bin/data/shaders/heightmap/frag.glsl @@ -0,0 +1,19 @@ +#version 450 + +layout (binding = 1) uniform sampler2D samplerColor; + +layout (location = 0) in vec2 inUv; +layout (location = 1) in vec3 inNormal; +layout (location = 2) in vec4 inColor; + +layout (location = 0) out vec4 outAlbedoSpecular; +layout (location = 1) out vec4 outNormal; + +void main() { + outAlbedoSpecular = texture(samplerColor, inUv); + outAlbedoSpecular = vec4(1,1,1,1); + outAlbedoSpecular.rgb *= inColor.rgb; + outAlbedoSpecular.a = 1; +// outPosition = vec4(inPosition, 1.0); + outNormal = vec4(normalize(inNormal), 1.0); +} \ No newline at end of file diff --git a/bin/data/shaders/heightmap/vert.glsl b/bin/data/shaders/heightmap/vert.glsl new file mode 100644 index 00000000..f802c523 --- /dev/null +++ b/bin/data/shaders/heightmap/vert.glsl @@ -0,0 +1,52 @@ +#version 450 + +layout (constant_id = 0) const uint PASSES = 6; +layout (location = 0) in vec3 inPos; +layout (location = 1) in vec2 inUv; +layout (location = 2) in vec3 inNormal; +layout (location = 3) in uint inColor; + +layout( push_constant ) uniform PushBlock { + uint pass; + uint draw; +} PushConstant; + +struct Matrices { + mat4 model; + mat4 view[PASSES]; + mat4 projection[PASSES]; +}; + +layout (binding = 0) uniform UBO { + Matrices matrices; + vec4 color; +} ubo; + +layout (location = 0) out vec2 outUv; +layout (location = 1) out vec3 outNormal; +layout (location = 2) out vec4 outColor; + +out gl_PerVertex { + vec4 gl_Position; +}; + + +void main() { + outUv = inUv; +// outColor = ubo.color; + +// outPosition = vec3(ubo.matrices.view[PushConstant.pass] * ubo.matrices.model * vec4(inPos.xyz, 1.0)); + outNormal = vec3(ubo.matrices.view[PushConstant.pass] * ubo.matrices.model * vec4(inNormal.xyz, 0.0)); + +// outPosition = vec3(ubo.matrices.model * vec4(inPos.xyz, 1.0)); +// outNormal = vec3(ubo.matrices.model * vec4(inNormal.xyz, 0.0)); + + outColor.a = (inColor >> 24u) & 0xFF; + outColor.b = (inColor >> 16u) & 0xFF; + outColor.g = (inColor >> 8u) & 0xFF; + outColor.r = (inColor ) & 0xFF; + outColor.rgb /= 256.0; + outColor.a = 0.5; + + gl_Position = ubo.matrices.projection[PushConstant.pass] * ubo.matrices.view[PushConstant.pass] * ubo.matrices.model * vec4(inPos.xyz, 1.0); +} \ No newline at end of file diff --git a/bin/data/shaders/line/frag.glsl b/bin/data/shaders/line/frag.glsl new file mode 100644 index 00000000..b996dd27 --- /dev/null +++ b/bin/data/shaders/line/frag.glsl @@ -0,0 +1,10 @@ +#version 450 + +layout (location = 0) in vec3 inColor; + +layout (location = 0) out vec4 outAlbedoSpecular; + +void main() { + outAlbedoSpecular.rgb *= inColor.rgb; + outAlbedoSpecular.a = 1; +} \ No newline at end of file diff --git a/bin/data/shaders/line/vert.glsl b/bin/data/shaders/line/vert.glsl new file mode 100644 index 00000000..215c618f --- /dev/null +++ b/bin/data/shaders/line/vert.glsl @@ -0,0 +1,35 @@ +#version 450 + +layout (constant_id = 0) const uint PASSES = 6; +layout (location = 0) in vec3 inPos; + +layout( push_constant ) uniform PushBlock { + uint pass; + uint draw; +} PushConstant; + +struct Matrices { + mat4 model; + mat4 view[PASSES]; + mat4 projection[PASSES]; +}; + +layout (binding = 0) uniform UBO { + Matrices matrices; + vec4 color; +} ubo; + +layout (location = 0) out vec4 outColor; + +out gl_PerVertex { + vec4 gl_Position; +}; + + +void main() { + outColor = ubo.color; + +// outPosition = vec3(ubo.matrices.view[PushConstant.pass] * ubo.matrices.model * vec4(inPos.xyz, 1.0)); + + gl_Position = ubo.matrices.projection[PushConstant.pass] * ubo.matrices.view[PushConstant.pass] * ubo.matrices.model * vec4(inPos.xyz, 1.0); +} \ No newline at end of file diff --git a/bin/data/shaders/noise/frag.glsl b/bin/data/shaders/noise/frag.glsl new file mode 100644 index 00000000..2b8bc5da --- /dev/null +++ b/bin/data/shaders/noise/frag.glsl @@ -0,0 +1,23 @@ +#version 450 + +layout (binding = 1) uniform sampler3D samplerColor; + +layout (location = 0) in vec2 inUv; +layout (location = 1) in vec4 inColor; +layout (location = 2) in vec3 inNormal; +layout (location = 3) in vec3 inPosition; + +layout (location = 0) out vec4 outAlbedoSpecular; +layout (location = 1) out vec4 outNormal; +layout (location = 2) out vec4 outPosition; + +layout (binding = 2) uniform UBO { + float slice; +} ubo; + +void main() { + outAlbedoSpecular.rgb = vec3(texture(samplerColor, vec3(inUv,ubo.slice)).r); + outAlbedoSpecular.a = 1; + outNormal = vec4(inNormal,1); + outPosition = vec4(inPosition,1); +} \ No newline at end of file diff --git a/bin/data/shaders/raytracing/comp.glsl b/bin/data/shaders/raytracing/comp.glsl new file mode 100644 index 00000000..dbc8fc79 --- /dev/null +++ b/bin/data/shaders/raytracing/comp.glsl @@ -0,0 +1,295 @@ +#version 450 + +layout (local_size_x = 32, local_size_y = 32) in; + +layout (constant_id = 0) const uint LIGHTS = 16; +layout (constant_id = 1) const uint EYES = 2; +layout (binding = 0, rgba8) uniform writeonly image2D resultImage[EYES]; + +#define EPSILON 0.0001 +#define MAXLEN 1000.0 + +layout( push_constant ) uniform PushBlock { + uint marchingSteps; + uint rayBounces; + float shadowFactor; + float reflectionStrength; + float reflectionFalloff; +} PushConstant; + +struct Ray { + vec3 origin; + vec3 direction; +}; +struct Result { + vec3 color; + float t; + int id; +}; +struct Light { + vec3 position; + float radius; + vec3 color; + float power; + vec2 type; + vec2 padding; + mat4 view; + mat4 projection; +}; + +struct State { + vec3 viewPosition; + Ray ray; + Result result; +} state; + +struct Fog { + vec2 range; + vec2 padding; + vec4 color; +}; + +layout (binding = 1) uniform UBO { + mat4 matrices[2]; + vec4 ambient; + Fog fog; + Light lights[LIGHTS]; +} ubo; + +struct Shape { + vec4 values; + vec4 albedoSpecular; + int type; +}; +layout (std140, binding = 2) buffer Shapes { + Shape shapes[]; +}; + +void reflectRay(inout vec3 rayD, in vec3 normal) { + rayD = rayD + 2.0 * -dot(normal, rayD) * normal; +} +// Lighting ========================================================= +float lightDiffuse(vec3 normal, vec3 lightDir) { + return clamp(dot(normal, lightDir), 0.1, 1.0); +} +float lightSpecular(vec3 normal, vec3 lightDir, float specularFactor) { + vec3 viewVec = normalize(state.viewPosition); + vec3 halfVec = normalize(lightDir + viewVec); + return pow(clamp(dot(normal, halfVec), 0.0, 1.0), specularFactor); +} + +// Sphere =========================================================== +float sphereIntersect(in vec3 rayO, in vec3 rayD, in Shape shape ) { + vec3 oc = rayO - shape.values.xyz; + float b = 2.0 * dot(oc, rayD); + float c = dot(oc, oc) - shape.values.w * shape.values.w; + float h = b*b - 4.0*c; + if (h < 0.0) return -1.0; + float t = (-b - sqrt(h)) / 2.0; + return t; +} +vec3 sphereNormal(in vec3 position, in Shape shape) { + return (position - shape.values.xyz) / shape.values.w; +} +float sphereSDF( vec3 position, in Shape shape ) { + return length(position - shape.values.xyz) - shape.values.w; +} +// Plane =========================================================== +float planeIntersect(in vec3 rayO, in vec3 rayD, in Shape shape) { + float d = dot(rayD, shape.values.xyz); + if (d == 0.0) return 0.0; + float t = -(shape.values.w + dot(rayO, shape.values.xyz)) / d; + return t < 0.0 ? 0.0 : t; +} +vec3 planeNormal(in vec3 position, in Shape shape) { + return shape.values.xyz; +} +float planeSDF( vec3 position, in Shape shape ) { + return dot( position, shape.values.xyz ) + shape.values.w; +} +// Generic ========================================================= +float shapeIntersect(in vec3 rayO, in vec3 rayD, in Shape shape) { + if ( shape.type == 1 ) return sphereIntersect( rayO, rayD, shape ); + if ( shape.type == 2 ) return planeIntersect( rayO, rayD, shape ); + return 0.0; +} +vec3 shapeNormal( vec3 position, in Shape shape ) { + if ( shape.type == 1 ) return sphereNormal(position, shape); + if ( shape.type == 2 ) return planeNormal(position, shape); + return vec3(0.0); +} +float shapeSDF( vec3 position, in Shape shape ) { + if ( shape.type == 1 ) return sphereSDF(position, shape); + if ( shape.type == 2 ) return planeSDF(position, shape); + return MAXLEN; +} +// Intersect ======================================================= +int intersect(in vec3 rayO, in vec3 rayD, inout float resT) { + int id = -1; + for (int i = 0; i < shapes.length(); i++) { + Shape shape = shapes[i]; + float tShape = shapeIntersect(rayO, rayD, shape); + if ((tShape > EPSILON) && (tShape < resT)) { + id = i; + resT = tShape; + } + } + return id; +} +float calcShadow(in vec3 rayO, in vec3 rayD, in int objectID, inout float resT) { + for (int i = 0; i < shapes.length(); i++) { + if ( i == objectID ) continue; + Shape shape = shapes[i]; + float tShape = shapeIntersect(rayO, rayD, shape); + if ((tShape > EPSILON) && (tShape < resT)) { + resT = tShape; + return PushConstant.shadowFactor; + } + } + return 1.0; +} +// Marching ======================================== +int intersectMarch( in vec3 rayO, in vec3 rayD, inout float resT ) { + resT = 0; + for (int i = 0; i < PushConstant.marchingSteps; ++i) { + vec3 position = resT * rayD + rayO; + float tNearest = MAXLEN; + int objectID = -1; + for ( int j = 0; j < shapes.length(); ++j ) { + Shape shape = shapes[j]; + float tShape = shapeSDF(position, shape); + // if ((tShape > EPSILON) && (tShape < tNearest)) { + if ( tShape < tNearest ) { + objectID = j; + tNearest = tShape; + } + } + if (tNearest < EPSILON) { + return objectID; + } + if (resT > MAXLEN) break; + resT += tNearest; + } + resT = MAXLEN; + return -1; +} +float calcShadowMarch( in vec3 rayO, in vec3 rayD, in int objectID, inout float resT ) { + float distance = resT; + resT = 0; + for (int i = 0; i < PushConstant.marchingSteps; ++i) { + vec3 position = resT * rayD + rayO; + float tNearest = distance; + int objectID = -1; + for ( int j = 0; j < shapes.length(); ++j ) { + if ( j == objectID ) continue; + Shape shape = shapes[j]; + float tShape = shapeSDF(position, shape); + // if ((tShape > EPSILON) && (tShape < tNearest)) { + if ( tShape < tNearest ) { + objectID = j; + tNearest = tShape; + } + } + if (tNearest < EPSILON) { + return PushConstant.shadowFactor; + } + if (resT > distance) break; + resT += tNearest; + } + resT = distance; + return 1.0; +} + +void fog(inout vec3 i, in float t ) { +/* + vec3 fogColor = ubo.ambient.rgb; + i = mix(i, fogColor.rgb, clamp(sqrt(t*t)/20.0, 0.0, 1.0)); +*/ + if ( ubo.fog.range.x == 0 || ubo.fog.range.y == 0 ) return; + + vec3 color = ubo.fog.color.rgb; + float inner = ubo.fog.range.x, outer = ubo.fog.range.y; + float factor = (t - inner) / (outer - inner); + factor = clamp( factor, 0.0, 1.0 ); + + i = mix(i.rgb, color, factor); +} + +Result renderScene(inout vec3 rayO, inout vec3 rayD ) { + Result result; + result.color = vec3(0.0); + result.t = MAXLEN; + result.id = PushConstant.marchingSteps > 0 ? intersectMarch(rayO, rayD, result.t) : intersect(rayO, rayD, result.t); + if (result.id == -1) return result; + + Shape shape = shapes[result.id]; + vec3 position = rayO + result.t * rayD; + vec3 normal = shapeNormal( position, shape ); + + for ( uint i = 0; i < LIGHTS; ++i ) { + Light light = ubo.lights[i]; + if ( light.radius <= EPSILON ) continue; + if ( light.power <= EPSILON ) continue; + + vec3 L = light.position - position; + float dist = length(L); + vec3 D = normalize(L); + float attenuation = light.radius / (pow(dist, 2.0) + 1.0);; + attenuation = 1; + // if ( dist > light.radius ) continue; + + vec4 albedoSpecular = shape.albedoSpecular; + + float d_dot = lightDiffuse(normal, D); + float s_factor = lightSpecular(normal, D, albedoSpecular.a); + vec3 color = (light.color * albedoSpecular.rgb) * d_dot + s_factor; + + // Shadows + float tShadow = dist; + float shadowed = 1; + if ( PushConstant.shadowFactor < 1.0 ) + shadowed = PushConstant.marchingSteps > 0 ? calcShadowMarch(position, D, result.id, tShadow) : calcShadow(position, D, result.id, tShadow); + result.color += color * light.power * attenuation * shadowed; + } + + // Fog + // fog(t, result.color); + + // Reflect ray for next render pass + reflectRay(rayD, normal); + rayO = position; + + return result; +} + +void main() { + for ( int pass = 0; pass < EYES; ++pass ) { + { + vec2 uv = vec2(gl_GlobalInvocationID.xy) / imageSize(resultImage[pass]); + vec4 near4 = ubo.matrices[pass] * (vec4(2.0 * uv - 1.0, -1.0, 1.0)); + vec4 far4 = ubo.matrices[pass] * (vec4(2.0 * uv - 1.0, 1.0, 1.0)); + vec3 near3 = near4.xyz / near4.w; + vec3 far3 = far4.xyz / far4.w; + + state.viewPosition = near3; + state.ray.origin = near3; + state.ray.direction = normalize( far3 - near3 ); + } + + // Basic color path + state.result = renderScene(state.ray.origin, state.ray.direction); + vec3 finalColor = state.result.color; + + // Reflection + float reflectionStrength = PushConstant.reflectionStrength; + for (int i = 0; i < PushConstant.rayBounces; i++) { + Result result = renderScene(state.ray.origin, state.ray.direction); + vec3 reflectionColor = result.color; + + finalColor = (1.0 - reflectionStrength) * finalColor + reflectionStrength * mix(reflectionColor, finalColor, 1.0 - reflectionStrength); + reflectionStrength *= PushConstant.reflectionFalloff; + } + + imageStore(resultImage[pass], ivec2(gl_GlobalInvocationID.xy), vec4(finalColor, 1.0)); + } +} \ No newline at end of file diff --git a/bin/data/shaders/terrain/frag.glsl b/bin/data/shaders/terrain/frag.glsl new file mode 100644 index 00000000..cfe7cd4b --- /dev/null +++ b/bin/data/shaders/terrain/frag.glsl @@ -0,0 +1,20 @@ +#version 450 + +layout (binding = 1) uniform sampler2D samplerColor; + +layout (location = 0) in vec2 inUv; +layout (location = 1) in vec4 inColor; +layout (location = 2) in vec3 inNormal; +layout (location = 3) in vec3 inPosition; + +layout (location = 0) out vec4 outAlbedoSpecular; +layout (location = 1) out vec4 outNormal; +layout (location = 2) out vec4 outPosition; + +void main() { + outAlbedoSpecular = texture(samplerColor, inUv); + // outAlbedoSpecular.rgb *= inColor.rgb; + outAlbedoSpecular.a = 1; + outNormal = vec4(inNormal,1); + outPosition = vec4(inPosition,1); +} \ No newline at end of file diff --git a/bin/data/shaders/terrain/vert.glsl b/bin/data/shaders/terrain/vert.glsl new file mode 100644 index 00000000..7c6d8752 --- /dev/null +++ b/bin/data/shaders/terrain/vert.glsl @@ -0,0 +1,51 @@ +#version 450 + +layout (constant_id = 0) const uint PASSES = 6; +layout (location = 0) in vec3 inPos; +layout (location = 1) in vec2 inUv; +layout (location = 2) in vec3 inNormal; +layout (location = 3) in uint inColor; + +layout( push_constant ) uniform PushBlock { + uint pass; + uint draw; +} PushConstant; + +struct Matrices { + mat4 model; + mat4 view[PASSES]; + mat4 projection[PASSES]; +}; + +layout (binding = 0) uniform UBO { + Matrices matrices; + vec4 color; +} ubo; + +layout (location = 0) out vec2 outUv; +layout (location = 1) out vec4 outColor; +layout (location = 2) out vec3 outNormal; +layout (location = 3) out vec3 outPosition; + +out gl_PerVertex { + vec4 gl_Position; +}; + + +void main() { + outUv = inUv; +// outColor = ubo.color; + + outPosition = vec3(ubo.matrices.view[PushConstant.pass] * ubo.matrices.model * vec4(inPos.xyz, 1.0)); + outNormal = vec3(ubo.matrices.view[PushConstant.pass] * ubo.matrices.model * vec4(inNormal.xyz, 0.0)); + outNormal = normalize(outNormal); + + outColor.a = (inColor >> 24u) & 0xFF; + outColor.b = (inColor >> 16u) & 0xFF; + outColor.g = (inColor >> 8u) & 0xFF; + outColor.r = (inColor ) & 0xFF; + outColor.rgb /= 256.0; + outColor.a = 0.5; + + gl_Position = ubo.matrices.projection[PushConstant.pass] * ubo.matrices.view[PushConstant.pass] * ubo.matrices.model * vec4(inPos.xyz, 1.0); +} \ No newline at end of file diff --git a/bin/data/shaders/texture/frag.glsl b/bin/data/shaders/texture/frag.glsl new file mode 100644 index 00000000..6ebfac38 --- /dev/null +++ b/bin/data/shaders/texture/frag.glsl @@ -0,0 +1,11 @@ +#version 450 + +layout (binding = 0) uniform sampler2D samplerColor; +layout (location = 0) in vec2 inUV; +layout (location = 0) out vec4 outFragColor; + +void main() { + vec4 sampledColor = texture(samplerColor, inUV); + if ( sampledColor.r <= 0.000001 && sampledColor.g <= 0.000001 && sampledColor.b <= 0.000001 ) discard; + outFragColor = sampledColor; +} \ No newline at end of file diff --git a/bin/data/shaders/texture/vert.glsl b/bin/data/shaders/texture/vert.glsl new file mode 100644 index 00000000..8e19c440 --- /dev/null +++ b/bin/data/shaders/texture/vert.glsl @@ -0,0 +1,14 @@ +#version 450 + +layout (location = 0) out vec2 outUV; + +out gl_PerVertex +{ + vec4 gl_Position; +}; + +void main() +{ + outUV = vec2((gl_VertexIndex << 1) & 2, gl_VertexIndex & 2); + gl_Position = vec4(outUV * 2.0f + -1.0f, 0.0f, 1.0f); +} \ No newline at end of file diff --git a/client/client/ext.cpp b/client/client/ext.cpp new file mode 100644 index 00000000..9b96202e --- /dev/null +++ b/client/client/ext.cpp @@ -0,0 +1,266 @@ +#include "../main.h" + +#include +#include +#include +#include +#include +#include +#include +#include + +bool client::ready = false; +bool client::terminated = false; +uf::Window client::window; +uf::Serializer client::config; + +void client::initialize() { + uf::IoStream::ncurses = true; + uf::renderer::device.window = &client::window; + + ext::load(); +#if 1 + client::config = ext::config; +#else + /* Initialize config */ { + struct { + uf::Serializer ext; + uf::Serializer fallback; + } config; + /* Get configuration */ { + config.ext = ext::config.serialize(); + } + /* Merge */ { + client::config = config.ext; + client::config.merge( config.fallback, true ); + } + } +#endif + /* Initialize window */ { + // Window size + pod::Vector2i size; { + size.x = client::config["window"]["size"]["x"].as(); + size.y = client::config["window"]["size"]["y"].as(); + // request system size + if ( size.x <= 0 && size.y <= 0 ) { + auto resolution = client::window.getResolution(); + client::config["window"]["size"]["x"] = (size.x = resolution.x); + client::config["window"]["size"]["y"] = (size.y = resolution.y); + } + } + // Window title + uf::String title; { + title = client::config["window"]["title"].as(); + } + // Terminal window; + spec::terminal.setVisible( client::config["window"]["terminal"]["visible"].as() ); + // Ncurses + uf::IoStream::ncurses = client::config["window"]["terminal"]["ncurses"].as(); + // Window's context settings + uf::renderer::settings::width = size.x; + uf::renderer::settings::height = size.y; + client::window.create( size, title ); + #if !UF_ENV_DREAMCAST + // Set refresh rate + ext::config["window"]["refresh rate"] = client::window.getRefreshRate(); + // Miscellaneous + client::window.setVisible(client::config["window"]["visible"].as()); + client::window.setCursorVisible(client::config["window"]["cursor"]["visible"].as()); + client::window.setKeyRepeatEnabled(client::config["window"]["keyboard"]["repeat"].as()); + // client::window.centerWindow(); + // client::window.setPosition({0, 0}); + // client::window.setMouseGrabbed(true); + + /* Set Icon */ if ( client::config["window"]["icon"].is() ) { + uf::Image icon; + icon.open(client::config["window"]["icon"].as()); + client::window.setIcon({(int) icon.getDimensions().x, (int) icon.getDimensions().y}, ((uint8_t*)icon.getPixelsPtr())); + } + client::window.setTitle(title); { + uf::Serializer json; + std::string hook = "window:Title.Changed"; + json["type"] = hook; + json["invoker"] = "os"; + json["window"]["title"] = std::string(title); + uf::hooks.call( hook, json ); + } + #endif + /* + uf::hooks.shouldPreferReadable(); + if ( client::config["engine"]["hook"]["mode"] == "Readable" ) { + + } + */ + } + + #if UF_USE_OPENAL + /* Initialize OpenAL */ { + if ( !ext::oal.initialize() ) { + std::cerr << "[ERROR] AL failed to initialize!" << std::endl; + std::exit(EXIT_SUCCESS); + return; + } + } + #endif + + /* Initialize hooks */ { + // if ( client::config["engine"]["hook"]["mode"] == "Both" || client::config["engine"]["hook"]["mode"] == "Readable" ) { + uf::hooks.addHook( "window:Mouse.CursorVisibility", [&](const ext::json::Value& json){ + client::window.setCursorVisible(json["state"].as()); + client::window.setMouseGrabbed(!json["state"].as()); + client::config["mouse"]["visible"] = json["state"].as(); + client::config["window"]["mouse"]["center"] = !json["state"].as(); + }); + uf::hooks.addHook( "window:Mouse.Lock", [&](const ext::json::Value& json){ + if ( client::window.hasFocus() ) { + client::window.setMousePosition(client::window.getSize()/2); + } + }); + uf::hooks.addHook( "window:Closed", [&](const ext::json::Value& json){ + client::ready = false; + // std::exit(EXIT_SUCCESS); + } ); + uf::hooks.addHook( "window:Title.Changed", [&](const ext::json::Value& json){ + if ( json["invoker"] != "os" ) { + if ( !ext::json::isObject( json["window"] ) ) return; + uf::String title = json["window"]["title"].as(); + client::window.setTitle(title); + } + } ); + uf::hooks.addHook( "window:Resized", [&](const ext::json::Value& json){ + pod::Vector2i size; { + size.x = json["window"]["size"]["x"].as(); + size.y = json["window"]["size"]["y"].as(); + } + if ( json["invoker"] != "os" ) { + client::window.setSize(size); + } + // Update viewport + if ( !ext::json::isArray( client::config["engine"]["ext"]["vulkan"]["framebuffer"]["size"] ) ) { + float scale = client::config["engine"]["ext"]["vulkan"]["framebuffer"]["size"].is() ? client::config["engine"]["ext"]["vulkan"]["framebuffer"]["size"].as() : 1; + uf::renderer::settings::width = size.x * scale; + uf::renderer::settings::height = size.y * scale; + } + + uf::renderer::states::resized = true; + } ); + /* + } + else if ( client::config["engine"]["hook"]["mode"] == "Both" || client::config["engine"]["hook"]["mode"] == "Optimal" ) { + uf::hooks.addHook( "window:Closed", [&](const uf::OptimalHook::argument_t& userdata)->uf::OptimalHook::return_t{ + client::ready = false; + std::exit(EXIT_SUCCESS); + return NULL; + } ); + uf::hooks.addHook( "window:Title.Changed", [&](const uf::OptimalHook::argument_t& userdata)->uf::OptimalHook::return_t{ + // Hook information + struct Hook { + std::string type; + std::string invoker; + + struct { + std::string title; + } window; + }; + const Hook& hook = uf::userdata::get(userdata); + if ( hook.invoker != "os" ) { + uf::String title = hook.window.title; + client::window.setTitle(title); + } + return NULL; + } ); + uf::hooks.addHook( "window:Resized", [&](const uf::OptimalHook::argument_t& userdata)->uf::OptimalHook::return_t{ + // Hook information + struct Hook { + std::string type; + std::string invoker; + + struct { + pod::Vector2i size; + } window; + }; + const Hook& hook = uf::userdata::get(userdata); + if ( hook.invoker != "os" ) { + client::window.setSize(hook.window.size); + } + // Update viewport + return NULL; + } ); + } + */ + } +#if !UF_ENV_DREAMCAST + if ( client::config["window"]["mode"].as() == "fullscreen" ) client::window.switchToFullscreen(); + if ( client::config["window"]["mode"].as() == "borderless" ) client::window.switchToFullscreen( true ); +#endif + client::ready = true; +} +void client::tick() { +// uf::hooks.call("system:Tick"); + client::window.pollEvents(); + // call mouse move + // query lock + if ( client::window.hasFocus() && client::config["window"]["mouse"]["center"].as() ) { + auto previous = client::window.getMousePosition(); + client::window.setMousePosition(client::window.getSize()/2); + auto current = client::window.getMousePosition(); + + auto size = client::window.getSize(); + uf::Serializer payload; + payload["invoker"] = "client"; + payload["mouse"]["delta"]["x"] = previous.x - current.x; + payload["mouse"]["delta"]["y"] = previous.y - current.y; + payload["mouse"]["position"]["x"] = current.x; + payload["mouse"]["position"]["y"] = current.y; + payload["mouse"]["size"]["x"] = size.x; + payload["mouse"]["size"]["y"] = size.y; + payload["mouse"]["state"] = "???"; + payload["type"] = "window:Mouse.Moved"; + uf::hooks.call("window:Mouse.Moved", payload); + } +/* +{ + "invoker" : "os", + "mouse" : + { + "delta" : + { + "x" : -17, + "y" : -12 + }, + "position" : + { + "x" : 371, + "y" : 276 + }, + "size" : + { + "x" : 800, + "y" : 600 + }, + "state" : "???" + }, + "type" : "window:Mouse.Moved" +} +*/ +} + +void client::render() { + client::window.display(); +} + +void client::terminate() { + /* Close Threads */ { + uf::thread::terminate(); + } + + client::window.terminate(); + + #if UF_USE_OPENAL + if ( !ext::oal.terminate() ) { + std::cerr << "[ERROR] AL failed to terminate!" << std::endl; + std::exit(EXIT_SUCCESS); + return; + } + #endif +} \ No newline at end of file diff --git a/client/dreamcast.gldc.inl b/client/dreamcast.gldc.inl new file mode 100644 index 00000000..9ae27a74 --- /dev/null +++ b/client/dreamcast.gldc.inl @@ -0,0 +1,87 @@ +#include +#include +#include + +/* A general OpenGL initialization function. Sets all of the initial parameters. */ +void InitGL(int Width, int Height) // We call this right after our OpenGL window is created. +{ + glClearColor(0.0f, 0.0f, 0.0f, 0.0f); // This Will Clear The Background Color To Black + glClearDepth(1.0); // Enables Clearing Of The Depth Buffer + glDepthFunc(GL_LESS); // The Type Of Depth Test To Do + glEnable(GL_DEPTH_TEST); // Enables Depth Testing + glShadeModel(GL_SMOOTH); // Enables Smooth Color Shading + + glEnableClientState(GL_VERTEX_ARRAY); // Enable vertex arrays + + glMatrixMode(GL_PROJECTION); + glLoadIdentity(); // Reset The Projection Matrix + + gluPerspective(45.0f,(GLfloat)Width/(GLfloat)Height,0.1f,100.0f); // Calculate The Aspect Ratio Of The Window + + glMatrixMode(GL_MODELVIEW); +} + +/* The function called when our window is resized (which shouldn't happen, because we're fullscreen) */ +void ReSizeGLScene(int Width, int Height) +{ + if (Height == 0) // Prevent A Divide By Zero If The Window Is Too Small + Height = 1; + + glViewport(0, 0, Width, Height); // Reset The Current Viewport And Perspective Transformation + + glMatrixMode(GL_PROJECTION); + glLoadIdentity(); + + gluPerspective(45.0f,(GLfloat)Width/(GLfloat)Height,0.1f,100.0f); + glMatrixMode(GL_MODELVIEW); +} + + +/* The main drawing function. */ +void DrawGLScene() +{ + + const GLfloat triangle [] = { + 0.0f, 1.0f, 0.0f, + 1.0f, -1.0f, 0.0f, + -1.0f, -1.0f, 0.0f + }; + + const GLfloat square [] = { + -1.0f, 1.0f, 0.0f, + 1.0f, 1.0f, 0.0f, + 1.0f, -1.0f, 0.0f, + -1.0f, -1.0f, 0.0f + }; + + glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT); // Clear The Screen And The Depth Buffer + glLoadIdentity(); // Reset The View + + glTranslatef(-1.5f,0.0f,-6.0f); // Move Left 1.5 Units And Into The Screen 6.0 + + glVertexPointer(3, GL_FLOAT, 0, triangle); + glDrawArrays(GL_TRIANGLES, 0, 3); + + glTranslatef(3.0f,0.0f,0.0f); // Move Right 3 Units + + glVertexPointer(3, GL_FLOAT, 0, square); + glDrawArrays(GL_QUADS, 0, 4); + + // swap buffers to display, since we're double buffered. + glKosSwapBuffers(); +} + +int main(int argc, char **argv) +{ + glKosInit(); + + InitGL(640, 480); + ReSizeGLScene(640, 480); + + while(1) { + UF_DEBUG_PRINT_MARKER(); + DrawGLScene(); + } + + return 0; +} diff --git a/client/dreamcast.inl b/client/dreamcast.inl new file mode 100644 index 00000000..f03a2f31 --- /dev/null +++ b/client/dreamcast.inl @@ -0,0 +1,82 @@ +/* + KallistiOS 2.0.0 + + nehe02.c + (c)2014 Josh Pearson + (c)2001 Benoit Miller + (c)2000 Jeff Molofee +*/ + +#include + +#include +#include +#include + +/* + The simplest OpenGL example ever! + + Essentially the same thing as NeHe's lesson02 code. + To learn more, go to http://nehe.gamedev.net/. +*/ + +void draw_gl(void) { + glClear(GL_COLOR_BUFFER_BIT | GL_DEPTH_BUFFER_BIT); + + glLoadIdentity(); + glTranslatef(-1.5f, 0.0f, -6.0f); + + glBegin(GL_TRIANGLES); + glVertex3f(0.0f, 1.0f, 0.0f); + glVertex3f(-1.0f, -1.0f, 0.0f); + glVertex3f(1.0f, -1.0f, 0.0f); + glEnd(); + + glTranslatef(3.0f, 0.0f, 0.0f); + + glBegin(GL_QUADS); + glVertex3f(-1.0f, 1.0f, 0.0f); + glVertex3f(1.0f, 1.0f, 0.0f); + glVertex3f(1.0f, -1.0f, 0.0f); + glVertex3f(-1.0f, -1.0f, 0.0f); + glEnd(); +} + +int main(int argc, char **argv) { + maple_device_t *cont; + cont_state_t *state; + + /* Get basic stuff initialized */ + printf("nehe02 beginning\n"); + /* Notice we do not init the PVR here, that is handled by OpenGL */ + glKosInit(); + + glMatrixMode(GL_PROJECTION); + glLoadIdentity(); + gluPerspective(45.0f, 640.0f / 480.0f, 0.1f, 100.0f); + glMatrixMode(GL_MODELVIEW); + glLoadIdentity(); + + while(1) { + cont = maple_enum_type(0, MAPLE_FUNC_CONTROLLER); + + /* Check key status */ + state = (cont_state_t *)maple_dev_status(cont); + + if(!state) { + printf("Error reading controller\n"); + break; + } + + if(state->buttons & CONT_START) + break; + + /* Draw the "scene" */ + draw_gl(); + + /* Finish the frame - Notice there is no glKosBegin/FinshFrame */ + glutSwapBuffers(); + } + + return 0; +} diff --git a/client/main.cpp b/client/main.cpp new file mode 100644 index 00000000..d90881e4 --- /dev/null +++ b/client/main.cpp @@ -0,0 +1,78 @@ +#include "main.h" + +#include +#include + +#include + +#if UF_NO_EXCEPTIONS + #define HANDLE_EXCEPTIONS 0 +#else + #define HANDLE_EXCEPTIONS 0 +#endif + +int main(int argc, char** argv){ + for ( size_t i = 0; i < argc; ++i ) { + char* c_str = argv[i]; + std::string string(argv[i]); + ext::arguments.emplace_back(string); + } + + std::atexit([]{ + uf::iostream << "Termination via std::atexit()!" << "\n"; + client::terminated = !(client::ready = ext::ready = false); + }); + + client::initialize(); + ext::initialize(); + + // For Multithreaded initialization + while ( !client::ready || !ext::ready ) { + static uf::Timer timer(false); + static double next = 1; + if ( !timer.running() ) timer.start(); + + if ( timer.elapsed().asDouble() >= next ) { + uf::iostream << "Waiting for " << ( client::ready ? "client" : "extension / engine" ) << " to initialize... Retrying in " << next << " seconds." << "\n"; + next *= 2; + } + } + while ( client::ready && ext::ready ) { + #if HANDLE_EXCEPTIONS + try { + #endif + static bool first = false; if ( !first ) { first = true; + uf::Serializer json; + std::string hook = "window:Resized"; + json["type"] = hook; + json["invoker"] = "ext"; + + json["window"]["size"]["x"] = client::config["window"]["size"]["x"]; + json["window"]["size"]["y"] = client::config["window"]["size"]["y"]; + uf::hooks.call(hook, json); + } + client::tick(); + ext::tick(); + client::render(); + ext::render(); + #if HANDLE_EXCEPTIONS + } catch ( std::runtime_error& e ) { + uf::iostream << "RUNTIME ERROR: " << e.what() << "\n"; + break; + } catch ( std::exception& e ) { + uf::iostream << "EXCEPTION ERROR: " << e.what() << "\n"; + throw e; + } catch ( bool handled ) { + if (!handled) uf::iostream << "UNHANDLED ERROR: " << "???" << "\n"; + } catch ( ... ) { + uf::iostream << "UNKNOWN ERROR: " << "???" << "\n"; + } + #endif + } + if ( !client::terminated ) { + uf::iostream << "Natural termination!" << "\n"; + } + ext::terminate(); + client::terminate(); + return 0; +} \ No newline at end of file diff --git a/client/main.h b/client/main.h new file mode 100644 index 00000000..2d07cad7 --- /dev/null +++ b/client/main.h @@ -0,0 +1,18 @@ +#pragma once +#include + +#include +#include +#include + +namespace client { + extern bool ready; + extern bool terminated; + extern uf::Window window; + extern uf::Serializer config; + + void initialize(); + void tick(); + void render(); + void terminate(); +} \ No newline at end of file diff --git a/data/audio/footstep/1.ogg b/data/audio/footstep/1.ogg deleted file mode 100644 index ac3b6ef2..00000000 Binary files a/data/audio/footstep/1.ogg and /dev/null differ diff --git a/data/audio/footstep/2.ogg b/data/audio/footstep/2.ogg deleted file mode 100644 index 3690c438..00000000 Binary files a/data/audio/footstep/2.ogg and /dev/null differ diff --git a/data/audio/ui/ding.ogg b/data/audio/ui/ding.ogg deleted file mode 100644 index 7e757622..00000000 Binary files a/data/audio/ui/ding.ogg and /dev/null differ diff --git a/data/audio/ui/hover.ogg b/data/audio/ui/hover.ogg deleted file mode 100644 index 9dcc0703..00000000 Binary files a/data/audio/ui/hover.ogg and /dev/null differ diff --git a/data/audio/ui/invalid select.ogg b/data/audio/ui/invalid select.ogg deleted file mode 100644 index 725cba97..00000000 Binary files a/data/audio/ui/invalid select.ogg and /dev/null differ diff --git a/data/audio/ui/main menu.ogg b/data/audio/ui/main menu.ogg deleted file mode 100644 index 8c9cbf73..00000000 Binary files a/data/audio/ui/main menu.ogg and /dev/null differ diff --git a/data/audio/ui/menu close.ogg b/data/audio/ui/menu close.ogg deleted file mode 100644 index 9556d170..00000000 Binary files a/data/audio/ui/menu close.ogg and /dev/null differ diff --git a/data/audio/ui/menu exit.ogg b/data/audio/ui/menu exit.ogg deleted file mode 100644 index a813a3ba..00000000 Binary files a/data/audio/ui/menu exit.ogg and /dev/null differ diff --git a/data/audio/ui/menu flip.ogg b/data/audio/ui/menu flip.ogg deleted file mode 100644 index 6eab8e6e..00000000 Binary files a/data/audio/ui/menu flip.ogg and /dev/null differ diff --git a/data/audio/ui/menu open.ogg b/data/audio/ui/menu open.ogg deleted file mode 100644 index 65a60e65..00000000 Binary files a/data/audio/ui/menu open.ogg and /dev/null differ diff --git a/data/audio/ui/register.ogg b/data/audio/ui/register.ogg deleted file mode 100644 index b4861e2d..00000000 Binary files a/data/audio/ui/register.ogg and /dev/null differ diff --git a/data/audio/ui/select.ogg b/data/audio/ui/select.ogg deleted file mode 100644 index 7556cf90..00000000 Binary files a/data/audio/ui/select.ogg and /dev/null differ diff --git a/data/audio/ui/turn.ogg b/data/audio/ui/turn.ogg deleted file mode 100644 index ccb8f6d3..00000000 Binary files a/data/audio/ui/turn.ogg and /dev/null differ diff --git a/data/cache/7d1b6aad265422f0b26f5759be9caad42032cf8babb8f24e1d5213310dd05621.png b/data/cache/7d1b6aad265422f0b26f5759be9caad42032cf8babb8f24e1d5213310dd05621.png deleted file mode 100644 index ea0724d4..00000000 Binary files a/data/cache/7d1b6aad265422f0b26f5759be9caad42032cf8babb8f24e1d5213310dd05621.png and /dev/null differ diff --git a/data/cache/80fb004ae52fc356c206aec46e7e2c7ee28c83a1cc3bbd015e89d4b279d30e1e.png b/data/cache/80fb004ae52fc356c206aec46e7e2c7ee28c83a1cc3bbd015e89d4b279d30e1e.png deleted file mode 100644 index f931b692..00000000 Binary files a/data/cache/80fb004ae52fc356c206aec46e7e2c7ee28c83a1cc3bbd015e89d4b279d30e1e.png and /dev/null differ diff --git a/data/cache/a9e4200047328c32c0f3749c4f1021e6a6a11cd1975f214b1436f0935b8e2a78.png b/data/cache/a9e4200047328c32c0f3749c4f1021e6a6a11cd1975f214b1436f0935b8e2a78.png deleted file mode 100644 index b410bb84..00000000 Binary files a/data/cache/a9e4200047328c32c0f3749c4f1021e6a6a11cd1975f214b1436f0935b8e2a78.png and /dev/null differ diff --git a/data/cache/f1613edc9c369861b2061d5d4aa869d4adbf62201ec190b112c0a028aaf5aac8.png b/data/cache/f1613edc9c369861b2061d5d4aa869d4adbf62201ec190b112c0a028aaf5aac8.png deleted file mode 100644 index ec355c10..00000000 Binary files a/data/cache/f1613edc9c369861b2061d5d4aa869d4adbf62201ec190b112c0a028aaf5aac8.png and /dev/null differ diff --git a/data/config.json b/data/config.json deleted file mode 100644 index aac53fce..00000000 --- a/data/config.json +++ /dev/null @@ -1,166 +0,0 @@ -{ - "engine": { - "scenes": { - "start": "McDonalds", - "lights": { - "max": 256, - "update threshold": 6, - "shadow threshold": 20 - }, - "textures": { - "max": 256 - } - }, - "ext": { - "vulkan": { - "validation": { - "enabled": false, - "filters": [ - "MessageID = 0x4dae5635", // UNASSIGNED-CoreValidation-DrawState-InvalidImageLayout (false positive for cubemaps) - "MessageID = 0x71500fba", // VUID-vkDestroyDevice-device-00378 (don't care about a clean cleanup) - "MessageID = 0x609a13b", // UNASSIGNED-CoreValidation-Shader-OutputNotConsumed (from depth-only calls) - "MessageID = 0x23e43bb7" // UNASSIGNED-CoreValidation-Shader-InputNotProduced (from depth-only calls) - // "MessageID = 0xe91b58a0" // VUID-vkCmdDrawIndexed-None-02686 (?) - ] - }, - "framebuffer": { - "size": 0.8, - // "size": [ 640, 480, "NEAREST" ], - // "size": [ 256, 224, "NEAREST" ], - // "msaa": 16 - "msaa": 4 - }, - "experimental": { - "rebuild on tick begin": false, - "wait on render end": false, - "individual pipelines": true, - "multithreaded command recording": true, - "deferred mode": "", - // "deferred mode": "deferredSampling", - "deferred reconstruct position": true, - "deferred alias output to swapchain": true, - "hdr": false - }, - "formats": { - "depth": "D32_SFLOAT", - "color": "R8G8B8A8_UNORM", // "R32G32B32A32_SFLOAT", - "normal": "R16G16B16A16_SFLOAT", - "position": "R16G16B16A16_SFLOAT" - }, - "features": [ - "independentBlend", - "deviceCoherentMemory", - "robustBufferAccess", - "samplerAnisotropy", - "sampleRateShading", - "nullDescriptor" - ], - "extensions": { - "instance": [ - "VK_KHR_get_physical_device_properties2", - "VK_KHR_get_surface_capabilities2" - ], - "device": [ - ] - } - }, - "lua": { - "main": "/main.lua", - "modules": { - "json": "/json.lua" - } - }, - "vr" : { - "enable" : false, - "manifest": "./data/openvr_manifest.json", - "swap eyes": false, - "dominant eye": 0, - "scale": 1 - }, - "ultralight": { - "enabled": true, - "scale": 1.5 - }, - "bullet": { - "iterations": 1, - "substeps": 12, - "timescale": 1, - "multithreaded": false, - "debug draw": { - "enabled": false, - "rate": 1.0 - } - }, - "discord": { - "enabled": false - } - }, - "audio": { - "mute": false - }, - "memory pool": { - "globalOverride": false, - "subPools": true, - "size": "512 MiB", - "pools": { - "entity": "128 MiB", - "userdata": "128 MiB", - "component": "128 MiB" - } - }, - "hook" : { - "mode" : "Readable" - }, - "render modes": { - "gui": true, - "deferred": true, - "stereo deferred": false, - "multiview stereo deferred": false - }, - "limiters": { - "deltaTime": 10, - "framerate": "auto" - }, - "threads": { - "workers" : "auto", - "frame limiter": "auto" - }, - "debug": { - "framerate": { - "print": false, - "every": 1 - }, - "garbage collection": { - "enabled": true, - "mode": 1, - "rate": 16, - "announce": true - }, - "entity": { - "delete children on destroy": false, - "delete components on destroy": false - } - } - }, - "window" : { - "terminal" : { - "ncurses" : false, - "visible" : true - }, - "keyboard" : { - "repeat" : false - }, - "cursor" : { - "visible" : true, - "center" : false - }, - "mode" : "windowed", // fullscreen, borderless, windowed - "icon" : "./data/textures/icon.png", - "size" : { - "x" : 960, - "y" : 540 - }, - "title" : "Grimgram", - "visible" : true - } -} \ No newline at end of file diff --git a/data/entities/gui.json b/data/entities/gui.json deleted file mode 100644 index c0a9d77e..00000000 --- a/data/entities/gui.json +++ /dev/null @@ -1,8 +0,0 @@ -{ - "name": "Gui Manager", - "type": "Object", - "behaviors": [ - "GuiManagerBehavior" - ], - "ignore": false -} \ No newline at end of file diff --git a/data/entities/gui/hud/hud.json b/data/entities/gui/hud/hud.json deleted file mode 100644 index 0e1bf947..00000000 --- a/data/entities/gui/hud/hud.json +++ /dev/null @@ -1,23 +0,0 @@ -{ - "name": "HUD", - "type": "Gui", - "ignore": false, - "assets": [ - "./scripts/hud.lua" - ], - "system": { - "clickable": false, - "hoverable": false - }, - "transform": { - "position": [ 0, 0, 0 ], - "rotation": { - "axis": [ 0, 0, 1 ], - "angle": 0 - }, - "scale": [ 16, 16, 16 ] - }, - "metadata": { - - } -} \ No newline at end of file diff --git a/data/entities/gui/hud/overlay.json b/data/entities/gui/hud/overlay.json deleted file mode 100644 index 549ace3f..00000000 --- a/data/entities/gui/hud/overlay.json +++ /dev/null @@ -1,36 +0,0 @@ -{ - "name": "HUD Overlay", - "type": "Gui", - "ignore": false, - "assets": [ - { "filename": "./textures/mp.png", "hash": "68e7c459f9aecd6815ff7df1e2eefa82db60a23713b0134f0bfc15d82f55453d" } - // { "filename": "./textures/ss2.png" } - ], - "system": { - "clickable": false, - "hoverable": false - }, - "transform": { - "position": [ 0, 0, 0 ], - "rotation": { - "axis": [ 0, 0, 1 ], - "angle": 0 - }, - // "scale": [ 1.7776, -1, -1 ] - "scale": [ 1, 1, 1 ] - }, - "metadata": { - "uv": [ 0, 0, 1, 1 ], - // "color": [ 0.8, 0.8, 1, 1 ], - // "color": [ 0.416, 0.573, 0.667, 1 ], - "color": [ 1, 1, 1, 1 ], - "location": "", - "scaling": "relative", - // "depth": 0.1, - // "alpha": 0.5, - "alpha": 0.75, - "mode": 1, - "gui layer": true, - "only model": true - } -} \ No newline at end of file diff --git a/data/entities/gui/hud/scripts/hud.lua b/data/entities/gui/hud/scripts/hud.lua deleted file mode 100644 index 17139407..00000000 --- a/data/entities/gui/hud/scripts/hud.lua +++ /dev/null @@ -1,154 +0,0 @@ -local scene = entities.currentScene() -local controller = entities.controller() -local metadata = ent:getComponent("Metadata") -local masterdata = scene:getComponent("Metadata") - -local visorLayers = 5 -local children = {} -for i=1, visorLayers do - children[i] = ent:loadChild("./overlay.json",true) -end - -local soundEmitter = ent:loadChild("./sound.json",true) - -local timer = Timer.new() -if not timer:running() then timer:start() end - -Static = { - values = {}, - get = function( obj ) - if obj == nil then - obj = scene - end - if Static.values[""..obj:uid()] == nil then - Static.values[""..obj:uid()] = {} - end - return Static.values[""..obj:uid()] - end -} - -local lerper = { - to = Quaternion(0,0,0,1), - from = Quaternion(0,0,0,1), - a = 0 -} - -local rotate = function( delta ) - delta.x = delta.x * 0.1 - delta.y = delta.y * 0.1 - - local transform = ent:getComponent("Transform") - local rotation = { - x = Quaternion.axisAngle( Vector3f(0, 1, 0), delta.x ), - y = Quaternion.axisAngle( Vector3f(1, 0, 0), delta.y ) - } - - lerper.a = 0 - lerper.from = Quaternion.multiply( transform.orientation, rotation.x:multiply(rotation.y) ) - transform.orientation = lerper.from - for k, obj in pairs(children) do - obj:getComponent("Transform").orientation = transform.orientation - end -end - -local windowSize = masterdata["system"]["config"]["window"]["size"]; -local entTransform = ent:getComponent("Transform") -entTransform.scale.x = entTransform.scale.x * windowSize.x / windowSize.y; - -for k, obj in pairs(children) do - local transform = obj:getComponent("Transform") - transform.scale = entTransform.scale; - transform.position.z = -0.5 + ((k-1) * 0.005) -end - -ent:addHook( "window:Resized", function( payload ) - if entTransform.scale.y == entTransform.scale.z then - entTransform.scale.x = entTransform.scale.y * payload["window"]["size"]["x"] / payload["window"]["size"]["y"]; - end - - for k, obj in pairs(children) do - local transform = obj:getComponent("Transform") - transform.scale = entTransform.scale; - end -end ) - -ent:addHook( "controller:Camera.Rotated", function( payload ) - rotate( { - x = -payload.angle.yaw, - y = -payload.angle.pitch - }) ---[[ - local transform = ent:getComponent("Transform") - lerper.a = 0 - local counterOrientation = Quaternion( payload.delta[1], payload.delta[2], payload.delta[3], payload.delta[4] ):inverse() - lerper.from = Quaternion.multiply( transform.orientation, counterOrientation ) - transform.orientation = lerper.from - for k, obj in pairs(children) do - obj:getComponent("Transform").orientation = transform.orientation - end -]] -end ) ---[[ -ent:addHook( "window:Mouse.Moved", function( payload ) - if payload.invoker ~= "client" then return end - - local delta = payload.mouse.delta - local size = payload.mouse.size - - if delta == nil or size == nil then return end - if delta.x == 0 or delta.y == 0 then return end - - delta.x = -delta.x / size.x - delta.y = -delta.y / size.y - - rotate( delta ) -end ) -]] - -ent:bind( "tick", function(self) - for k, obj in pairs(children) do - local metadata = obj:getComponent("Metadata") - local glow = math.sin(time.current()) * 0.5 + 0.5 -- constrained to [0,1] - glow = glow * 0.2 + 0.65 -- constrained to [0.65, 0.85] - metadata["alpha"] = glow - obj:setComponent("Metadata", metadata) - end - - local controllerTransform = controller:getComponent("Transform") - local controllerCamera = controller:getComponent("Camera") - local controllerCameraTransform = controllerCamera:getTransform() - local transform = ent:getComponent("Transform") - - local speed = 2.5 - if lerper.a == 1 then return end - lerper.a = lerper.a + time.delta() * speed - if lerper.a > 1 then lerper.a = 1 end - - transform.orientation = lerper.from:slerp( lerper.to, lerper.a ) - local orientation = transform.orientation - for k, obj in pairs(children) do - local transform = obj:getComponent("Transform") - transform.orientation = orientation - transform.model = controllerCamera:getProjection() * Matrix4f.translate( transform.position ) * transform.orientation:matrix() * Matrix4f.scale( transform.scale ) --Matrix4f.scale( Vector3f( 1.7776 * 2, 2, 2 ) ) - end -end ) - ---[[ - controller:callHook( "object:UpdateMetadata.%UID%", { - path = "overlay.position", - value = { - [1] = position.x, - [2] = position.y, - [3] = position.z - } - } ) - controller:callHook( "object:UpdateMetadata.%UID%", { - path = "overlay.orientation", - value = { - [1] = orientation.x, - [2] = orientation.y, - [3] = orientation.z, - [4] = orientation.w - } - } ) -]] \ No newline at end of file diff --git a/data/entities/gui/hud/sound.json b/data/entities/gui/hud/sound.json deleted file mode 100644 index 521052cd..00000000 --- a/data/entities/gui/hud/sound.json +++ /dev/null @@ -1,38 +0,0 @@ -{ - "type": "Object", - "name": "Sound Emitter", - "ignore": false, - "assets": [ - ], - "behaviors": [ - "SoundEmitterBehavior" - ], - "transform": { - "position": [ 0, 0, 0 ], - "rotation": { - "axis": [ 0, 1, 0 ], - "angle": 0 - }, - "scale": [ 1, 1, 1 ] - }, - "system": { - "hot reload": { - "enabled": true - }, - "defaults": { - "render": true, - "asset load": true - }, - "load": { - "ignore": true - } - }, - "metadata": { - "audio": { - "spatial": false, - "loop": false, - "volume": "sfx", - "rolloffFactor": 2 - } - } -} \ No newline at end of file diff --git a/data/entities/gui/mainmenu/circle-in.json b/data/entities/gui/mainmenu/circle-in.json deleted file mode 100644 index 2bc77fd8..00000000 --- a/data/entities/gui/mainmenu/circle-in.json +++ /dev/null @@ -1,25 +0,0 @@ -{ - "name": "Menu: Circle Inner", - "type": "Gui", - "ignore": false, - "transform": { - "position": [ 0.86, 0.86, 0 ], - "rotation": { - "axis": [ 1, 0, 0 ], - "angle": 0 - }, - "scale": [ 1, 1, 1 ] - }, - "clickable": false, - "hoverable": false, - "metadata": { - "uv": [ 0, 0, 1, 1 ], - "color": [ 1, 1, 1, 0.8 ], - "location": "", - "scaling": [ 0.64, 1 ], - "mode": "flat" - }, - "assets": [ - "https://cdn..xyz//unity/Android/sprite/sprite_magiccircle_in2.png" - ] -} \ No newline at end of file diff --git a/data/entities/gui/mainmenu/circle-out.json b/data/entities/gui/mainmenu/circle-out.json deleted file mode 100644 index 0fca3b79..00000000 --- a/data/entities/gui/mainmenu/circle-out.json +++ /dev/null @@ -1,25 +0,0 @@ -{ - "name": "Menu: Circle Outer", - "type": "Gui", - "ignore": false, - "transform": { - "position": [ 0.86, 0.86, 0 ], - "rotation": { - "axis": [ 1, 0, 0 ], - "angle": 0 - }, - "scale": [ 1, 1, 1 ] - }, - "clickable": false, - "hoverable": true, - "metadata": { - "uv": [ 0, 0, 1, 1 ], - "color": [ 1, 1, 1, 0.8 ], - "location": "", - "scaling": [ 0.64, 1 ], - "mode": "flat" - }, - "assets": [ - "https://cdn..xyz//unity/Android/sprite/sprite_magiccircle_out2.png" - ] -} \ No newline at end of file diff --git a/data/entities/gui/mainmenu/main-text.json b/data/entities/gui/mainmenu/main-text.json deleted file mode 100644 index a1897789..00000000 --- a/data/entities/gui/mainmenu/main-text.json +++ /dev/null @@ -1,26 +0,0 @@ -{ - "name": "Menu: Main Text", - "type": "Gui", - "ignore": false, - "transform": { - "position": [ -0.922623, -0.854923, 0 ], - "rotation": { - "axis": [ 0, 0, 1 ], - "angle": 0 - }, - "scale": [ 1, 1, 1 ] - }, - "metadata": { - "uv": [ 0, 0, 1, 1 ], - "location": "", - "scaling": "relative", - "debug": { - "moveable": false - }, - "text settings": { - "scale": 2, - "font": "Coolvetica.ttf", - "string": "Grimgram" - } - } -} \ No newline at end of file diff --git a/data/entities/gui/mainmenu/menu.json b/data/entities/gui/mainmenu/menu.json deleted file mode 100644 index 3556c418..00000000 --- a/data/entities/gui/mainmenu/menu.json +++ /dev/null @@ -1,30 +0,0 @@ -{ - "name": "Gui: Menu", - "type": "Gui", - "ignore": false, - "assets": [ - "./textures/menu.png", - "./scripts/menu.lua" - ], - "system": { - "clickable": true, - "hoverable": true - }, - "transform": { - "position": [ 0, 0, 0 ], - "rotation": { - "axis": [ 0, 0, 1 ], - "angle": 0 - }, - "scale": [ 1, 1, 1 ] - }, - "metadata": { - "experimental": true, - "uv": [ 0, 0, 1, 1 ], - "color": [ 1, 1, 1, 1 ], - "location": "", - "scaling": "relative", - "depth": 0.2, - "mode": "flat" - } -} \ No newline at end of file diff --git a/data/entities/gui/mainmenu/quit.json b/data/entities/gui/mainmenu/quit.json deleted file mode 100644 index 46d74135..00000000 --- a/data/entities/gui/mainmenu/quit.json +++ /dev/null @@ -1,35 +0,0 @@ -{ - "name": "Menu: Close Option", - "type": "Gui", - "ignore": false, - "transform": { - "position": [ -0.75622, 0.638136, 0 ], - "rotation": { - "axis": [ 0, 0, 1 ], - "angle": 0 - }, - "scale": [ 1, 1, 1 ] - }, - "clickable": true, - "hoverable": true, - "metadata": { - "uv": [ 0, 0, 1, 1 ], - "location": "", - "scaling": "relative", - "debug": { - "moveable": false - }, - "events": { - "click": { - "name": "system:Quit", - "payload": { - "scene": "StartMenu" - } - } - }, - "text settings": { - "legacy": false, - "string": "Quit" - } - } -} \ No newline at end of file diff --git a/data/entities/gui/mainmenu/scripts/menu.lua b/data/entities/gui/mainmenu/scripts/menu.lua deleted file mode 100644 index 30cddf68..00000000 --- a/data/entities/gui/mainmenu/scripts/menu.lua +++ /dev/null @@ -1,142 +0,0 @@ -Static = { - values = {}, - get = function( obj ) - if Static.values[""..obj:uid()] == nil then - Static.values[""..obj:uid()] = {} - end - return Static.values[""..obj:uid()] - end -} - -local scene = entities.currentScene() -local controller = entities.controller() -local camera = controller:getComponent("Camera") -local metadata = ent:getComponent("Metadata") -local masterdata = scene:getComponent("Metadata") - -local children = { - mainText = ent:loadChild("./main-text.json",true), - circleOut = ent:loadChild("./circle-out.json",true), - circleIn = ent:loadChild("./circle-in.json",true), - start = ent:loadChild("./start.json",true), - quit = ent:loadChild("./quit.json",true), -} - -local timer = Timer.new() -if not timer:running() then timer:start() end - -local playSound = function( key ) - local url = "/ui/" .. key .. ".ogg" - local assetLoader = scene:getComponent("Asset") - assetLoader:cache(string.resolveURI(url), ent:formatHookName("asset:Load.%UID%")) -end -local destination = function( obj, x, y, z ) - local static = Static.get(obj) - local transform = obj:getComponent("Transform") - static.from = Vector3f(x or transform.position.x, y or transform.position.y, z or transform.position.z) -end - -pcall( function() - local metadata = controller:getComponent("Metadata") - local json = json.readFromFile("./data/entities/player.json"); - controller:callHook("object:UpdateMetadata.%UID%", { - overlay = json["metadata"]["overlay"] - }) - camera:update(true); -end ) - -destination(children.mainText, nil, -2, 0) -destination(children.circleOut, nil, -2, 0) -destination(children.circleIn, nil, 2, 0) -destination(children.start, -1.5, nil, 0) -destination(children.quit, -1.5, nil, 0) - -ent:addHook("asset:Load.%UID%", function( json ) - local filename = json["filename"] - if filename == "" or string.extension( filename ) ~= "ogg" then return false end - - local sfx = ent:getComponent("Audio") - if not sfx:playing() then sfx:stop() end - sfx:load( filename ) - sfx:setVolume( masterdata["volumes"]["sfx"] ) - sfx:play() - - return true -end ) - -ent:bind( "tick", function(self) - local static = Static.get(self) - if not static.alpha then - static.alpha = 0 - end - - metadata["initialized"] = true; - if static.alpha >= 1.0 then - static.alpha = 1.0 - else - static.alpha = static.alpha + time.delta() * 1.5 - end - - -- make background glow - local glow = 1 + math.sin(1.25 * time.current()) * 0.125 - metadata["color"][1] = glow - metadata["color"][2] = glow - metadata["color"][3] = glow - metadata["alpha"] = static.alpha; - self:setComponent("Metadata", metadata) - - camera:update(true); - - -- iterate children in batch - for k, v in pairs(children) do - if v:uid() <= 0 then goto continue end - - -- set alpha - local metadata = v:getComponent("Metadata") - metadata["alpha"] = static.alpha - v:setComponent("Metadata", metadata) - - local transform = v:getComponent("Transform") - local static = Static.get(v) - -- translation - if not static.from then goto continue end - if not static.to then static.to = Vector3f(transform.position) end - if not static.delta then static.delta = 0 end - - if static.delta >= 1 then - static.delta = 1 - else - static.delta = static.delta + time.delta() * 1.5 - transform.position = Vector3f.lerp( static.from, static.to, static.delta ) - end - - ::continue:: - end - - -- circle in - child = children.circleIn - if child:uid() > 0 then - local static = Static.get( child ) - - local transform = child:getComponent("Transform") - local metadata = child:getComponent("Metadata") - - -- rotation - local speed = metadata["hovered"] and 0.25 or 0.0125 - static.time = (static.time or 0) + time.delta() * -speed - transform.orientation = Quaternion.axisAngle( Vector3f(0, 0, 1), static.time ) - end - -- circle out - child = children.circleOut - if child:uid() > 0 then - local static = Static.get( child ) - - local transform = child:getComponent("Transform") - local metadata = child:getComponent("Metadata") - - -- rotation - local speed = metadata["hovered"] and 0.25 or 0.0125 - static.time = (static.time or 0) + time.delta() * speed - transform.orientation = Quaternion.axisAngle( Vector3f(0, 0, 1), static.time ) - end -end ) \ No newline at end of file diff --git a/data/entities/gui/mainmenu/start.json b/data/entities/gui/mainmenu/start.json deleted file mode 100644 index 1b3ca801..00000000 --- a/data/entities/gui/mainmenu/start.json +++ /dev/null @@ -1,35 +0,0 @@ -{ - "name": "Menu: Start Option", - "type": "Gui", - "ignore": false, - "transform": { - "position": [ -0.75622, 0.446468, 0 ], - "rotation": { - "axis": [ 0, 0, 1 ], - "angle": 0 - }, - "scale": [ 1, 1, 1 ] - }, - "clickable": true, - "hoverable": true, - "metadata": { - "uv": [ 0, 0, 1, 1 ], - "location": "", - "scaling": "relative", - "debug": { - "moveable": false - }, - "events": { - "click": { - "name": "game:Scene.Load", - "payload": { - "scene": "SS2" - } - } - }, - "text settings": { - "string": "Start", - "string1": "スタート" - } - } -} \ No newline at end of file diff --git a/data/entities/gui/mainmenu/textures/menu.png b/data/entities/gui/mainmenu/textures/menu.png deleted file mode 100644 index 0d74366e..00000000 Binary files a/data/entities/gui/mainmenu/textures/menu.png and /dev/null differ diff --git a/data/entities/gui/mainmenu/textures/square.png b/data/entities/gui/mainmenu/textures/square.png deleted file mode 100644 index 3fd47364..00000000 Binary files a/data/entities/gui/mainmenu/textures/square.png and /dev/null differ diff --git a/data/entities/gui/pause/circle-in.json b/data/entities/gui/pause/circle-in.json deleted file mode 100644 index 21162ef3..00000000 --- a/data/entities/gui/pause/circle-in.json +++ /dev/null @@ -1,23 +0,0 @@ -{ - "name": "Menu: Circle Inner", - "type": "Gui", - "ignore": false, - "transform": { - "position": [ -0.86, 0.86, 0 ], - "rotation": { - "axis": [ 1, 0, 0 ], - "angle": 0 - }, - "scale": [ 1, 1, 1 ] - }, - "metadata": { - "uv": [ 0, 0, 1, 1 ], - "color": [ 1, 1, 1, 0.8 ], - "location": "", - "scaling": [ 0.64, 1 ], - "mode": "flat" - }, - "assets": [ - "https://cdn..xyz//unity/Android/sprite/sprite_magiccircle_in.png" - ] -} \ No newline at end of file diff --git a/data/entities/gui/pause/circle-out.json b/data/entities/gui/pause/circle-out.json deleted file mode 100644 index 9af75d9f..00000000 --- a/data/entities/gui/pause/circle-out.json +++ /dev/null @@ -1,25 +0,0 @@ -{ - "name": "Menu: Circle Outer", - "type": "Gui", - "ignore": false, - "transform": { - "position": [ -0.86, 0.86, 0 ], - "rotation": { - "axis": [ 1, 0, 0 ], - "angle": 0 - }, - "scale": [ 1, 1, 1 ] - }, - "clickable": false, - "hoverable": true, - "metadata": { - "uv": [ 0, 0, 1, 1 ], - "color": [ 1, 1, 1, 0.8 ], - "location": "", - "scaling": [ 0.64, 1 ], - "mode": "flat" - }, - "assets": [ - "https://cdn..xyz//unity/Android/sprite/sprite_magiccircle_out.png" - ] -} \ No newline at end of file diff --git a/data/entities/gui/pause/close.json b/data/entities/gui/pause/close.json deleted file mode 100644 index 2c863137..00000000 --- a/data/entities/gui/pause/close.json +++ /dev/null @@ -1,30 +0,0 @@ -{ - "name": "Menu: Close Option", - "type": "Gui", - "ignore": false, - "transform": { - "position": [ -0.65544, -0.339642, 0 ], - "rotation": { - "axis": [ 0, 0, 1 ], - "angle": 0 - }, - "scale": [ 0.156407, 0.0788377, 1 ] - }, - "clickable": true, - "hoverable": true, - "metadata": { - "uv": [ 0, 0, 1, 1 ], - "location": "", - "scaling": "relative", - "events": { - "click": { - "name": "menu:Close.%P-UID%", - "payload": {} - } - }, - "text settings": { - "string": "Close", - "string1": "クローズ" - } - } -} \ No newline at end of file diff --git a/data/entities/gui/pause/command-text.json b/data/entities/gui/pause/command-text.json deleted file mode 100644 index 303cd2b1..00000000 --- a/data/entities/gui/pause/command-text.json +++ /dev/null @@ -1,25 +0,0 @@ -{ - "name": "Menu: Command Text", - "type": "Gui", - "ignore": false, - "transform": { - "position": [ -0.830591, -0.699509, 0 ], - "rotation": { - "axis": [ 1, 0, 0 ], - "angle": 0 - }, - "scale": [ 0.258737, 0.115371, 1 ] - }, - "metadata": { - "uv": [ 0, 0, 1, 1 ], - "location": "", - "scaling": "relative", - "text settings": { - "stroke": [ 1, 0.749, 0.368, 1 ], - "color": [ 1, 0.749, 0.368, 1 ], - - "string": "Menu", - "string1": "コマンド" - } - } -} \ No newline at end of file diff --git a/data/entities/gui/pause/icon.json b/data/entities/gui/pause/icon.json deleted file mode 100644 index 3176abf4..00000000 --- a/data/entities/gui/pause/icon.json +++ /dev/null @@ -1,25 +0,0 @@ -{ - "name": "Gui: Icon", - "type": "Gui", - "ignore": false, - "transform": { - "position": [ 0, 0, 0 ], - "rotation": { - "axis": [ 0, 0, 1 ], - "angle": 0 - }, - "scale": [ 1, 1, 1 ] - }, - "metadata": { - "gui": { - "position": [ -0.875, -0.775, 0 ], - "uv": [ 0, 0, 1, 1 ], - "color": [ 1, 1, 1, 1 ], - "location": "", - "scaling": "fixed" - } - }, - "assets": [ - "https://cdn..xyz//unity/Android/icon/icon_agyou01_skin1.png" - ] -} \ No newline at end of file diff --git a/data/entities/gui/pause/main-text.json b/data/entities/gui/pause/main-text.json deleted file mode 100644 index 244c0a0f..00000000 --- a/data/entities/gui/pause/main-text.json +++ /dev/null @@ -1,23 +0,0 @@ -{ - "name": "Menu: Main Scroller", - "type": "Gui", - "ignore": true, - "transform": { - "position": [ 0.98, -2, 0 ], - "rotation": { - "axis": [ 0, 0, 1 ], - "angle": 1.5707963 - }, - "scale": [ 0.16, 1, 1 ] - }, - "hoverable": true, - "metadata": { - "uv": [ 0, 0, 1, 1 ], - "color": [ 0.113, 0.756, 0.988, 0.4 ], - "location": "", - "scaling": "relative" - }, - "assets": [ - "./textures/main.png" - ] -} \ No newline at end of file diff --git a/data/entities/gui/pause/menu.json b/data/entities/gui/pause/menu.json deleted file mode 100644 index 4c981bf9..00000000 --- a/data/entities/gui/pause/menu.json +++ /dev/null @@ -1,29 +0,0 @@ -{ - "name": "Gui: Menu", - "type": "Gui", - "behaviors": [ - "GuiBehavior" - ], - "ignore": false, - "transform": { - "position": [ 0, 0, 0 ], - "rotation": { - "axis": [ 0, 0, 1 ], - "angle": 0 - }, - "scale": [ 1, 1, 1 ] - }, - "metadata": { - "uv": [ 0, 0, 1, 1 ], - "color": [ 0.1, 0.05, 0.1, 0.5 ], - "location": "", - "scaling": "relative", - // "depth": 0.2, - "alpha": 1, - "mode": 1 - }, - "assets": [ - // "./textures/menu.png", - "./scripts/menu.lua" - ] -} \ No newline at end of file diff --git a/data/entities/gui/pause/quit.json b/data/entities/gui/pause/quit.json deleted file mode 100644 index 86aa526c..00000000 --- a/data/entities/gui/pause/quit.json +++ /dev/null @@ -1,43 +0,0 @@ -{ - "name": "Menu: Close Option", - "type": "Gui", - "ignore": false, - "transform": { - "position": [ -0.65544, -0.157698, 0 ], - "rotation": { - "axis": [ 0, 0, 1 ], - "angle": 0 - }, - "scale": [ 0.156407, 0.0788377, 1 ] - }, - "clickable": true, - "hoverable": true, - "metadata": { - "uv": [ 0, 0, 1, 1 ], - "location": "", - "scaling": "relative", - "debug": { - "moveable": true - }, - "events": { - "click": [ - { - "name": "menu:Close.%P-UID%", - "payload": { - "callback": { - "name": "game:Scene.Load", - "payload": { - "scene": "StartMenu" - }, - "scope": "scene" - } - } - } - ] - }, - "text settings": { - "string": "Quit", - "string1": "終了ã™ã‚‹" - } - } -} \ No newline at end of file diff --git a/data/entities/gui/pause/scripts/menu.lua b/data/entities/gui/pause/scripts/menu.lua deleted file mode 100644 index d755af28..00000000 --- a/data/entities/gui/pause/scripts/menu.lua +++ /dev/null @@ -1,194 +0,0 @@ -local scene = entities.currentScene() -local metadata = ent:getComponent("Metadata") -local masterdata = scene:getComponent("Metadata") - -local children = { - mainText = ent:loadChild("./main-text.json",true), - circleOut = ent:loadChild("./circle-out.json",true), - circleIn = ent:loadChild("./circle-in.json",true), - coverBar = ent:loadChild("./yellow-box.json",true), - commandText = ent:loadChild("./command-text.json",true), - tenkouseiOption = ent:loadChild("./tenkousei.json",true), - closeOption = ent:loadChild("./close.json",true), - quit = ent:loadChild("./quit.json",true), -} - -local soundEmitter = ent:loadChild("./sound.json",true) - -local timer = Timer.new() -if not timer:running() then timer:start() end - -Static = { - values = {}, - get = function( obj ) - if obj == nil then - obj = scene - end - if Static.values[""..obj:uid()] == nil then - Static.values[""..obj:uid()] = {} - end - return Static.values[""..obj:uid()] - end -} - -local destination = function( obj, x, y, z ) - local static = Static.get(obj) - local transform = obj:getComponent("Transform") - static.from = Vector3f(x or transform.position.x, y or transform.position.y, z or transform.position.z) -end --- circleOut -destination(children.circleOut, nil, -2, 0) -destination(children.circleIn, nil, 2, 0) -destination(children.coverBar, -1.5, nil, 0) -destination(children.commandText, -1.5, nil, 0) -destination(children.tenkouseiOption, -1.5, nil, 0) -destination(children.closeOption, -1.5, nil, 0) -destination(children.quit, -1.5, nil, 0) - -local playSound = function( key ) - local url = "/ui/" .. key .. ".ogg" - local assetLoader = scene:getComponent("Asset") - assetLoader:cache(string.resolveURI(url), soundEmitter:formatHookName("asset:Load.%UID%"), "") -end - -ent:addHook("menu:Close.%UID%", function( json ) - playSound("menu close") - - metadata["system"]["hooks"]["onClose"] = json["callback"]; - metadata["system"]["closing"] = true; - ent:setComponent("Metadata", metadata) -end ) - ---[[ -ent:addHook("asset:Load.%UID%", function( json ) - local filename = json["filename"] - if filename == "" or string.extension( filename ) ~= "ogg" then return false end - local sfx = ent:getComponent("Audio") - if not sfx:playing() then sfx:stop() end - sfx:load( filename ) - sfx:setVolume( masterdata["volumes"]["sfx"] ) - sfx:play() - return true -end ) -]] -playSound("menu open") - -ent:bind( "tick", function(self) - local static = Static.get(self) - if not static.alpha then - static.alpha = 0 - end - - -- handle closing - if metadata["system"]["closing"] then - if static.alpha <= 0 then - static.alpha = 0 - metadata["system"]["closing"] = false - metadata["system"]["closed"] = true - else - static.alpha = static.alpha - time.delta() - end - elseif metadata["system"]["closed"] then - timer:stop() - local callback = metadata["system"]["hooks"]["onClose"] - if callback then - local payload = callback["payload"] - local target = self - if callback["scope"] == "parent" then - target = ent:getParent() - elseif callback["scope"] == "scene" then - target = scene - end - - if type(callback["delay"]) == "number" and target:uid() ~= self:uid() then - target:queueHook( callback["name"], payload, callback["delay"] ); - else - target:callHook( callback["name"], payload ); - end - end - entities.destroy(self) - -- scene:queueHook("system:Destroy", { uid = self:uid() }, 0) - return - else - if not metadata["initialized"] then - static.alpha = 0 - end - metadata["initialized"] = true; - if static.alpha >= 1.0 then - static.alpha = 1.0 - else - static.alpha = static.alpha + time.delta() * 1.5 - end - end - - metadata["alpha"] = static.alpha; - self:setComponent("Metadata", metadata) - -- set alphas - for k, v in pairs(children) do - if v:uid() <= 0 then goto continue end - - -- set alpha - local metadata = v:getComponent("Metadata") - metadata["alpha"] = static.alpha - v:setComponent("Metadata", metadata) - - local transform = v:getComponent("Transform") - local static = Static.get(v) - -- translation - if not static.from then goto continue end - if not static.to then static.to = Vector3f(transform.position) end - if not static.delta then static.delta = 0 end - - if static.delta >= 1 then - static.delta = 1 - else - static.delta = static.delta + time.delta() * 1.5 - transform.position = Vector3f.lerp( static.from, static.to, static.delta ) - end - - ::continue:: - end - - -- main text - local child = children.mainText - if child:uid() > 0 then - local transform = child:getComponent("Transform") - local metadata = child:getComponent("Metadata") - local speed = metadata["hovered"] and 0.75 or 0.5 - transform.position.y = transform.position.y + time.delta() * speed - if transform.position.y > 2 then - transform.position.y = -2 - end - end - -- circle in - child = children.circleIn - if child:uid() > 0 then - local static = Static.get( child ) - - local transform = child:getComponent("Transform") - local metadata = child:getComponent("Metadata") - - -- rotation - local speed = metadata["hovered"] and 0.25 or 0.0125 - static.time = (static.time or 0) + time.delta() * -speed - transform.orientation = Quaternion.axisAngle( Vector3f(0, 0, 1), static.time ) - end - -- circle out - child = children.circleOut - if child:uid() > 0 then - local static = Static.get( child ) - - local transform = child:getComponent("Transform") - local metadata = child:getComponent("Metadata") - - -- rotation - local speed = metadata["hovered"] and 0.25 or 0.0125 - static.time = (static.time or 0) + time.delta() * speed - transform.orientation = Quaternion.axisAngle( Vector3f(0, 0, 1), static.time ) - end - - if window.keyPressed("Escape") and timer:elapsed() >= 1 then - timer:reset() - self:callHook("menu:Close.%UID%", {}) - end -end ) \ No newline at end of file diff --git a/data/entities/gui/pause/sound.json b/data/entities/gui/pause/sound.json deleted file mode 100644 index 521052cd..00000000 --- a/data/entities/gui/pause/sound.json +++ /dev/null @@ -1,38 +0,0 @@ -{ - "type": "Object", - "name": "Sound Emitter", - "ignore": false, - "assets": [ - ], - "behaviors": [ - "SoundEmitterBehavior" - ], - "transform": { - "position": [ 0, 0, 0 ], - "rotation": { - "axis": [ 0, 1, 0 ], - "angle": 0 - }, - "scale": [ 1, 1, 1 ] - }, - "system": { - "hot reload": { - "enabled": true - }, - "defaults": { - "render": true, - "asset load": true - }, - "load": { - "ignore": true - } - }, - "metadata": { - "audio": { - "spatial": false, - "loop": false, - "volume": "sfx", - "rolloffFactor": 2 - } - } -} \ No newline at end of file diff --git a/data/entities/gui/pause/tenkousei.json b/data/entities/gui/pause/tenkousei.json deleted file mode 100644 index 373b5f35..00000000 --- a/data/entities/gui/pause/tenkousei.json +++ /dev/null @@ -1,24 +0,0 @@ -{ - "name": "Menu: Tenkousei Option", - "type": "Gui", - "ignore": true, - "transform": { - "position": [ -0.65544, -0.52853, 0 ], - "rotation": { - "axis": [ 0, 0, 1 ], - "angle": 0 - }, - "scale": [ 0.156407, 0.0788377, 1 ] - }, - "clickable": true, - "hoverable": true, - "metadata": { - "uv": [ 0, 0, 1, 1 ], - "location": "", - "scaling": "relative", - "text settings": { - "string": "", - "string1": "「転光生ã€" - } - } -} \ No newline at end of file diff --git a/data/entities/gui/pause/textures/menu.png b/data/entities/gui/pause/textures/menu.png deleted file mode 100644 index 56972c21..00000000 Binary files a/data/entities/gui/pause/textures/menu.png and /dev/null differ diff --git a/data/entities/gui/pause/textures/square.png b/data/entities/gui/pause/textures/square.png deleted file mode 100644 index 3fd47364..00000000 Binary files a/data/entities/gui/pause/textures/square.png and /dev/null differ diff --git a/data/entities/gui/pause/transient-portrait.json b/data/entities/gui/pause/transient-portrait.json deleted file mode 100644 index 616418ae..00000000 --- a/data/entities/gui/pause/transient-portrait.json +++ /dev/null @@ -1,21 +0,0 @@ -{ - "name": "Menu: Transient Portrait", - "type": "Gui", - "ignore": true, - "transform": { - "position": [ 0.76, 0.2, 0 ], - "rotation": { - "axis": [ 1, 0, 0 ], - "angle": 0 - }, - "scale": [ 0.43, 1, 1 ] - }, - "clickable": true, - "metadata": { - "uv": [ 0, 0, 1, 1 ], - "color": [ 1, 1, 1, 0 ], - "location": "", - "scaling": "relative", - "depth": 0.1 - } -} \ No newline at end of file diff --git a/data/entities/gui/pause/transient-shadow.json b/data/entities/gui/pause/transient-shadow.json deleted file mode 100644 index 908f7c47..00000000 --- a/data/entities/gui/pause/transient-shadow.json +++ /dev/null @@ -1,21 +0,0 @@ -{ - "name": "Menu: Transient Shadow", - "type": "Gui", - "ignore": true, - "transform": { - "position": [ 0.46, 0, 0 ], - "rotation": { - "axis": [ 1, 0, 0 ], - "angle": 0 - }, - "scale": [ 0.43, 1, 1 ] - }, - "metadata": { - "uv": [ 0, 0, 1, 1 ], - "color": [ 1, 1, 1, 0 ], - "location": "", - "scaling": "relative", - "shader": 1, - "depth": 0.1 - } -} \ No newline at end of file diff --git a/data/entities/gui/pause/yellow-box.json b/data/entities/gui/pause/yellow-box.json deleted file mode 100644 index 49d36850..00000000 --- a/data/entities/gui/pause/yellow-box.json +++ /dev/null @@ -1,25 +0,0 @@ -{ - "name": "Menu: Left Rectangle", - "type": "Gui", - "ignore": false, - "transform": { - "position": [ -0.933374, 0, 0 ], - "rotation": { - "axis": [ 1, 0, 0 ], - "angle": 0 - }, - "scale": [ 0.067, 1, 1 ] - }, - "metadata": { - "uv": [ 0, 0, 1, 1 ], - // "color": [ 1, 0.749, 0.368, 1 ], - "color": [ 1, 0.749, 0.368, 1 ], - "location": "", - "scaling": "relative", - "shader": 1, - "mode": "flat" - }, - "assets": [ - "./textures/square.png" - ] -} \ No newline at end of file diff --git a/data/entities/gui/text/letter.json b/data/entities/gui/text/letter.json deleted file mode 100644 index c4e85168..00000000 --- a/data/entities/gui/text/letter.json +++ /dev/null @@ -1,22 +0,0 @@ -{ - "name": "Gui: Text", - "type": "Object", - "behaviors": [ - "GuiBehavior" - ], - "ignore": false, - "transform": { - "position": [ 0, 0, 0 ], - "rotation": { - "axis": [ 0, 0, 1 ], - "angle": 0 - }, - "scale": [ 1, 1, 1 ] - }, - "metadata": { - "uv": [ 0, 0, 1, 1 ], - "color": [ 1, 1, 1, 1 ], - "location": "", - "scaling": "relative" - } -} \ No newline at end of file diff --git a/data/entities/gui/text/string.json b/data/entities/gui/text/string.json deleted file mode 100644 index a2556cce..00000000 --- a/data/entities/gui/text/string.json +++ /dev/null @@ -1,42 +0,0 @@ -{ - "name": "Gui: Text", - "type": "Gui", - "ignore": true, - "transform": { - "position": [ 0, 0, 0 ], - "rotation": { - "axis": [ 0, 0, 1 ], - "angle": 0 - }, - "scale": [ 1, 1, 1 ] - }, - "metadata": { - "text settings": { - "legacy": false, - "padding": [ 4, 4 ], - "spread": 4, - "weight": 0.48395, - "size": 72, - "scale": 1.25, - // "size": 112, - // "scale": 1, - "sdf": true, - "font": "TAZUGANEGOTHICSTDN-BOLD.otf", - "kerning": 24, - // "font": "Coolvetica.ttf", - - "stroke": [ 0, 0, 0, 0 ], - "color": [ 1, 1, 1, 1 ], - - "direction": "down", - "align": "left", - "origin": [ 0, 0 ], - - "string": "", - - "world": false, - // "depth": 0, - "wrap": true - } - } -} \ No newline at end of file diff --git a/data/entities/hands.json b/data/entities/hands.json deleted file mode 100644 index 45774fbd..00000000 --- a/data/entities/hands.json +++ /dev/null @@ -1,76 +0,0 @@ -{ - "name": "Hands", - "type": "Object", - "ignore": true, - "transform": { - "position": [ 0, 0, 0 ], - "rotation": { - "axis": [ 0, 1, 0 ], - "angle": 0.0 - }, - "scale": [ 1, 1, 1 ] - }, - "assets": [ - ], - "behaviors": [ - "PlayerHandBehavior" - ], - "metadata": { - "hands": { - "left": { - "controller": { - "model": "{indexcontroller}valve_controller_knu_1_0_left", - "color": [ 1, 1, 1, 1 ] - }, - "light": { - "should": false, - "type": 3, - "color": [1, 1, 1], - "power": 50, - "fov": 80, - "shadows": true, - "bias": 0.000005, - "resolution": 512, - "static": false - }, - "pointer": { - "color": [ 1, 0, 1, 1 ], - "length": 0, //128, - "width": 8, - "offset": [ 0, 0, 0 ], - "orientation": { - "axis": [ 1, 0, 0 ], - "angle": 0 - } - } - }, - "right": { - "controller": { - "model": "{indexcontroller}valve_controller_knu_1_0_right", - "color": [ 1, 1, 1, 1 ] - }, - "light": { - "should": false, - "type": 3, - "color": [1, 1, 1], - "power": 50, - "fov": 80, - "shadows": true, - "bias": 0.000005, - "resolution": 512, - "static": false - }, - "pointer": { - "color": [ 1, 0, 1, 1 ], - "length": 0, //128, - "width": 8, - "offset": [ 0, 0, 0 ], - "orientation": { - "axis": [ 1, 0, 0 ], - "angle": 0 - } - } - } - } - } -} \ No newline at end of file diff --git a/data/entities/hud.json b/data/entities/hud.json deleted file mode 100644 index 1d99139b..00000000 --- a/data/entities/hud.json +++ /dev/null @@ -1,29 +0,0 @@ -{ - "name": "HUD Text", - "type": "Gui", - "ignore": false, - "transform": { - "position": [ -0.830591, -0.899509, 0 ], - "rotation": { - "axis": [ 1, 0, 0 ], - "angle": 0 - }, - "scale": [ 0.258737, 0.115371, 1 ] - }, - "system": { - "hot reload": { - "enabled": true - } - }, - "metadata": { - "uv": [ 0, 0, 1, 1 ], - "location": "", - "scaling": "relative", - "text settings": { - "stroke": [ 1, 0.749, 0.368, 1 ], - "color": [ 1, 0.749, 0.368, 1 ], - "depth": 0.5, - "string": "." - } - } -} \ No newline at end of file diff --git a/data/entities/light.json b/data/entities/light.json deleted file mode 100644 index 56646195..00000000 --- a/data/entities/light.json +++ /dev/null @@ -1,44 +0,0 @@ -{ - "type": "Object", - "name": "Light", - "behaviors": [ "LightBehavior" ], - "ignore": false, - "transform": { - "reference": true - }, - "system": { - "renderer": { - // "limiter": 128 - // "mode": "round robin" - // "mode": "once" - "mode": "in-range" - }, - "behavior-0": { - "tick": { - "head loop children": true, - "forward iteration": false, - "multithreading": false - }, - "render": { - "multithreading": false - } - } - }, - "metadata": { - "light": { - "type": "point", - "color": [1, 1, 1], - "power": 100, - "fov": 90, - "bias": { - "constant": 1.25, - "slope": 1.75, - "shader": 0.00005 - }, - "radius": [0.05, 0], - "resolution": 512, - "shadows": true, - "static": false - } - } -} \ No newline at end of file diff --git a/data/entities/player.json b/data/entities/player.json deleted file mode 100644 index 88c85b2a..00000000 --- a/data/entities/player.json +++ /dev/null @@ -1,108 +0,0 @@ -{ - "name": "Player", - "type": "Object", - "behaviors": [ - "PlayerBehavior", - "CraetureBehavior" - ], - "ignore": false, - "transform": { - "position": [ 0, 0, 0 ], - "rotation": { - "axis": [ 0, 1, 0 ], - "angle": 0.0 - }, - "scale": [ 1, 1, 1 ] - }, - "assets": [ - { "filename": "./playerModel.json", "delay": 1.0, "single threaded": true }, - "./hands.json" - ], - "system": { - "behavior-0": { - "tick": { - "head loop children": false, - "multithreading": false - } - }, - "physics": { - "collision": 1.0, - "impulse": true, - "gravity": [ 0, -9.81, 0 ], - "walk": 1, - "move": 4, - "run": 8, - "rotate": 1.25, - "crouch": 1, - "jump": [ 0, 4, 0 ], - - "type": "Capsule", - "radius": 1, - "height": 2, - "mass": 100, - "shared": false - } - }, - "metadata": { - "overlay": { - // "position": [ 0, 0, -3 ], - // "scale": [ -1.77778, -1, 1 ], - "position": [ 0, 0, -3 ], - "scale": [ 1.77778, -1, 1 ], - "orientation": [ 0, 0, 0, 1 ], - "floating": false, - "enabled": true, - "alpha": 1.0, - "cursor": { - "type": "mouse", - "radius": 0.05, - "color": [ 0.2, 0.2, 1.0, 1.0 ], - "enabled": false - } - }, - "light": { - "should": false, - "color": [1, 1, 1], - "position": [ 0, 2.5, 0 ], - "power": 0.1, - "radius": [0.001, 32] - }, - "region": { - "track": true, - "persist": true - }, - "audio": { - "footstep": { - "volume": 0.5, - "list": [ - "./data/audio/footstep/1.ogg", - "./data/audio/footstep/2.ogg" - ] - } - }, - "camera": { - "offset": [ 0, 0, 0 ], - "position" : [ 0, 2, 0 ], - "scale": [ 1, 1, 1 ], - "invert": [ false, false, false ], - "limit": { - // "minima": [ null, -1.57079633, null ], - // "maxima": [ null, 1.57079633, null ], - - "minima": [ null, -1.0, null ], - "maxima": [ null, 1.0, null ], - - "current": [ null, 0, null ] - }, - "settings": { - "fov" : 90, - "clip" : { "near" : 0.01, "far" : 512.0 }, - "size" : { - "auto" : true, - "x" : 7680, - "y" : 4320 - } - } - } - } -} \ No newline at end of file diff --git a/data/entities/playerModel.json b/data/entities/playerModel.json deleted file mode 100644 index bfe6c1ca..00000000 --- a/data/entities/playerModel.json +++ /dev/null @@ -1,49 +0,0 @@ -{ - "type": "Object", - "name": "Player: Model", - "ignore": false, - "assets": [ - "/player/bear.glb" - // "/player/s.glb" - ], - "behaviors": [ - "PlayerModelBehavior" - ], - "transform": { - "position": [ 0, -2.0, 0 ], - "rotation": { - "axis": [ 0, 1, 0 ], - "angle": 0 - }, - "scale": [ 0.16, 0.16, 0.16 ] - }, - "system": { - "hot reload": { - "enabled": true - }, - "defaults": { - // "render": true, - "asset load": true - } - }, - "metadata": { - "track via reference": true, - "track player": true, - "hide player model": true, - "model": { - "animation": "wank", - "print animations": true, - // "mesh optimization": 1, - "flags": { - "RENDER": true, - "COLLISION": false, - "SEPARATE": true, - "NORMALS": false, - "LOAD": false, - "ATLAS": false, - "SKINNED": true, - "INVERT": true - } - } - } -} \ No newline at end of file diff --git a/data/entities/portal.json b/data/entities/portal.json deleted file mode 100644 index 96f12861..00000000 --- a/data/entities/portal.json +++ /dev/null @@ -1,31 +0,0 @@ -{ - "type": "Portals", - "ignore": false, - "metadata": { - "portals": [ - { - "transform": { - "position": [ 0, 0, -10 ], - "orientation": [ 0, 0, 0, 1 ], - "scale": [ 6, 4, 1 ] - }, - "metadata": { - - } - }, - { - "transform": { - "position": [ 0, 0, 10 ], - "rotation": { - "axis": [ 0, 1, 0 ], - "angle": 3.14159 - }, - "scale": [ 6, 4, 1 ] - }, - "metadata": { - - } - } - ] - } -} \ No newline at end of file diff --git a/data/entities/scene.json b/data/entities/scene.json deleted file mode 100644 index f51551a1..00000000 --- a/data/entities/scene.json +++ /dev/null @@ -1,11 +0,0 @@ -{ - "name": "Scene", - "assets": [ - "/gui.json" - ], - "behaviors": [ - "SceneBehavior", - "SceneCollisionBehavior", - "ExtSceneBehavior" - ] -} \ No newline at end of file diff --git a/data/entities/scenes/mcdonalds/audio/soundscape/ambience.ogg b/data/entities/scenes/mcdonalds/audio/soundscape/ambience.ogg deleted file mode 100644 index 8d6a9686..00000000 Binary files a/data/entities/scenes/mcdonalds/audio/soundscape/ambience.ogg and /dev/null differ diff --git a/data/entities/scenes/mcdonalds/loading.json b/data/entities/scenes/mcdonalds/loading.json deleted file mode 100644 index 0ec6c59c..00000000 --- a/data/entities/scenes/mcdonalds/loading.json +++ /dev/null @@ -1,32 +0,0 @@ -{ - "name": "Gui: Loading", - "type": "Object", - "behaviors": [ - // "GuiBehavior" - ], - "assets": [ - { "filename": "./mcdonalds.json", "delay": 0 } - ], - "ignore": false, - "transform": { - "position": [ -0.830591, -0.699509, 0 ], - "rotation": { - "axis": [ 1, 0, 0 ], - "angle": 0 - }, - "scale": [ 0.258737, 0.115371, 1 ] - }, - "metadata": { - "uv": [ 0, 0, 1, 1 ], - "color": [ 1, 1, 1, 0.1 ], - "location": "", - "scaling": "relative", - "text settings": { - "stroke": [ 1, 0.749, 0.368, 1 ], - "color": [ 1, 0.749, 0.368, 1 ], - - "string": "Loading...", - "string1": "コマンド" - } - } -} \ No newline at end of file diff --git a/data/entities/scenes/mcdonalds/marker.json b/data/entities/scenes/mcdonalds/marker.json deleted file mode 100644 index e724cc23..00000000 --- a/data/entities/scenes/mcdonalds/marker.json +++ /dev/null @@ -1,24 +0,0 @@ -{ - "name": "Marker", - "type": "Gui", - "ignore": false, - "transform": { - "position": [ 0, 0, 0 ], - "rotation": { - "axis": [ 1, 0, 0 ], - "angle": 0 - }, - "scale": [ 1, 1, 1 ] - }, - "metadata": { - "uv": [ 0, 0, 1, 1 ], - "color": [ 1, 1, 1, 0.8 ], - "location": "", - "scaling": [ 1, 1 ], - "world": true, - "gui layer": false - }, - "assets": [ - "https://cdn..xyz//unity/Android/sprite/sprite_magiccircle_in2.png" - ] -} \ No newline at end of file diff --git a/data/entities/scenes/mcdonalds/mcdonalds.json b/data/entities/scenes/mcdonalds/mcdonalds.json deleted file mode 100644 index 58763206..00000000 --- a/data/entities/scenes/mcdonalds/mcdonalds.json +++ /dev/null @@ -1,78 +0,0 @@ -{ - "type": "Object", - "name": "Map", - "ignore": false, - "assets": [ - { "filename": "./models/mcdonalds.glb", "delay": 0, "single threaded": false }, - { "filename": "./static.json", "delay": 1 } - ], - "behaviors": [ - "LoadingBehavior" - ], - "transform": { - "position": [ 0, 0, 0 ], - "rotation": { - "axis": [ 0, 1, 0 ], - "angle": 0 - }, - "scale": [ 1, 1, 1 ] - }, - "system": { - "defaults": { - "asset load": true - } - }, - "metadata": { - "textures": { - "map": { - // "22": [ 86, "sin(time)" ], - // "4": [ 88, "sin(time)" ], - // "36": [ 87, 1.0 ] - } - }, - "model": { - // "mesh optimization": 0, - "cull mode": "auto", - "flags": { - "RENDER": true, - "COLLISION": false, - "SEPARATE": false, - "NORMALS": false, - "LOAD": false, - "ATLAS": true, - "SKINNED": false, - "INVERT": false, - "TRANSFORM": false - }, - "lights": { - // "renderMode": { "target": "worldspawn_1" }, - "shadows": true - }, - "tags": { - "worldspawn_1": { "collision": "static mesh" }, - "worldspawn_2": { "collision": "static mesh" }, - "info_player_spawn": { "action": "attach", "filename": "./player.json", "preserve orientation": true }, - /* - "light_5752": { - "transform": { "offset": true, "position": [ 0, -2.1768, 0 ] }, - "light": { - // "flicker": { "rate": 0.5, "power": 0, "timeout": 4 }, - "fade": { "rate": 4, "color": [0, 0, 0], "timeout": 16 }, - "shadows": false - } - }, - */ - "func_door_rotating_5243": { "action": "load", "payload": { "assets": ["./scripts/door.lua"], "metadata": { "angle":-1.570795 } } }, - "func_door_rotating_5444": { "action": "load", "payload": { "assets": ["./scripts/door.lua"], "metadata": { "angle": 1.570795 } } }, - "func_door_rotating_5495": { "action": "load", "payload": { "assets": ["./scripts/door.lua"], "metadata": { "angle": 1.570795 } } }, - "func_door_rotating_5220": { "action": "load", "payload": { "assets": ["./scripts/door.lua"], "metadata": { "angle":-1.570795 } } }, - "func_door_rotating_5556": { "action": "load", "payload": { "assets": ["./scripts/door.lua"], "metadata": { "angle": 1.570795 } } }, - "func_door_rotating_5689": { "action": "load", "payload": { "assets": ["./scripts/door.lua"], "metadata": { "angle":-1.570795 } } }, - "func_door_rotating_5712": { "action": "load", "payload": { "assets": ["./scripts/door.lua"], "metadata": { "angle": 1.570795 } } }, - "func_door_rotating_5576": { "action": "load", "payload": { "assets": ["./scripts/door.lua"], "metadata": { "angle":-1.570795 } } }, - "func_door_rotating_5584": { "action": "load", "payload": { "assets": ["./scripts/door.lua"], "metadata": { "angle":-1.570795 } } }, - "func_door_rotating_5568": { "action": "load", "payload": { "assets": ["./scripts/door.lua"], "metadata": { "angle":-1.570795 } } } - } - } - } -} \ No newline at end of file diff --git a/data/entities/scenes/mcdonalds/player.json b/data/entities/scenes/mcdonalds/player.json deleted file mode 100644 index dec26007..00000000 --- a/data/entities/scenes/mcdonalds/player.json +++ /dev/null @@ -1,19 +0,0 @@ -{ - "import": "/player.json", - "assets": [ - // { "filename": "/gui/hud/hud.json", "delay": 0 } - ], - "metadata": { - "overlay": { - "floating": true - }, - "collider": true, - "light": { - "should": false, - "color": [1, 1, 1], - "position": [ 0, 2.5, 0 ], - "power": 1, - "radius": [0.001, 32] - } - } -} \ No newline at end of file diff --git a/data/entities/scenes/mcdonalds/scene.json b/data/entities/scenes/mcdonalds/scene.json deleted file mode 100644 index 0531f9d8..00000000 --- a/data/entities/scenes/mcdonalds/scene.json +++ /dev/null @@ -1,50 +0,0 @@ -{ - "import": "/scene.json", - "assets": [ - "./audio/soundscape/ambience.ogg", - "./loading.json" - ], - "system": { - "hot reload": { - "enabled": true - }, - "renderer": { - "shader": { - "mode": 1, - "scalar": 16, - "parameters": [ 0, 0, 0, 0 ] - }, - "clear values": [ - [ 1, 1, 1, 0 ] - ] - } - }, - "metadata": { - "menus": { - "pause": "/gui/pause/menu.json" - }, - "volumes": { - "sfx": 0.25, - "bgm": 0.75, - "voice": 1.0 - }, - "light": { - "ambient": [ 0.025, 0.025, 0.025 ], - "kexp": 0, - "fog": { - "color": [ 0.25, 0.25, 0.25 ], - "range": [ 32, 64 ], - "step scale": 4, - "absorbtion": 0.07, - "density": { - "threshold": 0.35, - "multiplier": 5.0, - "scale": 25.0, - "offset": [0, -1, 1], - "timescale": 8 - } - }, - "should": true - } - } -} \ No newline at end of file diff --git a/data/entities/scenes/mcdonalds/scripts/door.lua b/data/entities/scenes/mcdonalds/scripts/door.lua deleted file mode 100644 index 33848703..00000000 --- a/data/entities/scenes/mcdonalds/scripts/door.lua +++ /dev/null @@ -1,18 +0,0 @@ -local scene = entities.currentScene() -local controller = entities.controller() - -local timer = Timer.new() -if not timer:running() then - timer:start(); -end - -local target = Vector3f(0,0,0) -local transform = ent:getComponent("Transform") -local metadata = ent:getComponent("Metadata") -local speed = metadata["speed"] or 1.0 / 3.0 -local starting = Quaternion(transform.orientation) -local ending = transform.orientation:multiply(Quaternion.axisAngle( Vector3f(0,1,0), metadata["angle"] )) --- on tick -ent:bind( "tick", function(self) - transform.orientation = starting:slerp( ending, math.cos(time.current() * speed) * 0.5 + 0.5 ) -end ) \ No newline at end of file diff --git a/data/entities/scenes/mcdonalds/scripts/realign.lua b/data/entities/scenes/mcdonalds/scripts/realign.lua deleted file mode 100644 index 84527d13..00000000 --- a/data/entities/scenes/mcdonalds/scripts/realign.lua +++ /dev/null @@ -1,22 +0,0 @@ -local scene = entities.currentScene() -local controller = entities.controller() - -local timer = Timer.new() -if not timer:running() then - timer:start(); -end - -local transform = ent:getComponent("Transform") --- on tick -ent:bind( "tick", function(self) - local offset = Vector3f(0,0,0) - if window.keyPressed("J") then offset.x = offset.x - time.delta() end - if window.keyPressed("L") then offset.x = offset.x + time.delta() end - if window.keyPressed("N") then offset.y = offset.y - time.delta() end - if window.keyPressed("M") then offset.y = offset.y + time.delta() end - if window.keyPressed("I") then offset.z = offset.z - time.delta() end - if window.keyPressed("K") then offset.z = offset.z + time.delta() end - if offset:magnitude() > 0.0001 then - transform.position = transform.position + offset - end -end ) \ No newline at end of file diff --git a/data/entities/scenes/mcdonalds/scripts/static.lua b/data/entities/scenes/mcdonalds/scripts/static.lua deleted file mode 100644 index d1b3a7a7..00000000 --- a/data/entities/scenes/mcdonalds/scripts/static.lua +++ /dev/null @@ -1,90 +0,0 @@ -local scene = entities.currentScene() -local controller = entities.controller() - -local timer = Timer.new() -if not timer:running() then - timer:start(); -end - --- release control -hooks.call("window:Mouse.CursorVisibility", { state = true }) -hooks.call("window:Mouse.Lock", {}); - --- on tick -ent:bind( "tick", function(self) - -- update static effect - local metadatas = { - ent = ent:getComponent("Metadata"), - scene = scene:getComponent("Metadata") - } - local transforms = { - ent = ent:getComponent("Transform"), - controller = controller:getComponent("Transform") - } - local distanceSquared = transforms.controller.position:distance( transforms.ent.position ) - distanceSquared = distanceSquared * distanceSquared - if type(metadatas.ent["static"]["scale"]) == "number" then - distanceSquared = distanceSquared * metadatas.ent["static"]["scale"] - end - local lo = type(metadatas.ent["static"]["range"][1]) == "number" and metadatas.ent["static"]["range"][1] or 0.1 - local hi = type(metadatas.ent["static"]["range"][2]) == "number" and metadatas.ent["static"]["range"][2] or 0.5 - local staticBlend = distanceSquared > 1 and 1.0 / distanceSquared or 1.0 - staticBlend = math.clamp( staticBlend, lo, hi ) - - local flicker = type(metadatas.ent["static"]["flicker"]) == "number" and metadatas.ent["static"]["flicker"] or 0.001 - local pieces = type(metadatas.ent["static"]["pieces"]) == "number" and metadatas.ent["static"]["pieces"] or 1000 - - local payload = { - mode = 2, - parameters = { - [1] = flicker, - [2] = pieces, - [3] = staticBlend, - [4] = "time" - } - } - scene:callHook("shader:Update.%UID%", payload) -end ) - - -local hud = ent:loadChild("/hud.json", true) -hud:bind( "tick", function(self) - -- update distance HUD element - if timer:elapsed() <= 0.0125 then return end - timer:reset() - - local metadata = self:getComponent("Metadata") - local transforms = { - controller = controller:getComponent("Transform"), - source = ent:getComponent("Transform") - } - local distance = transforms.controller.position:distance( transforms.source.position ) - --distance = string.si( distance, "m" ) - local maximum = 40 - local value = math.floor(distance/maximum * 100) - if value >= 100 then value = 100 end - distance = "Sanity: " .. value .. "%" - --distance = math.floor((15-distance)/15 * 100) .. "%" - if metadata["text settings"]["string"] ~= distance then - self:callHook( "gui:UpdateString.%UID%", { - string = distance - } ) - end -end ) - ---[[ -local marker = ent:loadChild("./marker.json", true) -marker:bind( "tick", function(self) - local transform = marker:getComponent("Transform") - local parentTransform = ent:getComponent("Transform") - local controllerTransform = controller:getComponent("Transform") - - local controllerCamera = controller:getComponent("Camera") - local controllerCameraTransform = controllerCamera:getTransform() - - transform.position = parentTransform.position + Vector3f(0,3,0) - transform.orientation = Quaternion.lookAt( transform.position - controllerTransform.position, Vector3f(0,1,0) ) - -- transform.orientation = transform.orientation:normalize() - -- transform.model = controllerCamera:getProjection() * controllerCamera:getView() * Matrix4f.translate( transform.position ) * transform.orientation:matrix() -end ) -]] \ No newline at end of file diff --git a/data/entities/scenes/mcdonalds/static.json b/data/entities/scenes/mcdonalds/static.json deleted file mode 100644 index 57ba0254..00000000 --- a/data/entities/scenes/mcdonalds/static.json +++ /dev/null @@ -1,47 +0,0 @@ -{ - "type": "Object", - "name": "Static Emitter", - "ignore": true, - "assets": [ - "/overworld/static.ogg", - "./scripts/static.lua" - ], - "behaviors": [ - "SoundEmitterBehavior" - ], - "transform": { - "position": [ -10.5331, -0.956335, 10.2349 ], - "rotation": { - "axis": [ 0, 1, 0 ], - "angle": 0 - }, - "scale": [ 1, 1, 1 ] - }, - "system": { - "hot reload": { - "enabled": true - }, - "defaults": { - "render": true, - "asset load": true - }, - "load": { - "ignore": true - } - }, - "metadata": { - "audio": { - "spatial": true, - "loop": true, - "volume": 1.6, - "rolloffFactor": 2 - }, - "static": { - "range": [ 0.0025, 1 ], - "flicker": 0.5, - "pieces": 16, - "scale": 0.4 - }, - "distance": false - } -} \ No newline at end of file diff --git a/data/entities/scenes/mcdonalds/textures/nggrs.png b/data/entities/scenes/mcdonalds/textures/nggrs.png deleted file mode 100644 index 786c52d0..00000000 Binary files a/data/entities/scenes/mcdonalds/textures/nggrs.png and /dev/null differ diff --git a/data/entities/scenes/mcdonalds/textures/window.png b/data/entities/scenes/mcdonalds/textures/window.png deleted file mode 100644 index 741424c0..00000000 Binary files a/data/entities/scenes/mcdonalds/textures/window.png and /dev/null differ diff --git a/data/entities/scenes/mcdonalds/textures/wood-blood.png b/data/entities/scenes/mcdonalds/textures/wood-blood.png deleted file mode 100644 index 9ed51230..00000000 Binary files a/data/entities/scenes/mcdonalds/textures/wood-blood.png and /dev/null differ diff --git a/data/entities/scenes/raytracing/scene.json b/data/entities/scenes/raytracing/scene.json deleted file mode 100644 index 421c2b4b..00000000 --- a/data/entities/scenes/raytracing/scene.json +++ /dev/null @@ -1,66 +0,0 @@ -{ - "type": "Scene", - "behaviors": [ - "SceneBehavior", - "ExtSceneBehavior", - "RayTracingSceneBehavior" - ], - "assets": [ - "/gui.json", - "./light.json", - "/player.json" - ], - "system": { - "hot reload": { - "enabled": true - }, - "renderer": { - "clear values": [ - [ 0.3, 0.3, 0.3, 0 ] - ] - }, - "physics": { - "collision": true, - "single threaded": false, - "sort": false, - "use": { - "strongest": false, - "worker": true, - "queue": false - }, - "optimizations": { - "ignore static entities": true, - "ignore duplicate tests": true, - "entity-local update": true - } - } - }, - "metadata": { - "menus": { - "pause": "/gui/pause/menu.json" - }, - "rays": { - "marching steps": 0, - "ray bounces": 2, - "shadow factor": 0.5, - "reflection": { - "strength": 0.4, - "falloff": 0.5 - } - }, - "volumes": { - "sfx": 0.25, - "bgm": 0.75, - "voice": 1.0 - }, - "light": { - "ambient": [ 0.1, 0.1, 0.1 ], - "kexp": 0, - "fog": { - "color": [ 0.1, 0.1, 0.1 ], - "range": [ 32, 64 ] - }, - "should": true - } - } -} \ No newline at end of file diff --git a/data/entities/scenes/startmenu/player.json b/data/entities/scenes/startmenu/player.json deleted file mode 100644 index 255c5ff8..00000000 --- a/data/entities/scenes/startmenu/player.json +++ /dev/null @@ -1,16 +0,0 @@ -{ - "import": "/player.json", - "assets": [ - { "filename": "/hands.json", "delay": 0 } - ], - "system": { - "physics": { - "gravity": [ 0, 0, 0 ], - "clamp": { - "x": [0, 0], - "y": [0, 0], - "z": [0, 0] - } - } - } -} \ No newline at end of file diff --git a/data/entities/scenes/startmenu/scene.json b/data/entities/scenes/startmenu/scene.json deleted file mode 100644 index 9e36d917..00000000 --- a/data/entities/scenes/startmenu/scene.json +++ /dev/null @@ -1,24 +0,0 @@ -{ - "type": "Main Menu", - "behaviors": [ - "SceneBehavior", - "ExtSceneBehavior" - ], - "assets": [ - "/gui.json", - "./player.json", - "/ui/main menu.ogg", - "/gui/mainmenu/menu.json" - ], - "hot reload": { - "enabled": true - }, - "clear color": [ 0, 0, 0, 1 ], - "metadata": { - "volumes": { - "sfx": 0.25, - "bgm": 0.15, - "voice": 1.0 - } - } -} \ No newline at end of file diff --git a/data/fonts/Coolvetica.ttf b/data/fonts/Coolvetica.ttf deleted file mode 100644 index 410ca316..00000000 Binary files a/data/fonts/Coolvetica.ttf and /dev/null differ diff --git a/data/fonts/TAZUGANEGOTHICSTDN-BOLD.otf b/data/fonts/TAZUGANEGOTHICSTDN-BOLD.otf deleted file mode 100644 index 1878242d..00000000 Binary files a/data/fonts/TAZUGANEGOTHICSTDN-BOLD.otf and /dev/null differ diff --git a/data/fonts/consola.ttf b/data/fonts/consola.ttf deleted file mode 100644 index 07d987e9..00000000 Binary files a/data/fonts/consola.ttf and /dev/null differ diff --git a/data/openvr_bindings_default.json b/data/openvr_bindings_default.json deleted file mode 100644 index 767330f3..00000000 --- a/data/openvr_bindings_default.json +++ /dev/null @@ -1,261 +0,0 @@ -{ - "controller_type" : "generic", - "description" : "Default bindings", - "name" : "Generic Bindings", - "bindings": { - "/actions/global": { - "sources": [ - { - "path": "/user/hand/right/input/a", - "mode": "button", - "inputs": { - "click": { - "output": "/actions/global/in/leftA" - } - } - }, - { - "path": "/user/hand/left/input/a", - "mode": "button", - "inputs": { - "click": { - "output": "/actions/global/in/rightA" - } - } - }, - { - "path": "/user/hand/left/input/b", - "mode": "button", - "inputs": { - "click": { - "output": "/actions/global/in/leftB" - } - } - }, - { - "path": "/user/hand/right/input/b", - "mode": "button", - "inputs": { - "click": { - "output": "/actions/global/in/rightB" - } - } - }, - { - "path": "/user/hand/left/input/trackpad", - "mode": "trackpad", - "inputs": { - "position": { - "output": "/actions/global/in/leftTrackpad" - }, - "touch": { - "output": "/actions/global/in/leftTouchpad" - } - } - }, - { - "path": "/user/hand/right/input/trackpad", - "mode": "trackpad", - "inputs": { - "position": { - "output": "/actions/global/in/rightTrackpad" - }, - "touch": { - "output": "/actions/global/in/rightTouchpad" - } - } - }, - { - "path": "/user/hand/left/input/trackpad", - "mode": "button", - "inputs": { - "click": { - "output": "/actions/global/in/leftClickpad" - } - } - }, - { - "path": "/user/hand/right/input/trackpad", - "mode": "button", - "inputs": { - "click": { - "output": "/actions/global/in/right_Clickpad" - } - } - }, - { - "path": "/user/hand/left/input/grip", - "mode": "force_sensor", - "inputs": { - "force": { - "output": "/actions/global/in/leftGrip" - } - } - }, - { - "path": "/user/hand/right/input/grip", - "mode": "force_sensor", - "inputs": { - "force": { - "output": "/actions/global/in/rightGrip" - } - } - }, - { - "path": "/user/hand/left/input/grip", - "mode": "grab", - "inputs": { - "grab": { - "output": "/actions/global/in/leftGrab" - } - } - }, - { - "path": "/user/hand/right/input/grip", - "mode": "grab", - "inputs": { - "grab": { - "output": "/actions/global/in/rightGrab" - } - } - }, - { - "path": "/user/hand/left/input/trigger", - "mode": "button", - "parameters": { - "haptic_amplitude": "0" - }, - "inputs": { - "click": { - "output": "/actions/global/in/leftClick" - } - } - }, - { - "path": "/user/hand/right/input/trigger", - "mode": "button", - "parameters": { - "haptic_amplitude": "0" - }, - "inputs": { - "click": { - "output": "/actions/global/in/rightClick" - } - } - }, - { - "path": "/user/hand/left/input/trigger", - "mode": "button", - "inputs": { - "click": { - "output": "/actions/global/in/leftTrigger" - } - } - }, - { - "path": "/user/hand/right/input/trigger", - "mode": "button", - "inputs": { - "click": { - "output": "/actions/global/in/rightTrigger" - } - } - }, - { - "path": "/user/hand/left/input/thumbstick", - "mode": "dpad_touch", - "parameters": { - "deadzone_pct": "85", - "overlap_pct": "0", - "sticky": "true" - }, - "inputs": { - "north": { - "output": "/actions/global/in/leftDPadUp" - }, - "south": { - "output": "/actions/global/in/leftDPadDown" - }, - "east": { - "output": "/actions/global/in/leftDPadRight" - }, - "west": { - "output": "/actions/global/in/leftDPadLeft" - } - } - }, - { - "path": "/user/hand/right/input/thumbstick", - "mode": "dpad_touch", - "parameters": { - "deadzone_pct": "85", - "overlap_pct": "0", - "sticky": "true" - }, - "inputs": { - "north": { - "output": "/actions/global/in/rightDPadUp" - }, - "south": { - "output": "/actions/global/in/rightDPadDown" - }, - "east": { - "output": "/actions/global/in/rightDPadRight" - }, - "west": { - "output": "/actions/global/in/rightDPadLeft" - } - } - }, - { - "path": "/user/hand/left/input/thumbstick", - "mode": "joystick", - "inputs": { - "position": { - "output": "/actions/global/in/leftThumbstick" - } - } - }, - { - "path": "/user/hand/right/input/thumbstick", - "mode": "joystick", - "inputs": { - "position": { - "output": "/actions/global/in/rightThumbstick" - } - } - } - ], - "poses": [ - { - "output": "/actions/global/in/leftHandPose", - "path": "/user/hand/left/pose/raw" - }, - { - "output": "/actions/global/in/rightHandPose", - "path": "/user/hand/right/pose/raw" - } - ], - "haptics": [ - { - "output": "/actions/global/out/leftHapticVibration", - "path": "/user/hand/left/output/haptic" - }, - { - "output": "/actions/global/out/rightHapticVibration", - "path": "/user/hand/right/output/haptic" - } - ], - "skeleton": [ - { - "output": "/actions/global/in/leftHandSkeleton", - "path": "/user/hand/left/input/skeleton/left" - }, - { - "output": "/actions/global/in/rightHandSkeleton", - "path": "/user/hand/right/input/skeleton/right" - } - ] - } - } -} \ No newline at end of file diff --git a/data/openvr_bindings_knuckles.json b/data/openvr_bindings_knuckles.json deleted file mode 100644 index 8abec4a3..00000000 --- a/data/openvr_bindings_knuckles.json +++ /dev/null @@ -1,275 +0,0 @@ -{ - "controller_type" : "knuckles", - "description" : "Default Index Knuckles bindings", - "name" : "Knuckles Bindings", - "bindings": { - "/actions/global": { - "sources": [ - { - "path": "/user/hand/left/input/a", - "mode": "button", - "inputs": { - "click": { - "output": "/actions/global/in/a.left" - } - } - }, - { - "path": "/user/hand/right/input/a", - "mode": "button", - "inputs": { - "click": { - "output": "/actions/global/in/a.right" - } - } - }, - { - "path": "/user/hand/left/input/b", - "mode": "button", - "inputs": { - "click": { - "output": "/actions/global/in/b.left" - } - } - }, - { - "path": "/user/hand/right/input/b", - "mode": "button", - "inputs": { - "click": { - "output": "/actions/global/in/b.right" - } - } - }, - { - "path": "/user/hand/left/input/trackpad", - "mode": "trackpad", - "inputs": { - "position": { - "output": "/actions/global/in/trackpad.left" - }, - "touch": { - "output": "/actions/global/in/touchpad.left" - } - } - }, - { - "path": "/user/hand/right/input/trackpad", - "mode": "trackpad", - "inputs": { - "position": { - "output": "/actions/global/in/trackpad.right" - }, - "touch": { - "output": "/actions/global/in/touchpad.right" - } - } - }, - { - "path": "/user/hand/left/input/trackpad", - "mode": "button", - "inputs": { - "click": { - "output": "/actions/global/in/clickpad.left" - } - } - }, - { - "path": "/user/hand/right/input/trackpad", - "mode": "button", - "inputs": { - "click": { - "output": "/actions/global/in/clickpad.right" - } - } - }, - { - "path": "/user/hand/left/input/grip", - "mode": "force_sensor", - "inputs": { - "force": { - "output": "/actions/global/in/grip.left" - } - } - }, - { - "path": "/user/hand/right/input/grip", - "mode": "force_sensor", - "inputs": { - "force": { - "output": "/actions/global/in/grip.right" - } - } - }, - { - "path": "/user/hand/left/input/grip", - "mode": "grab", - "inputs": { - "grab": { - "output": "/actions/global/in/grab.left" - } - } - }, - { - "path": "/user/hand/right/input/grip", - "mode": "grab", - "inputs": { - "grab": { - "output": "/actions/global/in/grab.right" - } - } - }, - { - "path": "/user/hand/left/input/trigger", - "mode": "button", - "parameters": { - "haptic_amplitude": "0" - }, - "inputs": { - "click": { - "output": "/actions/global/in/click.left" - } - } - }, - { - "path": "/user/hand/right/input/trigger", - "mode": "button", - "parameters": { - "haptic_amplitude": "0" - }, - "inputs": { - "click": { - "output": "/actions/global/in/click.right" - } - } - }, - { - "path": "/user/hand/left/input/trigger", - "mode": "trigger", - "inputs": { - "click": { - "output": "/actions/global/in/trigger.left" - } - } - }, - { - "path": "/user/hand/right/input/trigger", - "mode": "trigger", - "inputs": { - "click": { - "output": "/actions/global/in/trigger.right" - } - } - }, - { - "path": "/user/hand/left/input/thumbstick", - "mode": "dpad_touch", - "parameters": { - "deadzone_pct": "85", - "overlap_pct": "0", - "sticky": "true" - }, - "inputs": { - "north": { - "output": "/actions/global/in/dpadUp.left" - }, - "south": { - "output": "/actions/global/in/dpadDown.left" - }, - "east": { - "output": "/actions/global/in/dpadRight.left" - }, - "west": { - "output": "/actions/global/in/dpadLeft.left" - } - } - }, - { - "path": "/user/hand/right/input/thumbstick", - "mode": "dpad_touch", - "parameters": { - "deadzone_pct": "85", - "overlap_pct": "0", - "sticky": "true" - }, - "inputs": { - "north": { - "output": "/actions/global/in/dpadUp.right" - }, - "south": { - "output": "/actions/global/in/dpadDown.right" - }, - "east": { - "output": "/actions/global/in/dpadRight.right" - }, - "west": { - "output": "/actions/global/in/dpadLeft.right" - } - } - }, - { - "path": "/user/hand/left/input/thumbstick", - "mode": "joystick", - "inputs": { - "position": { - "output": "/actions/global/in/thumbstick.left" - }, - "click": { - "output": "/actions/global/in/thumbclick.left" - } - } - }, - { - "path": "/user/hand/right/input/thumbstick", - "mode": "joystick", - "inputs": { - "position": { - "output": "/actions/global/in/thumbstick.right" - }, - "click": { - "output": "/actions/global/in/thumbclick.right" - } - } - } - ], - "poses": [ - { - "output": "/actions/global/in/handPose.left", - "path": "/user/hand/left/pose/raw" - }, - { - "output": "/actions/global/in/handPose.right", - "path": "/user/hand/right/pose/raw" - }, - { - "output": "/actions/global/in/handTip.left", - "path": "/user/hand/left/pose/tip" - }, - { - "output": "/actions/global/in/handTip.right", - "path": "/user/hand/right/pose/tip" - } - ], - "haptics": [ - { - "output": "/actions/global/out/hapticVibration.left", - "path": "/user/hand/left/output/haptic" - }, - { - "output": "/actions/global/out/hapticVibration.right", - "path": "/user/hand/right/output/haptic" - } - ], - "skeleton": [ - { - "output": "/actions/global/in/handSkeleton.left", - "path": "/user/hand/left/input/skeleton/left" - }, - { - "output": "/actions/global/in/handSkeleton.right", - "path": "/user/hand/right/input/skeleton/right" - } - ] - } - } -} \ No newline at end of file diff --git a/data/openvr_manifest.json b/data/openvr_manifest.json deleted file mode 100644 index 6e2ded5d..00000000 --- a/data/openvr_manifest.json +++ /dev/null @@ -1,165 +0,0 @@ -{ - "default_bindings": [ - { - "controller_type": "knuckles", - "binding_url": "./openvr_bindings_knuckles.json" - } - ], - "actions": [ - { - "name": "/actions/global/in/a.left", - "type": "boolean" - }, - { - "name": "/actions/global/in/a.right", - "type": "boolean" - }, - { - "name": "/actions/global/in/b.left", - "type": "boolean" - }, - { - "name": "/actions/global/in/b.right", - "type": "boolean" - }, - { - "name": "/actions/global/in/trackpad.left", - "type": "vector2" - }, - { - "name": "/actions/global/in/touchpad.left", - "type": "vector2" - }, - { - "name": "/actions/global/in/trackpad.right", - "type": "vector2" - }, - { - "name": "/actions/global/in/touchpad.right", - "type": "vector2" - }, - { - "name": "/actions/global/in/clickpad.left", - "type": "boolean" - }, - { - "name": "/actions/global/in/clickpad.right", - "type": "boolean" - }, - { - "name": "/actions/global/in/grip.left", - "type": "vector1" - }, - { - "name": "/actions/global/in/grip.right", - "type": "vector1" - }, - { - "name": "/actions/global/in/grab.left", - "type": "boolean" - }, - { - "name": "/actions/global/in/grab.right", - "type": "boolean" - }, - { - "name": "/actions/global/in/click.left", - "type": "boolean" - }, - { - "name": "/actions/global/in/click.right", - "type": "boolean" - }, - { - "name": "/actions/global/in/trigger.left", - "type": "vector1" - }, - { - "name": "/actions/global/in/trigger.right", - "type": "vector1" - }, - { - "name": "/actions/global/in/dpadUp.left", - "type": "boolean" - }, - { - "name": "/actions/global/in/dpadDown.left", - "type": "boolean" - }, - { - "name": "/actions/global/in/dpadRight.left", - "type": "boolean" - }, - { - "name": "/actions/global/in/dpadLeft.left", - "type": "boolean" - }, - { - "name": "/actions/global/in/dpadUp.right", - "type": "boolean" - }, - { - "name": "/actions/global/in/dpadDown.right", - "type": "boolean" - }, - { - "name": "/actions/global/in/dpadRight.right", - "type": "boolean" - }, - { - "name": "/actions/global/in/dpadLeft.right", - "type": "boolean" - }, - { - "name": "/actions/global/in/thumbclick.left", - "type": "boolean" - }, - { - "name": "/actions/global/in/thumbclick.right", - "type": "boolean" - }, - { - "name": "/actions/global/in/thumbstick.left", - "type": "vector2" - }, - { - "name": "/actions/global/in/thumbstick.right", - "type": "vector2" - }, - { - "name": "/actions/global/in/handPose.left", - "type": "pose" - }, - { - "name": "/actions/global/in/handPose.right", - "type": "pose" - }, - { - "name": "/actions/global/in/handTip.left", - "type": "pose" - }, - { - "name": "/actions/global/in/handTip.right", - "type": "pose" - }, - { - "name": "/actions/global/out/hapticVibration.left", - "type": "vibration" - }, - { - "name": "/actions/global/out/hapticVibration.right", - "type": "vibration" - } - ], - "action_sets": [ - { - "name": "/actions/global", - "usage": "leftright" - } - ], - "localization" : [ - { - "language_tag": "en_us" - } - ] -} \ No newline at end of file diff --git a/data/scripts/json.lua b/data/scripts/json.lua deleted file mode 100644 index a9f78820..00000000 --- a/data/scripts/json.lua +++ /dev/null @@ -1,389 +0,0 @@ --- --- json.lua --- --- Copyright (c) 2020 rxi --- --- Permission is hereby granted, free of charge, to any person obtaining a copy of --- this software and associated documentation files (the "Software"), to deal in --- the Software without restriction, including without limitation the rights to --- use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies --- of the Software, and to permit persons to whom the Software is furnished to do --- so, subject to the following conditions: --- --- The above copyright notice and this permission notice shall be included in all --- copies or substantial portions of the Software. --- --- THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR --- IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, --- FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE --- AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER --- LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, --- OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE --- SOFTWARE. --- - -local json = { _version = "0.1.2" } - -------------------------------------------------------------------------------- --- Encode -------------------------------------------------------------------------------- - -local encode - -local escape_char_map = { - [ "\\" ] = "\\", - [ "\"" ] = "\"", - [ "\b" ] = "b", - [ "\f" ] = "f", - [ "\n" ] = "n", - [ "\r" ] = "r", - [ "\t" ] = "t", -} - -local escape_char_map_inv = { [ "/" ] = "/" } -for k, v in pairs(escape_char_map) do - escape_char_map_inv[v] = k -end - - -local function escape_char(c) - return "\\" .. (escape_char_map[c] or string.format("u%04x", c:byte())) -end - - -local function encode_nil(val) - return "null" -end - - -local function encode_table(val, stack) - local res = {} - stack = stack or {} - - -- Circular reference? - if stack[val] then error("circular reference") end - - stack[val] = true - - if rawget(val, 1) ~= nil or next(val) == nil then - -- Treat as array -- check keys are valid and it is not sparse - local n = 0 - for k in pairs(val) do - if type(k) ~= "number" then - error("invalid table: mixed or invalid key types") - end - n = n + 1 - end - if n ~= #val then - error("invalid table: sparse array") - end - -- Encode - for i, v in ipairs(val) do - table.insert(res, encode(v, stack)) - end - stack[val] = nil - return #res == 0 and "{}" or "[" .. table.concat(res, ",") .. "]" --- return "[" .. table.concat(res, ",") .. "]" - - else - -- Treat as an object - for k, v in pairs(val) do - if type(k) ~= "string" then - error("invalid table: mixed or invalid key types") - end - table.insert(res, encode(k, stack) .. ":" .. encode(v, stack)) - end - stack[val] = nil - return "{" .. table.concat(res, ",") .. "}" - end -end - - -local function encode_string(val) - return '"' .. val:gsub('[%z\1-\31\\"]', escape_char) .. '"' -end - - -local function encode_number(val) - -- Check for NaN, -inf and inf - if val ~= val or val <= -math.huge or val >= math.huge then - error("unexpected number value '" .. tostring(val) .. "'") - end - return string.format("%.14g", val) -end - - -local type_func_map = { - [ "nil" ] = encode_nil, - [ "table" ] = encode_table, - [ "string" ] = encode_string, - [ "number" ] = encode_number, - [ "boolean" ] = tostring, -} - - -encode = function(val, stack) - local t = type(val) - local f = type_func_map[t] - if f then - return f(val, stack) - end - error("unexpected type '" .. t .. "'") -end - - -function json.encode(val) - return ( encode(val) ) -end - - -------------------------------------------------------------------------------- --- Decode -------------------------------------------------------------------------------- - -local parse - -local function create_set(...) - local res = {} - for i = 1, select("#", ...) do - res[ select(i, ...) ] = true - end - return res -end - -local space_chars = create_set(" ", "\t", "\r", "\n") -local delim_chars = create_set(" ", "\t", "\r", "\n", "]", "}", ",") -local escape_chars = create_set("\\", "/", '"', "b", "f", "n", "r", "t", "u") -local literals = create_set("true", "false", "null") - -local literal_map = { - [ "true" ] = true, - [ "false" ] = false, - [ "null" ] = nil, -} - - -local function next_char(str, idx, set, negate) - for i = idx, #str do - if set[str:sub(i, i)] ~= negate then - return i - end - end - return #str + 1 -end - - -local function decode_error(str, idx, msg) - local line_count = 1 - local col_count = 1 - for i = 1, idx - 1 do - col_count = col_count + 1 - if str:sub(i, i) == "\n" then - line_count = line_count + 1 - col_count = 1 - end - end - error( string.format("%s at line %d col %d", msg, line_count, col_count) ) -end - - -local function codepoint_to_utf8(n) - -- http://scripts.sil.org/cms/scripts/page.php?site_id=nrsi&id=iws-appendixa - local f = math.floor - if n <= 0x7f then - return string.char(n) - elseif n <= 0x7ff then - return string.char(f(n / 64) + 192, n % 64 + 128) - elseif n <= 0xffff then - return string.char(f(n / 4096) + 224, f(n % 4096 / 64) + 128, n % 64 + 128) - elseif n <= 0x10ffff then - return string.char(f(n / 262144) + 240, f(n % 262144 / 4096) + 128, - f(n % 4096 / 64) + 128, n % 64 + 128) - end - error( string.format("invalid unicode codepoint '%x'", n) ) -end - - -local function parse_unicode_escape(s) - local n1 = tonumber( s:sub(1, 4), 16 ) - local n2 = tonumber( s:sub(7, 10), 16 ) - -- Surrogate pair? - if n2 then - return codepoint_to_utf8((n1 - 0xd800) * 0x400 + (n2 - 0xdc00) + 0x10000) - else - return codepoint_to_utf8(n1) - end -end - - -local function parse_string(str, i) - local res = "" - local j = i + 1 - local k = j - - while j <= #str do - local x = str:byte(j) - - if x < 32 then - decode_error(str, j, "control character in string") - - elseif x == 92 then -- `\`: Escape - res = res .. str:sub(k, j - 1) - j = j + 1 - local c = str:sub(j, j) - if c == "u" then - local hex = str:match("^[dD][89aAbB]%x%x\\u%x%x%x%x", j + 1) - or str:match("^%x%x%x%x", j + 1) - or decode_error(str, j - 1, "invalid unicode escape in string") - res = res .. parse_unicode_escape(hex) - j = j + #hex - else - if not escape_chars[c] then - decode_error(str, j - 1, "invalid escape char '" .. c .. "' in string") - end - res = res .. escape_char_map_inv[c] - end - k = j + 1 - - elseif x == 34 then -- `"`: End of string - res = res .. str:sub(k, j - 1) - return res, j + 1 - end - - j = j + 1 - end - - decode_error(str, i, "expected closing quote for string") -end - - -local function parse_number(str, i) - local x = next_char(str, i, delim_chars) - local s = str:sub(i, x - 1) - local n = tonumber(s) - if not n then - decode_error(str, i, "invalid number '" .. s .. "'") - end - return n, x -end - - -local function parse_literal(str, i) - local x = next_char(str, i, delim_chars) - local word = str:sub(i, x - 1) - if not literals[word] then - decode_error(str, i, "invalid literal '" .. word .. "'") - end - return literal_map[word], x -end - - -local function parse_array(str, i) - local res = {} - local n = 1 - i = i + 1 - while 1 do - local x - i = next_char(str, i, space_chars, true) - -- Empty / end of array? - if str:sub(i, i) == "]" then - i = i + 1 - break - end - -- Read token - x, i = parse(str, i) - res[n] = x - n = n + 1 - -- Next token - i = next_char(str, i, space_chars, true) - local chr = str:sub(i, i) - i = i + 1 - if chr == "]" then break end - if chr ~= "," then decode_error(str, i, "expected ']' or ','") end - end - return res, i -end - - -local function parse_object(str, i) - local res = {} - i = i + 1 - while 1 do - local key, val - i = next_char(str, i, space_chars, true) - -- Empty / end of object? - if str:sub(i, i) == "}" then - i = i + 1 - break - end - -- Read key - if str:sub(i, i) ~= '"' then - decode_error(str, i, "expected string for key") - end - key, i = parse(str, i) - -- Read ':' delimiter - i = next_char(str, i, space_chars, true) - if str:sub(i, i) ~= ":" then - decode_error(str, i, "expected ':' after key") - end - i = next_char(str, i + 1, space_chars, true) - -- Read value - val, i = parse(str, i) - -- Set - res[key] = val - -- Next token - i = next_char(str, i, space_chars, true) - local chr = str:sub(i, i) - i = i + 1 - if chr == "}" then break end - if chr ~= "," then decode_error(str, i, "expected '}' or ','") end - end - return res, i -end - - -local char_func_map = { - [ '"' ] = parse_string, - [ "0" ] = parse_number, - [ "1" ] = parse_number, - [ "2" ] = parse_number, - [ "3" ] = parse_number, - [ "4" ] = parse_number, - [ "5" ] = parse_number, - [ "6" ] = parse_number, - [ "7" ] = parse_number, - [ "8" ] = parse_number, - [ "9" ] = parse_number, - [ "-" ] = parse_number, - [ "t" ] = parse_literal, - [ "f" ] = parse_literal, - [ "n" ] = parse_literal, - [ "[" ] = parse_array, - [ "{" ] = parse_object, -} - - -parse = function(str, idx) - local chr = str:sub(idx, idx) - local f = char_func_map[chr] - if f then - return f(str, idx) - end - decode_error(str, idx, "unexpected character '" .. chr .. "'") -end - - -function json.decode(str) - if type(str) ~= "string" then - error("expected argument of type string, got " .. type(str)) - end - local res, idx = parse(str, next_char(str, 1, space_chars, true)) - idx = next_char(str, idx, space_chars, true) - if idx <= #str then - decode_error(str, idx, "trailing garbage") - end - return res -end - - -return json \ No newline at end of file diff --git a/data/textures/icon.png b/data/textures/icon.png deleted file mode 100644 index cf1a562d..00000000 Binary files a/data/textures/icon.png and /dev/null differ diff --git a/data/textures/skybox/back.png b/data/textures/skybox/back.png deleted file mode 100644 index 319ec74b..00000000 Binary files a/data/textures/skybox/back.png and /dev/null differ diff --git a/data/textures/skybox/down.png b/data/textures/skybox/down.png deleted file mode 100644 index 45378bfd..00000000 Binary files a/data/textures/skybox/down.png and /dev/null differ diff --git a/data/textures/skybox/front.png b/data/textures/skybox/front.png deleted file mode 100644 index 8005011e..00000000 Binary files a/data/textures/skybox/front.png and /dev/null differ diff --git a/data/textures/skybox/left.png b/data/textures/skybox/left.png deleted file mode 100644 index dfcc1329..00000000 Binary files a/data/textures/skybox/left.png and /dev/null differ diff --git a/data/textures/skybox/right.png b/data/textures/skybox/right.png deleted file mode 100644 index 9ab3fe69..00000000 Binary files a/data/textures/skybox/right.png and /dev/null differ diff --git a/data/textures/skybox/up.png b/data/textures/skybox/up.png deleted file mode 100644 index 8a665b3a..00000000 Binary files a/data/textures/skybox/up.png and /dev/null differ diff --git a/debug.sh b/debug.sh new file mode 100644 index 00000000..d74a4108 --- /dev/null +++ b/debug.sh @@ -0,0 +1,8 @@ +#!/bin/bash +cd bin +PREFIX=$(cat ./exe/default.config) +cp ./exe/lib/win64/*.dll . +cp ./exe/lib/win64/$PREFIX/*.dll . +gdb ./exe/program.$PREFIX.exe +rm *.dll + diff --git a/engine/inc/AL/alut.h b/engine/inc/AL/alut.h new file mode 100644 index 00000000..4b05a3cb --- /dev/null +++ b/engine/inc/AL/alut.h @@ -0,0 +1,126 @@ +#if !defined(AL_ALUT_H) +#define AL_ALUT_H + +#if defined(_MSC_VER) +#include +#include +#elif defined(__APPLE__) +#include +#include +#else +#include +#include +#endif + +#if defined(__cplusplus) +extern "C" { +#endif + +#if defined(_WIN32) && !defined(_XBOX) + #if defined (ALUT_BUILD_LIBRARY) + #define ALUT_API __declspec(dllexport) + #else + #define ALUT_API __declspec(dllimport) + #endif +#else + #if defined(ALUT_BUILD_LIBRARY) && defined(HAVE_GCC_VISIBILITY) + #define ALUT_API __attribute__((visibility("default"))) + #else + #define ALUT_API extern + #endif +#endif + +#if defined(_WIN32) + #define ALUT_APIENTRY __cdecl +#else + #define ALUT_APIENTRY +#endif + +#if defined(__MWERKS_) + #pragma export on +#endif + +/* Flag deprecated functions if possible (VisualC++ .NET and GCC >= 3.1.1). */ +#if defined(_MSC_VER) && _MSC_VER >= 1300 && !defined(MIDL_PASS) +#define ALUT_ATTRIBUTE_DEPRECATED __declspec(deprecated) +#elif defined(__GNUC__) && (__GNUC__ > 3 || (__GNUC__ == 3 && (__GNUC_MINOR__ > 1 || (__GNUC_MINOR__ == 1 && __GNUC_PATCHLEVEL__ >= 1)))) +#define ALUT_ATTRIBUTE_DEPRECATED __attribute__((deprecated)) +#else +#define ALUT_ATTRIBUTE_DEPRECATED +#endif + +#define ALUT_API_MAJOR_VERSION 1 +#define ALUT_API_MINOR_VERSION 1 + +#define ALUT_ERROR_NO_ERROR 0 +#define ALUT_ERROR_OUT_OF_MEMORY 0x200 +#define ALUT_ERROR_INVALID_ENUM 0x201 +#define ALUT_ERROR_INVALID_VALUE 0x202 +#define ALUT_ERROR_INVALID_OPERATION 0x203 +#define ALUT_ERROR_NO_CURRENT_CONTEXT 0x204 +#define ALUT_ERROR_AL_ERROR_ON_ENTRY 0x205 +#define ALUT_ERROR_ALC_ERROR_ON_ENTRY 0x206 +#define ALUT_ERROR_OPEN_DEVICE 0x207 +#define ALUT_ERROR_CLOSE_DEVICE 0x208 +#define ALUT_ERROR_CREATE_CONTEXT 0x209 +#define ALUT_ERROR_MAKE_CONTEXT_CURRENT 0x20A +#define ALUT_ERROR_DESTROY_CONTEXT 0x20B +#define ALUT_ERROR_GEN_BUFFERS 0x20C +#define ALUT_ERROR_BUFFER_DATA 0x20D +#define ALUT_ERROR_IO_ERROR 0x20E +#define ALUT_ERROR_UNSUPPORTED_FILE_TYPE 0x20F +#define ALUT_ERROR_UNSUPPORTED_FILE_SUBTYPE 0x210 +#define ALUT_ERROR_CORRUPT_OR_TRUNCATED_DATA 0x211 + +#define ALUT_WAVEFORM_SINE 0x100 +#define ALUT_WAVEFORM_SQUARE 0x101 +#define ALUT_WAVEFORM_SAWTOOTH 0x102 +#define ALUT_WAVEFORM_WHITENOISE 0x103 +#define ALUT_WAVEFORM_IMPULSE 0x104 + +#define ALUT_LOADER_BUFFER 0x300 +#define ALUT_LOADER_MEMORY 0x301 + +ALUT_API ALboolean ALUT_APIENTRY alutInit (int *argcp, char **argv); +ALUT_API ALboolean ALUT_APIENTRY alutInitWithoutContext (int *argcp, char **argv); +ALUT_API ALboolean ALUT_APIENTRY alutExit (void); + +ALUT_API ALenum ALUT_APIENTRY alutGetError (void); +ALUT_API const char *ALUT_APIENTRY alutGetErrorString (ALenum error); + +ALUT_API ALuint ALUT_APIENTRY alutCreateBufferFromFile (const char *fileName); +ALUT_API ALuint ALUT_APIENTRY alutCreateBufferFromFileImage (const ALvoid *data, ALsizei length); +ALUT_API ALuint ALUT_APIENTRY alutCreateBufferHelloWorld (void); +ALUT_API ALuint ALUT_APIENTRY alutCreateBufferWaveform (ALenum waveshape, ALfloat frequency, ALfloat phase, ALfloat duration); + +ALUT_API ALvoid *ALUT_APIENTRY alutLoadMemoryFromFile (const char *fileName, ALenum *format, ALsizei *size, ALfloat *frequency); +ALUT_API ALvoid *ALUT_APIENTRY alutLoadMemoryFromFileImage (const ALvoid *data, ALsizei length, ALenum *format, ALsizei *size, ALfloat *frequency); +ALUT_API ALvoid *ALUT_APIENTRY alutLoadMemoryHelloWorld (ALenum *format, ALsizei *size, ALfloat *frequency); +ALUT_API ALvoid *ALUT_APIENTRY alutLoadMemoryWaveform (ALenum waveshape, ALfloat frequency, ALfloat phase, ALfloat duration, ALenum *format, ALsizei *size, ALfloat *freq); + +ALUT_API const char *ALUT_APIENTRY alutGetMIMETypes (ALenum loader); + +ALUT_API ALint ALUT_APIENTRY alutGetMajorVersion (void); +ALUT_API ALint ALUT_APIENTRY alutGetMinorVersion (void); + +ALUT_API ALboolean ALUT_APIENTRY alutSleep (ALfloat duration); + +/* Nasty Compatibility stuff, WARNING: THESE FUNCTIONS ARE STRONGLY DEPRECATED */ +#if defined(__APPLE__) +ALUT_API ALUT_ATTRIBUTE_DEPRECATED void ALUT_APIENTRY alutLoadWAVFile (ALbyte *fileName, ALenum *format, void **data, ALsizei *size, ALsizei *frequency); +ALUT_API ALUT_ATTRIBUTE_DEPRECATED void ALUT_APIENTRY alutLoadWAVMemory (ALbyte *buffer, ALenum *format, void **data, ALsizei *size, ALsizei *frequency); +#else +ALUT_API ALUT_ATTRIBUTE_DEPRECATED void ALUT_APIENTRY alutLoadWAVFile (ALbyte *fileName, ALenum *format, void **data, ALsizei *size, ALsizei *frequency, ALboolean *loop); +ALUT_API ALUT_ATTRIBUTE_DEPRECATED void ALUT_APIENTRY alutLoadWAVMemory (ALbyte *buffer, ALenum *format, void **data, ALsizei *size, ALsizei *frequency, ALboolean *loop); +#endif +ALUT_API ALUT_ATTRIBUTE_DEPRECATED void ALUT_APIENTRY alutUnloadWAV (ALenum format, ALvoid *data, ALsizei size, ALsizei frequency); + +#if defined(__MWERKS_) + #pragma export off +#endif + +#if defined(__cplusplus) +} +#endif + +#endif diff --git a/engine/inc/ActiveSocket.h b/engine/inc/ActiveSocket.h new file mode 100644 index 00000000..5c2d0df4 --- /dev/null +++ b/engine/inc/ActiveSocket.h @@ -0,0 +1,92 @@ +/*---------------------------------------------------------------------------*/ +/* */ +/* ActiveSocket.h - Active Socket Decleration */ +/* */ +/* Author : Mark Carrier (mark@carrierlabs.com) */ +/* */ +/*---------------------------------------------------------------------------*/ +/* Copyright (c) 2007-2009 CarrierLabs, LLC. All rights reserved. + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions + * are met: + * + * 1. Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * + * 2. Redistributions in binary form must reproduce the above copyright + * notice, this list of conditions and the following disclaimer in + * the documentation and/or other materials provided with the + * distribution. + * + * 3. The name of the author may not be used to endorse or promote products + * derived from this software without specific prior written permission. + * + * 4. The name "CarrierLabs" must not be used to + * endorse or promote products derived from this software without + * prior written permission. For written permission, please contact + * mark@carrierlabs.com. + * + * THIS SOFTWARE IS PROVIDED BY MARK CARRIER ``AS IS'' AND ANY + * EXPRESSED OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE + * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR + * PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL MARK CARRIER OR + * ITS CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, + * SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT + * NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; + * LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) + * HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, + * STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) + * ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED + * OF THE POSSIBILITY OF SUCH DAMAGE. + *----------------------------------------------------------------------------*/ +#ifndef __ACTIVESOCKET_H__ +#define __ACTIVESOCKET_H__ + +#include "SimpleSocket.h" + +class CPassiveSocket; + +/// Provides a platform independent class to create an active socket. +/// An active socket is used to create a socket which connects to a server. +/// This type of object would be used when an application needs to send/receive +/// data from a server. +class CActiveSocket : public CSimpleSocket +{ +public: + friend class CPassiveSocket; + + CActiveSocket(CSocketType type = SocketTypeTcp); + virtual ~CActiveSocket() + { + Close(); + }; + + /// Established a connection to the address specified by pAddr. + /// Connection-based protocol sockets (CSocket::SocketTypeTcp) may + /// successfully call Open() only once, however; connectionless protocol + /// sockets (CSocket::SocketTypeUdp) may use Open() multiple times to + /// change their association. + /// @param pAddr specifies the destination address to connect. + /// @param nPort specifies the destination port. + /// @return true if successful connection made, otherwise false. + virtual bool Open(const char *pAddr, uint16 nPort); + +private: + /// Utility function used to create a TCP connection, called from Open(). + /// @return true if successful connection made, otherwise false. + bool ConnectTCP(const char *pAddr, uint16 nPort); + + /// Utility function used to create a UDP connection, called from Open(). + /// @return true if successful connection made, otherwise false. + bool ConnectUDP(const char *pAddr, uint16 nPort); + + /// Utility function used to create a RAW connection, called from Open(). + /// @return true if successful connection made, otherwise false. + bool ConnectRAW(const char *pAddr, uint16 nPort); + +private: + struct hostent *m_pHE; +}; + +#endif /* __ACTIVESOCKET_H__ */ diff --git a/engine/inc/AppCore/App.h b/engine/inc/AppCore/App.h new file mode 100644 index 00000000..0236c2de --- /dev/null +++ b/engine/inc/AppCore/App.h @@ -0,0 +1,182 @@ +/// +/// @file App.h +/// +/// @brief The header for the App class. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2019 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include "Defines.h" +#include +#include +#include + +namespace ultralight { + +class Monitor; +class Window; + +/// +/// Interface for all App-related events. @see App::set_listener +/// +class AExport AppListener { +public: + virtual ~AppListener() {} + + /// + /// Called whenever the App updates. You should update all app logic here. + /// + /// @note This event is fired right before the run loop calls + /// Renderer::Update and Renderer::Render. + /// + virtual void OnUpdate() {} +}; + +/// +/// App-specific settings. +/// +struct AExport Settings { + /// + /// The name of the developer of this app. + /// + /// This is used to generate a unique path to store local application data + /// on the user's machine. + /// + String developer_name = "MyCompany"; + + /// + /// The name of this app. + /// + /// This is used to generate a unique path to store local application data + /// on the user's machine. + /// + String app_name = "MyApp"; + + /// + /// The root file path for our file system. You should set this to the + /// relative path where all of your app data is. + /// + /// This will be used to resolve all file URLs, eg file:///page.html + /// + /// @note This relative path is resolved using the following logic: + /// - Windows: relative to the executable path + /// - Linux: relative to the executable path + /// - macOS: relative to YourApp.app/Contents/Resources/ + /// + String file_system_path = "./assets/"; + + /// + /// Whether or not we should load and compile shaders from the file system + /// (eg, from the /shaders/ path, relative to file_system_path). + /// + /// If this is false (the default), we will instead load pre-compiled shaders + /// from memory which speeds up application startup time. + /// + bool load_shaders_from_file_system = false; + + /// + /// We try to use the GPU renderer when a compatible GPU is detected. + /// + /// Set this to true to force the engine to always use the CPU renderer. + /// + bool force_cpu_renderer = false; +}; + +/// +/// Main application class. +/// +class AExport App : public RefCounted { +public: + /// + /// Create the App singleton. + /// + /// @param settings Settings to customize App runtime behavior. + /// + /// @param config Config options for the Ultralight renderer. + /// + /// @return Returns a ref-pointer to the created App instance. + /// + /// @note You should only create one of these per application lifetime. + /// + /// @note Certain Config options may be overridden during App creation, + /// most commonly Config::face_winding and Config::device_scale_hint. + /// + static Ref Create(Settings settings = Settings(), Config config = Config()); + + /// + /// Get the App singleton. + /// + static App* instance(); + + /// + /// Get the settings this App was created with. + /// + virtual const Settings& settings() const = 0; + + /// + /// Set the main window. You must set this before calling Run. + /// + /// @param window The window to use for all rendering. + /// + /// @note We currently only support one Window per App, this will change + /// later once we add support for multiple driver instances. + /// + virtual void set_window(Ref window) = 0; + + /// + /// Get the main window. + /// + virtual RefPtr window() = 0; + + /// + /// Set an AppListener to receive callbacks for app-related events. + /// + /// @note Ownership remains with the caller. + /// + virtual void set_listener(AppListener* listener) = 0; + + /// + /// Get the AppListener, if any. + /// + virtual AppListener* listener() = 0; + + /// + /// Whether or not the App is running. + /// + virtual bool is_running() const = 0; + + /// + /// Get the main monitor (this is never NULL). + /// + /// @note We'll add monitor enumeration later. + /// + virtual Monitor* main_monitor() = 0; + + /// + /// Get the underlying Renderer instance. + /// + virtual Ref renderer() = 0; + + /// + /// Run the main loop. + /// + /// @note Make sure to call set_window before calling this. + /// + virtual void Run() = 0; + + /// + /// Quit the application. + /// + virtual void Quit() = 0; + +protected: + virtual ~App(); +}; + +} // namespace ultralight diff --git a/engine/inc/AppCore/AppCore.h b/engine/inc/AppCore/AppCore.h new file mode 100644 index 00000000..00fad093 --- /dev/null +++ b/engine/inc/AppCore/AppCore.h @@ -0,0 +1,6 @@ +#include +#include +#include +#include +#include +#include \ No newline at end of file diff --git a/engine/inc/AppCore/CAPI.h b/engine/inc/AppCore/CAPI.h new file mode 100644 index 00000000..e28a43b3 --- /dev/null +++ b/engine/inc/AppCore/CAPI.h @@ -0,0 +1,448 @@ +/// +/// @file CAPI.h +/// +/// @brief The C-language API for AppCore +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#ifndef APPCORE_CAPI_H +#define APPCORE_CAPI_H + +#include + +#if defined(__WIN32__) || defined(_WIN32) +# if defined(APPCORE_IMPLEMENTATION) +# define ACExport __declspec(dllexport) +# else +# define ACExport __declspec(dllimport) +# endif +#else +# define ACExport __attribute__((visibility("default"))) +#endif + +#ifdef __cplusplus +extern "C" { +#endif + +typedef struct C_Settings* ULSettings; +typedef struct C_App* ULApp; +typedef struct C_Window* ULWindow; +typedef struct C_Monitor* ULMonitor; +typedef struct C_Overlay* ULOverlay; + +/// +/// Window creation flags. @see Window::Create +/// +typedef enum { + kWindowFlags_Borderless = 1 << 0, + kWindowFlags_Titled = 1 << 1, + kWindowFlags_Resizable = 1 << 2, + kWindowFlags_Maximizable = 1 << 3, +} ULWindowFlags; + +/// +/// Create settings with default values (see ). +/// +ACExport ULSettings ulCreateSettings(); + +/// +/// Destroy settings. +/// +ACExport void ulDestroySettings(ULSettings settings); + +/// +/// Set the name of the developer of this app. +/// +/// This is used to generate a unique path to store local application data +/// on the user's machine. +/// +/// Default is "MyCompany" +/// +ACExport void ulSettingsSetDeveloperName(ULSettings settings, ULString name); + +/// +/// Set the name of this app. +/// +/// This is used to generate a unique path to store local application data +/// on the user's machine. +/// +/// Default is "MyApp" +/// +ACExport void ulSettingsSetAppName(ULSettings settings, ULString name); + +/// +/// Set the root file path for our file system, you should set this to the +/// relative path where all of your app data is. +/// +/// This will be used to resolve all file URLs, eg file:///page.html +/// +/// @note The default path is "./assets/" +/// +/// This relative path is resolved using the following logic: +/// - Windows: relative to the executable path +/// - Linux: relative to the executable path +/// - macOS: relative to YourApp.app/Contents/Resources/ +/// +ACExport void ulSettingsSetFileSystemPath(ULSettings settings, ULString path); + +/// +/// Set whether or not we should load and compile shaders from the file system +/// (eg, from the /shaders/ path, relative to file_system_path). +/// +/// If this is false (the default), we will instead load pre-compiled shaders +/// from memory which speeds up application startup time. +/// +ACExport void ulSettingsSetLoadShadersFromFileSystem(ULSettings settings, + bool enabled); + +/// +/// We try to use the GPU renderer when a compatible GPU is detected. +/// +/// Set this to true to force the engine to always use the CPU renderer. +/// +ACExport void ulSettingsSetForceCPURenderer(ULSettings settings, + bool force_cpu); +/// +/// Create the App singleton. +/// +/// @param settings Settings to customize App runtime behavior. You can pass +/// NULL for this parameter to use default settings. +/// +/// @param config Config options for the Ultralight renderer. You can pass +/// NULL for this parameter to use default config. +/// +/// @note You should only create one of these per application lifetime. +/// +/// @note Certain Config options may be overridden during App creation, +/// most commonly Config::face_winding and Config::device_scale_hint. +/// +ACExport ULApp ulCreateApp(ULSettings settings, ULConfig config); + +/// +/// Destroy the App instance. +/// +ACExport void ulDestroyApp(ULApp app); + +/// +/// Set the main window, you must set this before calling ulAppRun. +/// +/// @param window The window to use for all rendering. +/// +/// @note We currently only support one Window per App, this will change +/// later once we add support for multiple driver instances. +/// +ACExport void ulAppSetWindow(ULApp app, ULWindow window); + +/// +/// Get the main window. +/// +ACExport ULWindow ulAppGetWindow(ULApp app); + +typedef void +(*ULUpdateCallback) (void* user_data); + +/// +/// Set a callback for whenever the App updates. You should update all app +/// logic here. +/// +/// @note This event is fired right before the run loop calls +/// Renderer::Update and Renderer::Render. +/// +ACExport void ulAppSetUpdateCallback(ULApp app, ULUpdateCallback callback, + void* user_data); + +/// +/// Whether or not the App is running. +/// +ACExport bool ulAppIsRunning(ULApp app); + +/// +/// Get the main monitor (this is never NULL). +/// +/// @note We'll add monitor enumeration later. +/// +ACExport ULMonitor ulAppGetMainMonitor(ULApp app); + +/// +/// Get the underlying Renderer instance. +/// +ACExport ULRenderer ulAppGetRenderer(ULApp app); + +/// +/// Run the main loop, make sure to call ulAppSetWindow before calling this. +/// +ACExport void ulAppRun(ULApp app); + +/// +/// Quit the application. +/// +ACExport void ulAppQuit(ULApp app); + +/// +/// Get the monitor's DPI scale (1.0 = 100%). +/// +ACExport double ulMonitorGetScale(ULMonitor monitor); + +/// +/// Get the width of the monitor (in pixels). +/// +ACExport unsigned int ulMonitorGetWidth(ULMonitor monitor); + +/// +/// Get the height of the monitor (in pixels). +/// +ACExport unsigned int ulMonitorGetHeight(ULMonitor monitor); + +/// +/// Create a new Window. +/// +/// @param monitor The monitor to create the Window on. +/// +/// @param width The width (in device coordinates). +/// +/// @param height The height (in device coordinates). +/// +/// @param fullscreen Whether or not the window is fullscreen. +/// +/// @param window_flags Various window flags. +/// +ACExport ULWindow ulCreateWindow(ULMonitor monitor, unsigned int width, + unsigned int height, bool fullscreen, + unsigned int window_flags); + +/// +/// Destroy a Window. +/// +ACExport void ulDestroyWindow(ULWindow window); + +typedef void +(*ULCloseCallback) (void* user_data); + +/// +/// Set a callback to be notified when a window closes. +/// +ACExport void ulWindowSetCloseCallback(ULWindow window, + ULCloseCallback callback, + void* user_data); + +typedef void +(*ULResizeCallback) (void* user_data, unsigned int width, unsigned int height); + +/// +/// Set a callback to be notified when a window resizes +/// (parameters are passed back in pixels). +/// +ACExport void ulWindowSetResizeCallback(ULWindow window, + ULResizeCallback callback, + void* user_data); + +/// +/// Get window width (in pixels). +/// +ACExport unsigned int ulWindowGetWidth(ULWindow window); + +/// +/// Get window height (in pixels). +/// +ACExport unsigned int ulWindowGetHeight(ULWindow window); + +/// +/// Get whether or not a window is fullscreen. +/// +ACExport bool ulWindowIsFullscreen(ULWindow window); + +/// +/// Get the DPI scale of a window. +/// +ACExport double ulWindowGetScale(ULWindow window); + +/// +/// Set the window title. +/// +ACExport void ulWindowSetTitle(ULWindow window, const char* title); + +/// +/// Set the cursor for a window. +/// +ACExport void ulWindowSetCursor(ULWindow window, ULCursor cursor); + +/// +/// Close a window. +/// +ACExport void ulWindowClose(ULWindow window); + +/// +/// Convert device coordinates to pixels using the current DPI scale. +/// +ACExport int ulWindowDeviceToPixel(ULWindow window, int val); + +/// +/// Convert pixels to device coordinates using the current DPI scale. +/// +ACExport int ulWindowPixelsToDevice(ULWindow window, int val); + +/// +/// Get the underlying native window handle. +/// +/// @note This is: - HWND on Windows +/// - NSWindow* on macOS +/// - GLFWwindow* on Linux +/// +ACExport void* ulWindowGetNativeHandle(ULWindow window); + +/// +/// Create a new Overlay. +/// +/// @param window The window to create the Overlay in. (we currently only +/// support one window per application) +/// +/// @param width The width in device coordinates. +/// +/// @param height The height in device coordinates. +/// +/// @param x The x-position (offset from the left of the Window), in +/// pixels. +/// +/// @param y The y-position (offset from the top of the Window), in +/// pixels. +/// +/// @note Each Overlay is essentially a View and an on-screen quad. You should +/// create the Overlay then load content into the underlying View. +/// +ACExport ULOverlay ulCreateOverlay(ULWindow window, unsigned int width, + unsigned int height, int x, int y); + +/// +/// Create a new Overlay, wrapping an existing View. +/// +/// @param window The window to create the Overlay in. (we currently only +/// support one window per application) +/// +/// @param view The View to wrap (will use its width and height). +/// +/// @param x The x-position (offset from the left of the Window), in +/// pixels. +/// +/// @param y The y-position (offset from the top of the Window), in +/// pixels. +/// +/// @note Each Overlay is essentially a View and an on-screen quad. You should +/// create the Overlay then load content into the underlying View. +/// +ACExport ULOverlay ulCreateOverlayWithView(ULWindow window, ULView view, + int x, int y); + +/// +/// Destroy an overlay. +/// +ACExport void ulDestroyOverlay(ULOverlay overlay); + +/// +/// Get the underlying View. +/// +ACExport ULView ulOverlayGetView(ULOverlay overlay); + +/// +/// Get the width (in pixels). +/// +ACExport unsigned int ulOverlayGetWidth(ULOverlay overlay); + +/// +/// Get the height (in pixels). +/// +ACExport unsigned int ulOverlayGetHeight(ULOverlay overlay); + +/// +/// Get the x-position (offset from the left of the Window), in pixels. +/// +ACExport int ulOverlayGetX(ULOverlay overlay); + +/// +/// Get the y-position (offset from the top of the Window), in pixels. +/// +ACExport int ulOverlayGetY(ULOverlay overlay); + +/// +/// Move the overlay to a new position (in pixels). +/// +ACExport void ulOverlayMoveTo(ULOverlay overlay, int x, int y); + +/// +/// Resize the overlay (and underlying View), dimensions should be +/// specified in pixels. +/// +ACExport void ulOverlayResize(ULOverlay overlay, unsigned int width, + unsigned int height); + +/// +/// Whether or not the overlay is hidden (not drawn). +/// +ACExport bool ulOverlayIsHidden(ULOverlay overlay); + +/// +/// Hide the overlay (will no longer be drawn). +/// +ACExport void ulOverlayHide(ULOverlay overlay); + +/// +/// Show the overlay. +/// +ACExport void ulOverlayShow(ULOverlay overlay); + +/// +/// Whether or not an overlay has keyboard focus. +/// +ACExport bool ulOverlayHasFocus(ULOverlay overlay); + +/// +/// Grant this overlay exclusive keyboard focus. +/// +ACExport void ulOverlayFocus(ULOverlay overlay); + +/// +/// Remove keyboard focus. +/// +ACExport void ulOverlayUnfocus(ULOverlay overlay); + +/****************************************************************************** + * Platform + *****************************************************************************/ + +/// +/// This is only needed if you are not calling ulCreateApp(). +/// +/// Initializes the platform font loader and sets it as the current FontLoader. +/// +ACExport void ulEnablePlatformFontLoader(); + +/// +/// This is only needed if you are not calling ulCreateApp(). +/// +/// Initializes the platform file system (needed for loading file:/// URLs) and +/// sets it as the current FileSystem. +/// +/// You can specify a base directory path to resolve relative paths against. +/// +ACExport void ulEnablePlatformFileSystem(ULString base_dir); + +/// +/// This is only needed if you are not calling ulCreateApp(). +/// +/// Initializes the default logger (writes the log to a file). +/// +/// You should specify a writable log path to write the log to +/// for example "./ultralight.log". +/// +ACExport void ulEnableDefaultLogger(ULString log_path); + +#ifdef __cplusplus +} +#endif + +#endif // APPCORE_CAPI_H diff --git a/engine/inc/AppCore/Defines.h b/engine/inc/AppCore/Defines.h new file mode 100644 index 00000000..8c2e85eb --- /dev/null +++ b/engine/inc/AppCore/Defines.h @@ -0,0 +1,42 @@ +// Copyright 2018 Ultralight, Inc. All rights reserved. +#pragma once + +// Needed for limit defines, like INTMAX_MAX, which is used by the std C++ library +#ifndef __STDC_LIMIT_MACROS +#define __STDC_LIMIT_MACROS +#endif + +#include +#include +#include + +#ifdef SWIG +#define AExport +#else + +// Require C++11 Support +#if defined(_MSC_VER) +# if _MSC_VER < 1800 +# error This project needs at least Visual Studio 2013 to build +# endif +#elif __cplusplus <= 199711L +# error This project can only be compiled with a compiler that supports C++11 +#endif + + +#if defined(__WIN32__) || defined(_WIN32) +# if defined(APPCORE_IMPLEMENTATION) +# define AExport __declspec(dllexport) +# else +# define AExport __declspec(dllimport) +# endif +#define _thread_local __declspec(thread) +#ifndef _NATIVE_WCHAR_T_DEFINED +#define DISABLE_NATIVE_WCHAR_T +#endif +#else +# define AExport __attribute__((visibility("default"))) +#define _thread_local __thread +#endif + +#endif diff --git a/engine/inc/AppCore/JSHelpers.h b/engine/inc/AppCore/JSHelpers.h new file mode 100644 index 00000000..29493531 --- /dev/null +++ b/engine/inc/AppCore/JSHelpers.h @@ -0,0 +1,554 @@ +#pragma once +#include +#include +#include +#include +#include +#include + +namespace ultralight { + +/// +/// Set the current JSContext. +/// +/// Most JavaScriptCore C API calls require an active JavaScript execution +/// context (JSContextRef). You can get the JSContextRef for a page via +/// `View::LockJSContext()`. This context changes with each page navigation. +/// +/// **Note**: +/// You MUST set a JSContext before using most of the C++ API below. +/// +void AExport SetJSContext(JSContextRef ctx); + +/// +/// Get the current JSContext. +/// +JSContextRef AExport GetJSContext(); + +/// +/// JavaScript String wrapper that automatically manages JSStringRef lifetime +/// and provides helpful conversions. +/// +class AExport JSString { +public: + /// Create empty string + JSString(); + + /// Create from C-string + JSString(const char* str); + + /// Create from Ultralight String + JSString(const String& str); + + /// Take ownership of existing JSStringRef (will not increase ref-count) + JSString(JSStringRef str); + + /// Copy constructor (will increase ref-count) + JSString(const JSString& other); + + /// Destructor + ~JSString(); + + /// Assignment operator (will increase ref-count) + JSString& operator=(const JSString& other); + + /// Cast to String + operator String(); + + /// Cast to underlying JSStringRef + operator JSStringRef() const { return instance_; } + +protected: + JSStringRef instance_; +}; + +class JSArray; +class JSObject; +class JSFunction; + +/// Tag type used with the JSValue constructor to create "Null" types +struct AExport JSValueNullTag {}; + +/// Tag type used with the JSValue constructor to create "Undefined" types +struct AExport JSValueUndefinedTag {}; + +/// +/// JavaScript variant value wrapper that automatically manages JSValueRef +/// lifetime and provides helpful conversions. +/// +class AExport JSValue { +public: + /// Create null (empty) JSValue + JSValue(); + + /// Create null JSValue explicitly + JSValue(JSValueNullTag); + + /// Create undefined JSValue + JSValue(JSValueUndefinedTag); + + /// Create boolean JSValue + JSValue(bool val); + + /// Create unsigned integer JSValue (aka, Number) [will be cast to double] + JSValue(uint32_t val); + + /// Create integer JSValue (aka, Number) [will be cast to double] + JSValue(int32_t val); + + /// Create unsigned integer JSValue (aka, Number) [will be cast to double] + JSValue(uint64_t val); + + /// Create integer JSValue (aka, Number) [will be cast to double] + JSValue(int64_t val); + + /// Create double JSValue (aka, Number) + JSValue(double val); + + /// Create string JSValue + JSValue(const char* val); + + /// Create string JSValue + JSValue(const String& val); + + /// Create string JSValue + JSValue(JSString val); + + /// Create from existing JSValueRef + JSValue(JSValueRef val); + + /// Create object JSValue + JSValue(JSObjectRef obj); + + /// Copy constructor, a shallow copy is made, the constructed JSValue will + /// point to the same JSValueRef. + JSValue(const JSValue& other); + + /// Destructor + virtual ~JSValue(); + + /// A shallow copy is made, this JSValue will point to the same JSValueRef + virtual JSValue& operator=(const JSValue& other); + + /// Whether or not the value is a JavaScript Null type. + bool IsNull() const; + + /// Whether or not the value is a JavaScript Undefined type. + bool IsUndefined() const; + + /// Whether or not the value is a JavaScript Boolean type. + bool IsBoolean() const; + + /// Whether or not the value is a JavaScript Number type. + bool IsNumber() const; + + /// Whether or not the value is a JavaScript String type. + bool IsString() const; + + /// Whether or not the value is a JavaScript Object type. + bool IsObject() const; + + /// Whether or not the value is a JavaScript Array type. + bool IsArray() const; + + /// Whether or not the value is a JavaScript Function type. + bool IsFunction() const; + + /// Get the value as a Boolean + bool ToBoolean() const; + + /// Get the value as a Number (Double) + double ToNumber() const; + + /// Get the value as a Number (Integer) + int64_t ToInteger() const { return static_cast(ToNumber()); } + + /// Get the value as a String + JSString ToString() const; + + /// Get the value as an Object (will debug assert if not an Object) + JSObject ToObject() const; + + /// Get the value as an Array (will debug asset if not an Array) + JSArray ToArray() const; + + /// Get the value as a Function (will debug asset if not a Function) + JSFunction ToFunction() const; + + operator bool() const { return ToBoolean(); } + + operator double() const { return ToNumber(); } + + operator uint32_t() const { return static_cast(ToNumber()); } + + operator int32_t() const { return static_cast(ToNumber()); } + + operator uint64_t() const { return static_cast(ToNumber()); } + + operator int64_t() const { return ToInteger(); } + + operator String() const { return ToString(); } + + operator JSString() const { return ToString(); } + + operator JSObject() const; + + operator JSObjectRef() const; + + operator JSArray() const; + + operator JSFunction() const; + + /// Get the underlying JSValueRef + operator JSValueRef() const { return instance(); } + + /// + /// Get the bound context for this JSValue (it is cached at creation). + /// + JSContextRef context() const { return ctx_; } + + /// + /// Set the JSContext for this JSValue. + /// + /// **Note**: + /// JSValues created from within a JSCallback have a temporary JSContext + /// that is destroyed when the callback returns. You will need to "move" + /// any JSValues created within these callbacks to the View's main context + /// (call set_context() with the main context) before using them outside + /// the callback. + /// + void set_context(JSContextRef context) { ctx_ = context; } + +protected: + JSValue(JSContextRef ctx); + JSValue(JSContextRef ctx, JSValueRef val); + virtual JSValueRef instance() const; + + JSContextRef ctx_; + JSValueRef instance_ = nullptr; + friend class JSFunction; +}; + +/// +/// A vector of JSValues, used for passing around arguments in JSCallback. +/// +class AExport JSArgs { +public: + /// Create an empty list of JavaScript arguments + JSArgs(); + + /// Create a list of JavaScript arguments using a C++ initializer list + JSArgs(const std::initializer_list& values); + + /// Copy-constructor + JSArgs(const JSArgs& other); + + /// Destructor + ~JSArgs(); + + /// Assignment operator + JSArgs& operator=(const JSArgs& other); + + /// + /// Access an element of the argument list by index. + /// + /// **Note**: + /// All JSValues are actually wrappers of JSValueRef instances so even + /// though this function doesn't return a JSValue& you are still operating + /// directly on the underlying JavaScript value instance. + /// + JSValue operator[](size_t pos); + + /// + /// Access an element of the argument list by index. (const overload) + /// + /// **Note**: + /// All JSValues are actually wrappers of JSValueRef instances so even + /// though this function doesn't return a JSValue& you are still operating + /// directly on the underlying JavaScript value instance. + /// + const JSValue operator[](size_t pos) const; + + /// Whether or not the argument list is empty. + bool empty() const; + + /// The number of elements in the argument list. + size_t size() const; + + /// Clear the argument list. + void clear(); + + /// Add a new argument to the end of the list. + void push_back(const JSValue& val); + + /// Remove the last item from the end of the list. + void pop_back(); + + /// Get the argument list as a C-array of JSValues + JSValue* data(); + + /// Get the argument list as a C-array of JSValues (const overload) + const JSValue* data() const; +protected: + void* instance_; +}; + +/// +/// JSCallback typedef used for binding C++ callbacks to JavaScript functions. +/// +/// Takes two arguments (const JSObject& thisObj, const JSArgs& args) and +/// returns nothing (void). +/// +typedef std::function JSCallback; + +/// +/// JSCallbackWithRetval typedef used for binding C++ callbacks to JavaScript +/// functions with an optional return value. +/// +/// Takes two arguments (const JSObject& thisObj, const JSArgs& args) and +/// returns a JSValue back to JavaScript. +/// +typedef std::function JSCallbackWithRetval; + +/// +/// Macro to help bind C++ member functions to a JSCallback +/// +/// Usage: JSCallback callback = BindJSCallback(&MyClass::MyMemberFunction); +/// +/// **Note**: Expected to run from within an instance of 'MyClass', note the +/// 'this' keyword in the macro. +/// +#define BindJSCallback(fn) (JSCallback)std::bind(fn, this, std::placeholders::_1, std::placeholders::_2) + +/// +/// Macro to help bind C++ member functions to a JSCallbackWithRetval +/// +/// Usage: JSCallback callback = BindJSCallback(&MyClass::MyMemberFunction); +/// +/// **Note**: Expected to run from within an instance of 'MyClass', note the +/// 'this' keyword in the macro. +/// +#define BindJSCallbackWithRetval(fn) (JSCallbackWithRetval)std::bind(fn, this, std::placeholders::_1, std::placeholders::_2) + +/// +/// Wrapper for JSObject property value (JSValue subclass). Allows new value assignment +/// to object property, binding C++ callbacks to object properties via function objects, +/// as well as value query via the JSValue interface. +/// +class AExport JSPropertyValue : public JSValue { +public: + virtual ~JSPropertyValue(); + + /// Assign a new value to the property (internally calls JSObjectSetProperty) + virtual JSPropertyValue& operator=(const JSValue& value); + + /// Bind to native C++ callback (creates a Function object that can be called from JS) + JSPropertyValue& operator=(const JSCallback& callback); + + /// Bind to native C++ callback with return value (creates a Function object that can be called from JS) + JSPropertyValue& operator=(const JSCallbackWithRetval& callback); + +protected: + virtual JSValueRef instance() const; + JSPropertyValue(JSContextRef ctx, JSObjectRef proxy_obj, unsigned idx); + JSPropertyValue(JSContextRef ctx, JSObjectRef proxy_obj, JSString idx); + JSPropertyValue(const JSPropertyValue&) = default; + JSPropertyValue& operator=(const JSPropertyValue&) = delete; + + JSObject* proxyObj_; + bool using_numeric_idx_; + unsigned numeric_idx_; + JSString string_idx_; + friend class JSArray; + friend class JSObject; +}; + +/// +/// JSArray wrapper that automatically manages lifetime and provides +/// convenient access to indices and Array functions. +/// +class AExport JSArray { +public: + /// Create empty Array + JSArray(); + + /// Create Array from list of JSValues + JSArray(const std::initializer_list& values); + + /// Create Array from existing JSObjectRef (JavaScriptCore C API) + JSArray(JSObjectRef array_obj); + + /// Copy constructor (shallow copy, will point to same instance) + JSArray(const JSArray& other); + + ~JSArray(); + + /// Assignment (shallow assignment, will point to same instance) + JSArray& operator=(const JSArray& other); + + /// Get number of elements in the Array + unsigned length(); + + /// Push an element to back of Array + void push(const JSValue& val); + + /// Find the index (location) of a certain value, will return -1 if not found + int indexOf(const JSValue& val, int start = 0) const; + + /// Get a property by array index (numbering starts at 0) + JSPropertyValue operator[](unsigned idx) const; + + /// Get the underlying JSObjectRef (JavaScriptCore C API) + operator JSObjectRef() const { return instance_; } + + /// + /// Get the bound context for this JSArray (it is cached at creation). + /// + JSContextRef context() const { return ctx_; } + + /// + /// Set the JSContext for this JSArray. + /// + /// **Note**: + /// JSArrays created from within a JSCallback have a temporary JSContext + /// that is destroyed when the callback returns. You will need to "move" + /// any JSArrays created within these callbacks to the View's main context + /// (call set_context() with the main context) before using them outside + /// the callback. + /// + void set_context(JSContextRef context) { ctx_ = context; } + +protected: + JSArray(JSContextRef ctx, JSValueRef val); + + JSContextRef ctx_; + JSObjectRef instance_; + friend class JSValue; +}; + +/// +/// JSObject wrapper that automatically manages lifetime and provides +/// convenient access to properties. +/// +class AExport JSObject { +public: + /// Create empty Object + JSObject(); + + /// Create from existing JSObjectRef from JavaScriptCore C API + JSObject(JSObjectRef obj); + + /// Copy constructor (shallow copy, will point to same instance) + JSObject(const JSObject& other); + + ~JSObject(); + + /// Assignment (shallow assignment, will point to same instance) + JSObject& operator=(const JSObject& other); + + /// Get a property by name + JSPropertyValue operator[](JSString propertyName) const; + + /// Check if a property exists + bool HasProperty(JSString propertyName) const; + + /// Remove a property + bool DeleteProperty(JSString propertyName); + + /// Get the underlying JSObjectRef (JavaScriptCore C API) + operator JSObjectRef() const { return instance_; } + + /// + /// Get the bound context for this JSObject (it is cached at creation). + /// + JSContextRef context() const { return ctx_; } + + /// + /// Set the JSContext for this JSObject. + /// + /// **Note**: + /// JSObjects created from within a JSCallback have a temporary JSContext + /// that is destroyed when the callback returns. You will need to "move" + /// any JSObjects created within these callbacks to the View's main context + /// (call set_context() with the main context) before using them outside + /// the callback. + /// + void set_context(JSContextRef context) { ctx_ = context; } + +protected: + JSObject(JSContextRef ctx, JSValueRef val); + JSObject(JSContextRef ctx, JSObjectRef obj); + + JSContextRef ctx_; + JSObjectRef instance_; + friend class JSValue; + friend class JSPropertyValue; +}; + +/// +/// JSFunction wrapper that automatically manages lifetime and provides +/// convenient function invocation operators. +/// +class AExport JSFunction { +public: + /// Create an empty Function. + /// NOTE: It is OKAY to create this without calling SetJSContext() first. + JSFunction(); + + /// Copy constructor (shallow copy, will point to same instance) + JSFunction(const JSFunction& other); + + ~JSFunction(); + + /// Assignment (shallow assignment, will point to same instance) + JSFunction& operator=(const JSFunction& other); + + /// Whether or not this is a valid, callable Function object. + bool IsValid() const; + + /// Call function (using Global Object for 'this') and return the result. + JSValue operator()(const JSArgs& args); + + /// Call function (with explicit object for 'this') and return the result + JSValue operator()(const JSObject& thisObject, const JSArgs& args); + + /// Get the underlying JSObjectRef (JavaScriptCore C API) + operator JSObjectRef() const { return instance_; } + + /// + /// Get the bound context for this JSFunction (it is cached at creation). + /// + JSContextRef context() const { return ctx_; } + + /// + /// Set the JSContext for this JSFunction. + /// + /// **Note**: + /// JSFunctions created from within a JSCallback have a temporary JSContext + /// that is destroyed when the callback returns. You will need to "move" + /// any JSFunctions created within these callbacks to the View's main context + /// (call set_context() with the main context) before using them outside + /// the callback. + /// + void set_context(JSContextRef context) { ctx_ = context; } + +protected: + JSFunction(JSContextRef ctx, JSValueRef val); + + JSContextRef ctx_; + JSObjectRef instance_; + friend class JSValue; +}; + +/// +/// Get the Global Object for the current JSContext. +/// In JavaScript, this would be equivalent to the "window" object. +/// +JSObject AExport JSGlobalObject(); + +/// +/// Evaluate a string of JavaScript and return a result. +/// +JSValue AExport JSEval(const JSString& str); + +} // namespace ultralight diff --git a/engine/inc/AppCore/Monitor.h b/engine/inc/AppCore/Monitor.h new file mode 100644 index 00000000..54951175 --- /dev/null +++ b/engine/inc/AppCore/Monitor.h @@ -0,0 +1,41 @@ +/// +/// @file Monitor.h +/// +/// @brief The header for the Monitor class. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2019 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include "Defines.h" + +namespace ultralight { + +/// +/// Monitor class, represents a platform monitor. +/// +class AExport Monitor { +public: + virtual ~Monitor() {} + + /// + /// Get the DPI scale (1.0 = 100%) + /// + virtual double scale() const = 0; + + /// + /// Get the width of the monitor. + /// + virtual uint32_t width() const = 0; + + /// Get the height of the monitor. + /// + virtual uint32_t height() const = 0; +}; + +} // namespace ultralight diff --git a/engine/inc/AppCore/Overlay.h b/engine/inc/AppCore/Overlay.h new file mode 100644 index 00000000..2881dc14 --- /dev/null +++ b/engine/inc/AppCore/Overlay.h @@ -0,0 +1,141 @@ +/// +/// @file Overlay.h +/// +/// @brief The header for the Overlay class. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2019 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include "Window.h" +#include + +namespace ultralight { + +/// +/// Web-content overlay. Displays a web-page within an area of the main window. +/// +/// @note Each Overlay is essentially a View and an on-screen quad. You should +/// create the Overlay then load content into the underlying View. +/// +class AExport Overlay : public RefCounted { +public: + /// + /// Create a new Overlay. + /// + /// @param window The window to create the Overlay in. (we currently only + /// support one window per application) + /// + /// @param width The width in pixels. + /// + /// @param height The height in pixels. + /// + /// @param x The x-position (offset from the left of the Window), in + /// pixels. + /// + /// @param y The y-position (offset from the top of the Window), in + /// pixels. + /// + static Ref Create(Ref window, uint32_t width, + uint32_t height, int x, int y); + + /// + /// Create a new Overlay, wrapping an existing View. + /// + /// @param window The window to create the Overlay in. (we currently only + /// support one window per application) + /// + /// @param view The View to wrap (will use its width and height). + /// + /// @param x The x-position (offset from the left of the Window), in + /// pixels. + /// + /// @param y The y-position (offset from the top of the Window), in + /// pixels. + /// + static Ref Create(Ref window, Ref view, int x, int y); + + /// + /// Get the underlying View. + /// + virtual ultralight::Ref view() = 0; + + /// + /// Get the width (in pixels). + /// + virtual uint32_t width() const = 0; + + /// + /// Get the height (in pixels). + /// + virtual uint32_t height() const = 0; + + /// + /// Get the x-position (offset from the left of the Window), in pixels. + /// + virtual int x() const = 0; + + /// + /// Get the y-position (offset from the top of the Window), in pixels. + /// + virtual int y() const = 0; + + /// + /// Whether or not the overlay is hidden (not drawn). + /// + virtual bool is_hidden() const = 0; + + /// + /// Hide the overlay (will no longer be drawn) + /// + virtual void Hide() = 0; + + /// + /// Show the overlay. + /// + virtual void Show() = 0; + + /// + /// Whether or not this overlay has keyboard focus. + /// + virtual bool has_focus() const = 0; + + /// + /// Grant this overlay exclusive keyboard focus. + /// + virtual void Focus() = 0; + + /// + /// Remove keyboard focus. + /// + virtual void Unfocus() = 0; + + /// + /// Move the overlay to a new position (in pixels). + /// + virtual void MoveTo(int x, int y) = 0; + + /// + /// Resize the overlay (and underlying View), dimensions should be + /// specified in pixels. + /// + virtual void Resize(uint32_t width, uint32_t height) = 0; + + /// + /// Whether or not this Overlay needs repaint (either it has moved, resized, + /// or the internal View needs repaint). + /// + virtual bool NeedsRepaint() = 0; + +protected: + virtual ~Overlay(); + virtual void Draw() = 0; + friend class OverlayManager; +}; + +} // namespace framework diff --git a/engine/inc/AppCore/Platform.h b/engine/inc/AppCore/Platform.h new file mode 100644 index 00000000..653f7186 --- /dev/null +++ b/engine/inc/AppCore/Platform.h @@ -0,0 +1,53 @@ +/// +/// @file Platform.h +/// +/// @brief The header for the Platform helpers. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include "Defines.h" +#include +#include +#include +#include + +namespace ultralight { + +/// +/// Get the native font loader for the current platform. +/// +/// @note This singleton is owned by the library, do not destroy it. +/// +AExport FontLoader* GetPlatformFontLoader(); + +/// +/// Get the native file system for the current platform, creating it if it +/// doesn't exist using the base directory provided. +/// +/// This is used to load data for file:/// URLs. +/// +/// @param baseDir An base file path that will be used to resolve relative +/// file paths. You can optionally specify "@resource_path" +/// on macOS to use the app bundle's resource path. +/// +/// @note This singleton is owned by the library, do not destroy it. +/// +AExport FileSystem* GetPlatformFileSystem(const String& baseDir); + +/// +/// Get the default logger (writes the log to a file on disk). +/// +/// @param logPath A file path to write the log to. +/// +/// @note This singleton is owned by the library, do not destroy it. +/// +AExport Logger* GetDefaultLogger(const String& logPath); + +} // namespace ultralight diff --git a/engine/inc/AppCore/Window.h b/engine/inc/AppCore/Window.h new file mode 100644 index 00000000..13b2a8ae --- /dev/null +++ b/engine/inc/AppCore/Window.h @@ -0,0 +1,157 @@ +/// +/// @file Window.h +/// +/// @brief The header for the Window class. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2019 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include "Defines.h" +#include +#include +#include + +namespace ultralight { + +class Monitor; +class OverlayManager; +class Surface; + +/// +/// Interface for all Window-related events. @see Window::set_listener +/// +class WindowListener { +public: + virtual ~WindowListener() {} + + /// + /// Called when the Window is closed. + /// + virtual void OnClose() = 0; + + /// + /// Called when the Window is resized. + /// + /// @param width The new width (in pixels). + /// + /// @param height The new height (in pixels). + /// + virtual void OnResize(uint32_t width, uint32_t height) = 0; +}; + +/// +/// Window creation flags. @see Window::Create +/// +enum WindowFlags : uint8_t { + kWindowFlags_Borderless = 1 << 0, + kWindowFlags_Titled = 1 << 1, + kWindowFlags_Resizable = 1 << 2, + kWindowFlags_Maximizable = 1 << 3, +}; + +/// +/// Window class, represents a platform window. +/// +class AExport Window : public RefCounted { +public: + /// + /// Create a new Window. + /// + /// @param monitor The monitor to create the Window on. + /// + /// @param width The width (in device coordinates). + /// + /// @param height The height (in device coordinates). + /// + /// @param fullscreen Whether or not the window is fullscreen. + /// + /// @param window_flags Various window flags. + /// + static Ref Create(Monitor* monitor, uint32_t width, uint32_t height, + bool fullscreen, unsigned int window_flags); + + /// + /// Set a WindowListener to receive callbacks for window-related events. + /// + /// @note Ownership remains with the caller. + /// + virtual void set_listener(WindowListener* listener) = 0; + + /// + /// Get the WindowListener, if any. + /// + virtual WindowListener* listener() = 0; + + /// + /// Get the window width (in pixels). + /// + virtual uint32_t width() const = 0; + + /// + /// Get the window height (in pixels). + /// + virtual uint32_t height() const = 0; + + /// + /// Whether or not the window is fullscreen. + /// + virtual bool is_fullscreen() const = 0; + + /// + /// The DPI scale of the window. + /// + virtual double scale() const = 0; + + /// + /// Set the window title. + /// + virtual void SetTitle(const char* title) = 0; + + /// + /// Set the cursor. + /// + virtual void SetCursor(ultralight::Cursor cursor) = 0; + + /// + /// Close the window. + /// + virtual void Close() = 0; + + /// + /// Convert device coordinates to pixels using the current DPI scale. + /// + virtual int DeviceToPixels(int val) const = 0; + + /// + /// Convert pixels to device coordinates using the current DPI scale. + /// + virtual int PixelsToDevice(int val) const = 0; + + /// + /// Draw a surface directly to window, used only by CPU renderer + /// + virtual void DrawSurface(int x, int y, Surface* surface) {} + + /// + /// Get the underlying native window handle. + /// + /// @note This is: - HWND on Windows + /// - NSWindow* on macOS + /// - GLFWwindow* on Linux + /// + virtual void* native_handle() const = 0; + +protected: + virtual ~Window(); + virtual OverlayManager* overlay_manager() const = 0; + + friend class OverlayImpl; +}; + +} // namespace ultralight diff --git a/engine/inc/GL/glext.h b/engine/inc/GL/glext.h new file mode 100644 index 00000000..b5b7678b --- /dev/null +++ b/engine/inc/GL/glext.h @@ -0,0 +1,11028 @@ +#ifndef __glext_h_ +#define __glext_h_ + +#ifdef __cplusplus +extern "C" { +#endif + +/* +** Copyright (c) 2007-2010 The Khronos Group Inc. +** +** Permission is hereby granted, free of charge, to any person obtaining a +** copy of this software and/or associated documentation files (the +** "Materials"), to deal in the Materials without restriction, including +** without limitation the rights to use, copy, modify, merge, publish, +** distribute, sublicense, and/or sell copies of the Materials, and to +** permit persons to whom the Materials are furnished to do so, subject to +** the following conditions: +** +** The above copyright notice and this permission notice shall be included +** in all copies or substantial portions of the Materials. +** +** THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, +** EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF +** MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. +** IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY +** CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, +** TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE +** MATERIALS OR THE USE OR OTHER DEALINGS IN THE MATERIALS. +*/ + +/* Header file version number, required by OpenGL ABI for Linux */ +/* glext.h last updated $Date: 2010-08-03 01:30:25 -0700 (Tue, 03 Aug 2010) $ */ +/* Current version at http://www.opengl.org/registry/ */ +#define GL_GLEXT_VERSION 64 +/* Function declaration macros - to move into glplatform.h */ + +#if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__) && !defined(__SCITECH_SNAP__) +#define WIN32_LEAN_AND_MEAN 1 +#include +#endif + +#ifndef APIENTRY +#define APIENTRY +#endif +#ifndef APIENTRYP +#define APIENTRYP APIENTRY * +#endif +#ifndef GLAPI +#define GLAPI extern +#endif + +/*************************************************************/ + +#ifndef GL_VERSION_1_2 +#define GL_UNSIGNED_BYTE_3_3_2 0x8032 +#define GL_UNSIGNED_SHORT_4_4_4_4 0x8033 +#define GL_UNSIGNED_SHORT_5_5_5_1 0x8034 +#define GL_UNSIGNED_INT_8_8_8_8 0x8035 +#define GL_UNSIGNED_INT_10_10_10_2 0x8036 +#define GL_TEXTURE_BINDING_3D 0x806A +#define GL_PACK_SKIP_IMAGES 0x806B +#define GL_PACK_IMAGE_HEIGHT 0x806C +#define GL_UNPACK_SKIP_IMAGES 0x806D +#define GL_UNPACK_IMAGE_HEIGHT 0x806E +#define GL_TEXTURE_3D 0x806F +#define GL_PROXY_TEXTURE_3D 0x8070 +#define GL_TEXTURE_DEPTH 0x8071 +#define GL_TEXTURE_WRAP_R 0x8072 +#define GL_MAX_3D_TEXTURE_SIZE 0x8073 +#define GL_UNSIGNED_BYTE_2_3_3_REV 0x8362 +#define GL_UNSIGNED_SHORT_5_6_5 0x8363 +#define GL_UNSIGNED_SHORT_5_6_5_REV 0x8364 +#define GL_UNSIGNED_SHORT_4_4_4_4_REV 0x8365 +#define GL_UNSIGNED_SHORT_1_5_5_5_REV 0x8366 +#define GL_UNSIGNED_INT_8_8_8_8_REV 0x8367 +#define GL_UNSIGNED_INT_2_10_10_10_REV 0x8368 +#define GL_BGR 0x80E0 +#define GL_BGRA 0x80E1 +#define GL_MAX_ELEMENTS_VERTICES 0x80E8 +#define GL_MAX_ELEMENTS_INDICES 0x80E9 +#define GL_CLAMP_TO_EDGE 0x812F +#define GL_TEXTURE_MIN_LOD 0x813A +#define GL_TEXTURE_MAX_LOD 0x813B +#define GL_TEXTURE_BASE_LEVEL 0x813C +#define GL_TEXTURE_MAX_LEVEL 0x813D +#define GL_SMOOTH_POINT_SIZE_RANGE 0x0B12 +#define GL_SMOOTH_POINT_SIZE_GRANULARITY 0x0B13 +#define GL_SMOOTH_LINE_WIDTH_RANGE 0x0B22 +#define GL_SMOOTH_LINE_WIDTH_GRANULARITY 0x0B23 +#define GL_ALIASED_LINE_WIDTH_RANGE 0x846E +#endif + +#ifndef GL_VERSION_1_2_DEPRECATED +#define GL_RESCALE_NORMAL 0x803A +#define GL_LIGHT_MODEL_COLOR_CONTROL 0x81F8 +#define GL_SINGLE_COLOR 0x81F9 +#define GL_SEPARATE_SPECULAR_COLOR 0x81FA +#define GL_ALIASED_POINT_SIZE_RANGE 0x846D +#endif + +#ifndef GL_ARB_imaging +#define GL_CONSTANT_COLOR 0x8001 +#define GL_ONE_MINUS_CONSTANT_COLOR 0x8002 +#define GL_CONSTANT_ALPHA 0x8003 +#define GL_ONE_MINUS_CONSTANT_ALPHA 0x8004 +#define GL_BLEND_COLOR 0x8005 +#define GL_FUNC_ADD 0x8006 +#define GL_MIN 0x8007 +#define GL_MAX 0x8008 +#define GL_BLEND_EQUATION 0x8009 +#define GL_FUNC_SUBTRACT 0x800A +#define GL_FUNC_REVERSE_SUBTRACT 0x800B +#endif + +#ifndef GL_ARB_imaging_DEPRECATED +#define GL_CONVOLUTION_1D 0x8010 +#define GL_CONVOLUTION_2D 0x8011 +#define GL_SEPARABLE_2D 0x8012 +#define GL_CONVOLUTION_BORDER_MODE 0x8013 +#define GL_CONVOLUTION_FILTER_SCALE 0x8014 +#define GL_CONVOLUTION_FILTER_BIAS 0x8015 +#define GL_REDUCE 0x8016 +#define GL_CONVOLUTION_FORMAT 0x8017 +#define GL_CONVOLUTION_WIDTH 0x8018 +#define GL_CONVOLUTION_HEIGHT 0x8019 +#define GL_MAX_CONVOLUTION_WIDTH 0x801A +#define GL_MAX_CONVOLUTION_HEIGHT 0x801B +#define GL_POST_CONVOLUTION_RED_SCALE 0x801C +#define GL_POST_CONVOLUTION_GREEN_SCALE 0x801D +#define GL_POST_CONVOLUTION_BLUE_SCALE 0x801E +#define GL_POST_CONVOLUTION_ALPHA_SCALE 0x801F +#define GL_POST_CONVOLUTION_RED_BIAS 0x8020 +#define GL_POST_CONVOLUTION_GREEN_BIAS 0x8021 +#define GL_POST_CONVOLUTION_BLUE_BIAS 0x8022 +#define GL_POST_CONVOLUTION_ALPHA_BIAS 0x8023 +#define GL_HISTOGRAM 0x8024 +#define GL_PROXY_HISTOGRAM 0x8025 +#define GL_HISTOGRAM_WIDTH 0x8026 +#define GL_HISTOGRAM_FORMAT 0x8027 +#define GL_HISTOGRAM_RED_SIZE 0x8028 +#define GL_HISTOGRAM_GREEN_SIZE 0x8029 +#define GL_HISTOGRAM_BLUE_SIZE 0x802A +#define GL_HISTOGRAM_ALPHA_SIZE 0x802B +#define GL_HISTOGRAM_LUMINANCE_SIZE 0x802C +#define GL_HISTOGRAM_SINK 0x802D +#define GL_MINMAX 0x802E +#define GL_MINMAX_FORMAT 0x802F +#define GL_MINMAX_SINK 0x8030 +#define GL_TABLE_TOO_LARGE 0x8031 +#define GL_COLOR_MATRIX 0x80B1 +#define GL_COLOR_MATRIX_STACK_DEPTH 0x80B2 +#define GL_MAX_COLOR_MATRIX_STACK_DEPTH 0x80B3 +#define GL_POST_COLOR_MATRIX_RED_SCALE 0x80B4 +#define GL_POST_COLOR_MATRIX_GREEN_SCALE 0x80B5 +#define GL_POST_COLOR_MATRIX_BLUE_SCALE 0x80B6 +#define GL_POST_COLOR_MATRIX_ALPHA_SCALE 0x80B7 +#define GL_POST_COLOR_MATRIX_RED_BIAS 0x80B8 +#define GL_POST_COLOR_MATRIX_GREEN_BIAS 0x80B9 +#define GL_POST_COLOR_MATRIX_BLUE_BIAS 0x80BA +#define GL_POST_COLOR_MATRIX_ALPHA_BIAS 0x80BB +#define GL_COLOR_TABLE 0x80D0 +#define GL_POST_CONVOLUTION_COLOR_TABLE 0x80D1 +#define GL_POST_COLOR_MATRIX_COLOR_TABLE 0x80D2 +#define GL_PROXY_COLOR_TABLE 0x80D3 +#define GL_PROXY_POST_CONVOLUTION_COLOR_TABLE 0x80D4 +#define GL_PROXY_POST_COLOR_MATRIX_COLOR_TABLE 0x80D5 +#define GL_COLOR_TABLE_SCALE 0x80D6 +#define GL_COLOR_TABLE_BIAS 0x80D7 +#define GL_COLOR_TABLE_FORMAT 0x80D8 +#define GL_COLOR_TABLE_WIDTH 0x80D9 +#define GL_COLOR_TABLE_RED_SIZE 0x80DA +#define GL_COLOR_TABLE_GREEN_SIZE 0x80DB +#define GL_COLOR_TABLE_BLUE_SIZE 0x80DC +#define GL_COLOR_TABLE_ALPHA_SIZE 0x80DD +#define GL_COLOR_TABLE_LUMINANCE_SIZE 0x80DE +#define GL_COLOR_TABLE_INTENSITY_SIZE 0x80DF +#define GL_CONSTANT_BORDER 0x8151 +#define GL_REPLICATE_BORDER 0x8153 +#define GL_CONVOLUTION_BORDER_COLOR 0x8154 +#endif + +#ifndef GL_VERSION_1_3 +#define GL_TEXTURE0 0x84C0 +#define GL_TEXTURE1 0x84C1 +#define GL_TEXTURE2 0x84C2 +#define GL_TEXTURE3 0x84C3 +#define GL_TEXTURE4 0x84C4 +#define GL_TEXTURE5 0x84C5 +#define GL_TEXTURE6 0x84C6 +#define GL_TEXTURE7 0x84C7 +#define GL_TEXTURE8 0x84C8 +#define GL_TEXTURE9 0x84C9 +#define GL_TEXTURE10 0x84CA +#define GL_TEXTURE11 0x84CB +#define GL_TEXTURE12 0x84CC +#define GL_TEXTURE13 0x84CD +#define GL_TEXTURE14 0x84CE +#define GL_TEXTURE15 0x84CF +#define GL_TEXTURE16 0x84D0 +#define GL_TEXTURE17 0x84D1 +#define GL_TEXTURE18 0x84D2 +#define GL_TEXTURE19 0x84D3 +#define GL_TEXTURE20 0x84D4 +#define GL_TEXTURE21 0x84D5 +#define GL_TEXTURE22 0x84D6 +#define GL_TEXTURE23 0x84D7 +#define GL_TEXTURE24 0x84D8 +#define GL_TEXTURE25 0x84D9 +#define GL_TEXTURE26 0x84DA +#define GL_TEXTURE27 0x84DB +#define GL_TEXTURE28 0x84DC +#define GL_TEXTURE29 0x84DD +#define GL_TEXTURE30 0x84DE +#define GL_TEXTURE31 0x84DF +#define GL_ACTIVE_TEXTURE 0x84E0 +#define GL_MULTISAMPLE 0x809D +#define GL_SAMPLE_ALPHA_TO_COVERAGE 0x809E +#define GL_SAMPLE_ALPHA_TO_ONE 0x809F +#define GL_SAMPLE_COVERAGE 0x80A0 +#define GL_SAMPLE_BUFFERS 0x80A8 +#define GL_SAMPLES 0x80A9 +#define GL_SAMPLE_COVERAGE_VALUE 0x80AA +#define GL_SAMPLE_COVERAGE_INVERT 0x80AB +#define GL_TEXTURE_CUBE_MAP 0x8513 +#define GL_TEXTURE_BINDING_CUBE_MAP 0x8514 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_X 0x8515 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X 0x8516 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y 0x8517 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y 0x8518 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z 0x8519 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z 0x851A +#define GL_PROXY_TEXTURE_CUBE_MAP 0x851B +#define GL_MAX_CUBE_MAP_TEXTURE_SIZE 0x851C +#define GL_COMPRESSED_RGB 0x84ED +#define GL_COMPRESSED_RGBA 0x84EE +#define GL_TEXTURE_COMPRESSION_HINT 0x84EF +#define GL_TEXTURE_COMPRESSED_IMAGE_SIZE 0x86A0 +#define GL_TEXTURE_COMPRESSED 0x86A1 +#define GL_NUM_COMPRESSED_TEXTURE_FORMATS 0x86A2 +#define GL_COMPRESSED_TEXTURE_FORMATS 0x86A3 +#define GL_CLAMP_TO_BORDER 0x812D +#endif + +#ifndef GL_VERSION_1_3_DEPRECATED +#define GL_CLIENT_ACTIVE_TEXTURE 0x84E1 +#define GL_MAX_TEXTURE_UNITS 0x84E2 +#define GL_TRANSPOSE_MODELVIEW_MATRIX 0x84E3 +#define GL_TRANSPOSE_PROJECTION_MATRIX 0x84E4 +#define GL_TRANSPOSE_TEXTURE_MATRIX 0x84E5 +#define GL_TRANSPOSE_COLOR_MATRIX 0x84E6 +#define GL_MULTISAMPLE_BIT 0x20000000 +#define GL_NORMAL_MAP 0x8511 +#define GL_REFLECTION_MAP 0x8512 +#define GL_COMPRESSED_ALPHA 0x84E9 +#define GL_COMPRESSED_LUMINANCE 0x84EA +#define GL_COMPRESSED_LUMINANCE_ALPHA 0x84EB +#define GL_COMPRESSED_INTENSITY 0x84EC +#define GL_COMBINE 0x8570 +#define GL_COMBINE_RGB 0x8571 +#define GL_COMBINE_ALPHA 0x8572 +#define GL_SOURCE0_RGB 0x8580 +#define GL_SOURCE1_RGB 0x8581 +#define GL_SOURCE2_RGB 0x8582 +#define GL_SOURCE0_ALPHA 0x8588 +#define GL_SOURCE1_ALPHA 0x8589 +#define GL_SOURCE2_ALPHA 0x858A +#define GL_OPERAND0_RGB 0x8590 +#define GL_OPERAND1_RGB 0x8591 +#define GL_OPERAND2_RGB 0x8592 +#define GL_OPERAND0_ALPHA 0x8598 +#define GL_OPERAND1_ALPHA 0x8599 +#define GL_OPERAND2_ALPHA 0x859A +#define GL_RGB_SCALE 0x8573 +#define GL_ADD_SIGNED 0x8574 +#define GL_INTERPOLATE 0x8575 +#define GL_SUBTRACT 0x84E7 +#define GL_CONSTANT 0x8576 +#define GL_PRIMARY_COLOR 0x8577 +#define GL_PREVIOUS 0x8578 +#define GL_DOT3_RGB 0x86AE +#define GL_DOT3_RGBA 0x86AF +#endif + +#ifndef GL_VERSION_1_4 +#define GL_BLEND_DST_RGB 0x80C8 +#define GL_BLEND_SRC_RGB 0x80C9 +#define GL_BLEND_DST_ALPHA 0x80CA +#define GL_BLEND_SRC_ALPHA 0x80CB +#define GL_POINT_FADE_THRESHOLD_SIZE 0x8128 +#define GL_DEPTH_COMPONENT16 0x81A5 +#define GL_DEPTH_COMPONENT24 0x81A6 +#define GL_DEPTH_COMPONENT32 0x81A7 +#define GL_MIRRORED_REPEAT 0x8370 +#define GL_MAX_TEXTURE_LOD_BIAS 0x84FD +#define GL_TEXTURE_LOD_BIAS 0x8501 +#define GL_INCR_WRAP 0x8507 +#define GL_DECR_WRAP 0x8508 +#define GL_TEXTURE_DEPTH_SIZE 0x884A +#define GL_TEXTURE_COMPARE_MODE 0x884C +#define GL_TEXTURE_COMPARE_FUNC 0x884D +#endif + +#ifndef GL_VERSION_1_4_DEPRECATED +#define GL_POINT_SIZE_MIN 0x8126 +#define GL_POINT_SIZE_MAX 0x8127 +#define GL_POINT_DISTANCE_ATTENUATION 0x8129 +#define GL_GENERATE_MIPMAP 0x8191 +#define GL_GENERATE_MIPMAP_HINT 0x8192 +#define GL_FOG_COORDINATE_SOURCE 0x8450 +#define GL_FOG_COORDINATE 0x8451 +#define GL_FRAGMENT_DEPTH 0x8452 +#define GL_CURRENT_FOG_COORDINATE 0x8453 +#define GL_FOG_COORDINATE_ARRAY_TYPE 0x8454 +#define GL_FOG_COORDINATE_ARRAY_STRIDE 0x8455 +#define GL_FOG_COORDINATE_ARRAY_POINTER 0x8456 +#define GL_FOG_COORDINATE_ARRAY 0x8457 +#define GL_COLOR_SUM 0x8458 +#define GL_CURRENT_SECONDARY_COLOR 0x8459 +#define GL_SECONDARY_COLOR_ARRAY_SIZE 0x845A +#define GL_SECONDARY_COLOR_ARRAY_TYPE 0x845B +#define GL_SECONDARY_COLOR_ARRAY_STRIDE 0x845C +#define GL_SECONDARY_COLOR_ARRAY_POINTER 0x845D +#define GL_SECONDARY_COLOR_ARRAY 0x845E +#define GL_TEXTURE_FILTER_CONTROL 0x8500 +#define GL_DEPTH_TEXTURE_MODE 0x884B +#define GL_COMPARE_R_TO_TEXTURE 0x884E +#endif + +#ifndef GL_VERSION_1_5 +#define GL_BUFFER_SIZE 0x8764 +#define GL_BUFFER_USAGE 0x8765 +#define GL_QUERY_COUNTER_BITS 0x8864 +#define GL_CURRENT_QUERY 0x8865 +#define GL_QUERY_RESULT 0x8866 +#define GL_QUERY_RESULT_AVAILABLE 0x8867 +#define GL_ARRAY_BUFFER 0x8892 +#define GL_ELEMENT_ARRAY_BUFFER 0x8893 +#define GL_ARRAY_BUFFER_BINDING 0x8894 +#define GL_ELEMENT_ARRAY_BUFFER_BINDING 0x8895 +#define GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING 0x889F +#define GL_READ_ONLY 0x88B8 +#define GL_WRITE_ONLY 0x88B9 +#define GL_READ_WRITE 0x88BA +#define GL_BUFFER_ACCESS 0x88BB +#define GL_BUFFER_MAPPED 0x88BC +#define GL_BUFFER_MAP_POINTER 0x88BD +#define GL_STREAM_DRAW 0x88E0 +#define GL_STREAM_READ 0x88E1 +#define GL_STREAM_COPY 0x88E2 +#define GL_STATIC_DRAW 0x88E4 +#define GL_STATIC_READ 0x88E5 +#define GL_STATIC_COPY 0x88E6 +#define GL_DYNAMIC_DRAW 0x88E8 +#define GL_DYNAMIC_READ 0x88E9 +#define GL_DYNAMIC_COPY 0x88EA +#define GL_SAMPLES_PASSED 0x8914 +#endif + +#ifndef GL_VERSION_1_5_DEPRECATED +#define GL_VERTEX_ARRAY_BUFFER_BINDING 0x8896 +#define GL_NORMAL_ARRAY_BUFFER_BINDING 0x8897 +#define GL_COLOR_ARRAY_BUFFER_BINDING 0x8898 +#define GL_INDEX_ARRAY_BUFFER_BINDING 0x8899 +#define GL_TEXTURE_COORD_ARRAY_BUFFER_BINDING 0x889A +#define GL_EDGE_FLAG_ARRAY_BUFFER_BINDING 0x889B +#define GL_SECONDARY_COLOR_ARRAY_BUFFER_BINDING 0x889C +#define GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING 0x889D +#define GL_WEIGHT_ARRAY_BUFFER_BINDING 0x889E +#define GL_FOG_COORD_SRC 0x8450 +#define GL_FOG_COORD 0x8451 +#define GL_CURRENT_FOG_COORD 0x8453 +#define GL_FOG_COORD_ARRAY_TYPE 0x8454 +#define GL_FOG_COORD_ARRAY_STRIDE 0x8455 +#define GL_FOG_COORD_ARRAY_POINTER 0x8456 +#define GL_FOG_COORD_ARRAY 0x8457 +#define GL_FOG_COORD_ARRAY_BUFFER_BINDING 0x889D +#define GL_SRC0_RGB 0x8580 +#define GL_SRC1_RGB 0x8581 +#define GL_SRC2_RGB 0x8582 +#define GL_SRC0_ALPHA 0x8588 +#define GL_SRC1_ALPHA 0x8589 +#define GL_SRC2_ALPHA 0x858A +#endif + +#ifndef GL_VERSION_2_0 +#define GL_BLEND_EQUATION_RGB 0x8009 +#define GL_VERTEX_ATTRIB_ARRAY_ENABLED 0x8622 +#define GL_VERTEX_ATTRIB_ARRAY_SIZE 0x8623 +#define GL_VERTEX_ATTRIB_ARRAY_STRIDE 0x8624 +#define GL_VERTEX_ATTRIB_ARRAY_TYPE 0x8625 +#define GL_CURRENT_VERTEX_ATTRIB 0x8626 +#define GL_VERTEX_PROGRAM_POINT_SIZE 0x8642 +#define GL_VERTEX_ATTRIB_ARRAY_POINTER 0x8645 +#define GL_STENCIL_BACK_FUNC 0x8800 +#define GL_STENCIL_BACK_FAIL 0x8801 +#define GL_STENCIL_BACK_PASS_DEPTH_FAIL 0x8802 +#define GL_STENCIL_BACK_PASS_DEPTH_PASS 0x8803 +#define GL_MAX_DRAW_BUFFERS 0x8824 +#define GL_DRAW_BUFFER0 0x8825 +#define GL_DRAW_BUFFER1 0x8826 +#define GL_DRAW_BUFFER2 0x8827 +#define GL_DRAW_BUFFER3 0x8828 +#define GL_DRAW_BUFFER4 0x8829 +#define GL_DRAW_BUFFER5 0x882A +#define GL_DRAW_BUFFER6 0x882B +#define GL_DRAW_BUFFER7 0x882C +#define GL_DRAW_BUFFER8 0x882D +#define GL_DRAW_BUFFER9 0x882E +#define GL_DRAW_BUFFER10 0x882F +#define GL_DRAW_BUFFER11 0x8830 +#define GL_DRAW_BUFFER12 0x8831 +#define GL_DRAW_BUFFER13 0x8832 +#define GL_DRAW_BUFFER14 0x8833 +#define GL_DRAW_BUFFER15 0x8834 +#define GL_BLEND_EQUATION_ALPHA 0x883D +#define GL_MAX_VERTEX_ATTRIBS 0x8869 +#define GL_VERTEX_ATTRIB_ARRAY_NORMALIZED 0x886A +#define GL_MAX_TEXTURE_IMAGE_UNITS 0x8872 +#define GL_FRAGMENT_SHADER 0x8B30 +#define GL_VERTEX_SHADER 0x8B31 +#define GL_MAX_FRAGMENT_UNIFORM_COMPONENTS 0x8B49 +#define GL_MAX_VERTEX_UNIFORM_COMPONENTS 0x8B4A +#define GL_MAX_VARYING_FLOATS 0x8B4B +#define GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS 0x8B4C +#define GL_MAX_COMBINED_TEXTURE_IMAGE_UNITS 0x8B4D +#define GL_SHADER_TYPE 0x8B4F +#define GL_FLOAT_VEC2 0x8B50 +#define GL_FLOAT_VEC3 0x8B51 +#define GL_FLOAT_VEC4 0x8B52 +#define GL_INT_VEC2 0x8B53 +#define GL_INT_VEC3 0x8B54 +#define GL_INT_VEC4 0x8B55 +#define GL_BOOL 0x8B56 +#define GL_BOOL_VEC2 0x8B57 +#define GL_BOOL_VEC3 0x8B58 +#define GL_BOOL_VEC4 0x8B59 +#define GL_FLOAT_MAT2 0x8B5A +#define GL_FLOAT_MAT3 0x8B5B +#define GL_FLOAT_MAT4 0x8B5C +#define GL_SAMPLER_1D 0x8B5D +#define GL_SAMPLER_2D 0x8B5E +#define GL_SAMPLER_3D 0x8B5F +#define GL_SAMPLER_CUBE 0x8B60 +#define GL_SAMPLER_1D_SHADOW 0x8B61 +#define GL_SAMPLER_2D_SHADOW 0x8B62 +#define GL_DELETE_STATUS 0x8B80 +#define GL_COMPILE_STATUS 0x8B81 +#define GL_LINK_STATUS 0x8B82 +#define GL_VALIDATE_STATUS 0x8B83 +#define GL_INFO_LOG_LENGTH 0x8B84 +#define GL_ATTACHED_SHADERS 0x8B85 +#define GL_ACTIVE_UNIFORMS 0x8B86 +#define GL_ACTIVE_UNIFORM_MAX_LENGTH 0x8B87 +#define GL_SHADER_SOURCE_LENGTH 0x8B88 +#define GL_ACTIVE_ATTRIBUTES 0x8B89 +#define GL_ACTIVE_ATTRIBUTE_MAX_LENGTH 0x8B8A +#define GL_FRAGMENT_SHADER_DERIVATIVE_HINT 0x8B8B +#define GL_SHADING_LANGUAGE_VERSION 0x8B8C +#define GL_CURRENT_PROGRAM 0x8B8D +#define GL_POINT_SPRITE_COORD_ORIGIN 0x8CA0 +#define GL_LOWER_LEFT 0x8CA1 +#define GL_UPPER_LEFT 0x8CA2 +#define GL_STENCIL_BACK_REF 0x8CA3 +#define GL_STENCIL_BACK_VALUE_MASK 0x8CA4 +#define GL_STENCIL_BACK_WRITEMASK 0x8CA5 +#endif + +#ifndef GL_VERSION_2_0_DEPRECATED +#define GL_VERTEX_PROGRAM_TWO_SIDE 0x8643 +#define GL_POINT_SPRITE 0x8861 +#define GL_COORD_REPLACE 0x8862 +#define GL_MAX_TEXTURE_COORDS 0x8871 +#endif + +#ifndef GL_VERSION_2_1 +#define GL_PIXEL_PACK_BUFFER 0x88EB +#define GL_PIXEL_UNPACK_BUFFER 0x88EC +#define GL_PIXEL_PACK_BUFFER_BINDING 0x88ED +#define GL_PIXEL_UNPACK_BUFFER_BINDING 0x88EF +#define GL_FLOAT_MAT2x3 0x8B65 +#define GL_FLOAT_MAT2x4 0x8B66 +#define GL_FLOAT_MAT3x2 0x8B67 +#define GL_FLOAT_MAT3x4 0x8B68 +#define GL_FLOAT_MAT4x2 0x8B69 +#define GL_FLOAT_MAT4x3 0x8B6A +#define GL_SRGB 0x8C40 +#define GL_SRGB8 0x8C41 +#define GL_SRGB_ALPHA 0x8C42 +#define GL_SRGB8_ALPHA8 0x8C43 +#define GL_COMPRESSED_SRGB 0x8C48 +#define GL_COMPRESSED_SRGB_ALPHA 0x8C49 +#endif + +#ifndef GL_VERSION_2_1_DEPRECATED +#define GL_CURRENT_RASTER_SECONDARY_COLOR 0x845F +#define GL_SLUMINANCE_ALPHA 0x8C44 +#define GL_SLUMINANCE8_ALPHA8 0x8C45 +#define GL_SLUMINANCE 0x8C46 +#define GL_SLUMINANCE8 0x8C47 +#define GL_COMPRESSED_SLUMINANCE 0x8C4A +#define GL_COMPRESSED_SLUMINANCE_ALPHA 0x8C4B +#endif + +#ifndef GL_VERSION_3_0 +#define GL_COMPARE_REF_TO_TEXTURE 0x884E +#define GL_CLIP_DISTANCE0 0x3000 +#define GL_CLIP_DISTANCE1 0x3001 +#define GL_CLIP_DISTANCE2 0x3002 +#define GL_CLIP_DISTANCE3 0x3003 +#define GL_CLIP_DISTANCE4 0x3004 +#define GL_CLIP_DISTANCE5 0x3005 +#define GL_CLIP_DISTANCE6 0x3006 +#define GL_CLIP_DISTANCE7 0x3007 +#define GL_MAX_CLIP_DISTANCES 0x0D32 +#define GL_MAJOR_VERSION 0x821B +#define GL_MINOR_VERSION 0x821C +#define GL_NUM_EXTENSIONS 0x821D +#define GL_CONTEXT_FLAGS 0x821E +#define GL_DEPTH_BUFFER 0x8223 +#define GL_STENCIL_BUFFER 0x8224 +#define GL_COMPRESSED_RED 0x8225 +#define GL_COMPRESSED_RG 0x8226 +#define GL_CONTEXT_FLAG_FORWARD_COMPATIBLE_BIT 0x0001 +#define GL_RGBA32F 0x8814 +#define GL_RGB32F 0x8815 +#define GL_RGBA16F 0x881A +#define GL_RGB16F 0x881B +#define GL_VERTEX_ATTRIB_ARRAY_INTEGER 0x88FD +#define GL_MAX_ARRAY_TEXTURE_LAYERS 0x88FF +#define GL_MIN_PROGRAM_TEXEL_OFFSET 0x8904 +#define GL_MAX_PROGRAM_TEXEL_OFFSET 0x8905 +#define GL_CLAMP_READ_COLOR 0x891C +#define GL_FIXED_ONLY 0x891D +#define GL_MAX_VARYING_COMPONENTS 0x8B4B +#define GL_TEXTURE_1D_ARRAY 0x8C18 +#define GL_PROXY_TEXTURE_1D_ARRAY 0x8C19 +#define GL_TEXTURE_2D_ARRAY 0x8C1A +#define GL_PROXY_TEXTURE_2D_ARRAY 0x8C1B +#define GL_TEXTURE_BINDING_1D_ARRAY 0x8C1C +#define GL_TEXTURE_BINDING_2D_ARRAY 0x8C1D +#define GL_R11F_G11F_B10F 0x8C3A +#define GL_UNSIGNED_INT_10F_11F_11F_REV 0x8C3B +#define GL_RGB9_E5 0x8C3D +#define GL_UNSIGNED_INT_5_9_9_9_REV 0x8C3E +#define GL_TEXTURE_SHARED_SIZE 0x8C3F +#define GL_TRANSFORM_FEEDBACK_VARYING_MAX_LENGTH 0x8C76 +#define GL_TRANSFORM_FEEDBACK_BUFFER_MODE 0x8C7F +#define GL_MAX_TRANSFORM_FEEDBACK_SEPARATE_COMPONENTS 0x8C80 +#define GL_TRANSFORM_FEEDBACK_VARYINGS 0x8C83 +#define GL_TRANSFORM_FEEDBACK_BUFFER_START 0x8C84 +#define GL_TRANSFORM_FEEDBACK_BUFFER_SIZE 0x8C85 +#define GL_PRIMITIVES_GENERATED 0x8C87 +#define GL_TRANSFORM_FEEDBACK_PRIMITIVES_WRITTEN 0x8C88 +#define GL_RASTERIZER_DISCARD 0x8C89 +#define GL_MAX_TRANSFORM_FEEDBACK_INTERLEAVED_COMPONENTS 0x8C8A +#define GL_MAX_TRANSFORM_FEEDBACK_SEPARATE_ATTRIBS 0x8C8B +#define GL_INTERLEAVED_ATTRIBS 0x8C8C +#define GL_SEPARATE_ATTRIBS 0x8C8D +#define GL_TRANSFORM_FEEDBACK_BUFFER 0x8C8E +#define GL_TRANSFORM_FEEDBACK_BUFFER_BINDING 0x8C8F +#define GL_RGBA32UI 0x8D70 +#define GL_RGB32UI 0x8D71 +#define GL_RGBA16UI 0x8D76 +#define GL_RGB16UI 0x8D77 +#define GL_RGBA8UI 0x8D7C +#define GL_RGB8UI 0x8D7D +#define GL_RGBA32I 0x8D82 +#define GL_RGB32I 0x8D83 +#define GL_RGBA16I 0x8D88 +#define GL_RGB16I 0x8D89 +#define GL_RGBA8I 0x8D8E +#define GL_RGB8I 0x8D8F +#define GL_RED_INTEGER 0x8D94 +#define GL_GREEN_INTEGER 0x8D95 +#define GL_BLUE_INTEGER 0x8D96 +#define GL_RGB_INTEGER 0x8D98 +#define GL_RGBA_INTEGER 0x8D99 +#define GL_BGR_INTEGER 0x8D9A +#define GL_BGRA_INTEGER 0x8D9B +#define GL_SAMPLER_1D_ARRAY 0x8DC0 +#define GL_SAMPLER_2D_ARRAY 0x8DC1 +#define GL_SAMPLER_1D_ARRAY_SHADOW 0x8DC3 +#define GL_SAMPLER_2D_ARRAY_SHADOW 0x8DC4 +#define GL_SAMPLER_CUBE_SHADOW 0x8DC5 +#define GL_UNSIGNED_INT_VEC2 0x8DC6 +#define GL_UNSIGNED_INT_VEC3 0x8DC7 +#define GL_UNSIGNED_INT_VEC4 0x8DC8 +#define GL_INT_SAMPLER_1D 0x8DC9 +#define GL_INT_SAMPLER_2D 0x8DCA +#define GL_INT_SAMPLER_3D 0x8DCB +#define GL_INT_SAMPLER_CUBE 0x8DCC +#define GL_INT_SAMPLER_1D_ARRAY 0x8DCE +#define GL_INT_SAMPLER_2D_ARRAY 0x8DCF +#define GL_UNSIGNED_INT_SAMPLER_1D 0x8DD1 +#define GL_UNSIGNED_INT_SAMPLER_2D 0x8DD2 +#define GL_UNSIGNED_INT_SAMPLER_3D 0x8DD3 +#define GL_UNSIGNED_INT_SAMPLER_CUBE 0x8DD4 +#define GL_UNSIGNED_INT_SAMPLER_1D_ARRAY 0x8DD6 +#define GL_UNSIGNED_INT_SAMPLER_2D_ARRAY 0x8DD7 +#define GL_QUERY_WAIT 0x8E13 +#define GL_QUERY_NO_WAIT 0x8E14 +#define GL_QUERY_BY_REGION_WAIT 0x8E15 +#define GL_QUERY_BY_REGION_NO_WAIT 0x8E16 +#define GL_BUFFER_ACCESS_FLAGS 0x911F +#define GL_BUFFER_MAP_LENGTH 0x9120 +#define GL_BUFFER_MAP_OFFSET 0x9121 +/* Reuse tokens from ARB_depth_buffer_float */ +/* reuse GL_DEPTH_COMPONENT32F */ +/* reuse GL_DEPTH32F_STENCIL8 */ +/* reuse GL_FLOAT_32_UNSIGNED_INT_24_8_REV */ +/* Reuse tokens from ARB_framebuffer_object */ +/* reuse GL_INVALID_FRAMEBUFFER_OPERATION */ +/* reuse GL_FRAMEBUFFER_ATTACHMENT_COLOR_ENCODING */ +/* reuse GL_FRAMEBUFFER_ATTACHMENT_COMPONENT_TYPE */ +/* reuse GL_FRAMEBUFFER_ATTACHMENT_RED_SIZE */ +/* reuse GL_FRAMEBUFFER_ATTACHMENT_GREEN_SIZE */ +/* reuse GL_FRAMEBUFFER_ATTACHMENT_BLUE_SIZE */ +/* reuse GL_FRAMEBUFFER_ATTACHMENT_ALPHA_SIZE */ +/* reuse GL_FRAMEBUFFER_ATTACHMENT_DEPTH_SIZE */ +/* reuse GL_FRAMEBUFFER_ATTACHMENT_STENCIL_SIZE */ +/* reuse GL_FRAMEBUFFER_DEFAULT */ +/* reuse GL_FRAMEBUFFER_UNDEFINED */ +/* reuse GL_DEPTH_STENCIL_ATTACHMENT */ +/* reuse GL_INDEX */ +/* reuse GL_MAX_RENDERBUFFER_SIZE */ +/* reuse GL_DEPTH_STENCIL */ +/* reuse GL_UNSIGNED_INT_24_8 */ +/* reuse GL_DEPTH24_STENCIL8 */ +/* reuse GL_TEXTURE_STENCIL_SIZE */ +/* reuse GL_TEXTURE_RED_TYPE */ +/* reuse GL_TEXTURE_GREEN_TYPE */ +/* reuse GL_TEXTURE_BLUE_TYPE */ +/* reuse GL_TEXTURE_ALPHA_TYPE */ +/* reuse GL_TEXTURE_DEPTH_TYPE */ +/* reuse GL_UNSIGNED_NORMALIZED */ +/* reuse GL_FRAMEBUFFER_BINDING */ +/* reuse GL_DRAW_FRAMEBUFFER_BINDING */ +/* reuse GL_RENDERBUFFER_BINDING */ +/* reuse GL_READ_FRAMEBUFFER */ +/* reuse GL_DRAW_FRAMEBUFFER */ +/* reuse GL_READ_FRAMEBUFFER_BINDING */ +/* reuse GL_RENDERBUFFER_SAMPLES */ +/* reuse GL_FRAMEBUFFER_ATTACHMENT_OBJECT_TYPE */ +/* reuse GL_FRAMEBUFFER_ATTACHMENT_OBJECT_NAME */ +/* reuse GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LEVEL */ +/* reuse GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_CUBE_MAP_FACE */ +/* reuse GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LAYER */ +/* reuse GL_FRAMEBUFFER_COMPLETE */ +/* reuse GL_FRAMEBUFFER_INCOMPLETE_ATTACHMENT */ +/* reuse GL_FRAMEBUFFER_INCOMPLETE_MISSING_ATTACHMENT */ +/* reuse GL_FRAMEBUFFER_INCOMPLETE_DRAW_BUFFER */ +/* reuse GL_FRAMEBUFFER_INCOMPLETE_READ_BUFFER */ +/* reuse GL_FRAMEBUFFER_UNSUPPORTED */ +/* reuse GL_MAX_COLOR_ATTACHMENTS */ +/* reuse GL_COLOR_ATTACHMENT0 */ +/* reuse GL_COLOR_ATTACHMENT1 */ +/* reuse GL_COLOR_ATTACHMENT2 */ +/* reuse GL_COLOR_ATTACHMENT3 */ +/* reuse GL_COLOR_ATTACHMENT4 */ +/* reuse GL_COLOR_ATTACHMENT5 */ +/* reuse GL_COLOR_ATTACHMENT6 */ +/* reuse GL_COLOR_ATTACHMENT7 */ +/* reuse GL_COLOR_ATTACHMENT8 */ +/* reuse GL_COLOR_ATTACHMENT9 */ +/* reuse GL_COLOR_ATTACHMENT10 */ +/* reuse GL_COLOR_ATTACHMENT11 */ +/* reuse GL_COLOR_ATTACHMENT12 */ +/* reuse GL_COLOR_ATTACHMENT13 */ +/* reuse GL_COLOR_ATTACHMENT14 */ +/* reuse GL_COLOR_ATTACHMENT15 */ +/* reuse GL_DEPTH_ATTACHMENT */ +/* reuse GL_STENCIL_ATTACHMENT */ +/* reuse GL_FRAMEBUFFER */ +/* reuse GL_RENDERBUFFER */ +/* reuse GL_RENDERBUFFER_WIDTH */ +/* reuse GL_RENDERBUFFER_HEIGHT */ +/* reuse GL_RENDERBUFFER_INTERNAL_FORMAT */ +/* reuse GL_STENCIL_INDEX1 */ +/* reuse GL_STENCIL_INDEX4 */ +/* reuse GL_STENCIL_INDEX8 */ +/* reuse GL_STENCIL_INDEX16 */ +/* reuse GL_RENDERBUFFER_RED_SIZE */ +/* reuse GL_RENDERBUFFER_GREEN_SIZE */ +/* reuse GL_RENDERBUFFER_BLUE_SIZE */ +/* reuse GL_RENDERBUFFER_ALPHA_SIZE */ +/* reuse GL_RENDERBUFFER_DEPTH_SIZE */ +/* reuse GL_RENDERBUFFER_STENCIL_SIZE */ +/* reuse GL_FRAMEBUFFER_INCOMPLETE_MULTISAMPLE */ +/* reuse GL_MAX_SAMPLES */ +/* Reuse tokens from ARB_framebuffer_sRGB */ +/* reuse GL_FRAMEBUFFER_SRGB */ +/* Reuse tokens from ARB_half_float_vertex */ +/* reuse GL_HALF_FLOAT */ +/* Reuse tokens from ARB_map_buffer_range */ +/* reuse GL_MAP_READ_BIT */ +/* reuse GL_MAP_WRITE_BIT */ +/* reuse GL_MAP_INVALIDATE_RANGE_BIT */ +/* reuse GL_MAP_INVALIDATE_BUFFER_BIT */ +/* reuse GL_MAP_FLUSH_EXPLICIT_BIT */ +/* reuse GL_MAP_UNSYNCHRONIZED_BIT */ +/* Reuse tokens from ARB_texture_compression_rgtc */ +/* reuse GL_COMPRESSED_RED_RGTC1 */ +/* reuse GL_COMPRESSED_SIGNED_RED_RGTC1 */ +/* reuse GL_COMPRESSED_RG_RGTC2 */ +/* reuse GL_COMPRESSED_SIGNED_RG_RGTC2 */ +/* Reuse tokens from ARB_texture_rg */ +/* reuse GL_RG */ +/* reuse GL_RG_INTEGER */ +/* reuse GL_R8 */ +/* reuse GL_R16 */ +/* reuse GL_RG8 */ +/* reuse GL_RG16 */ +/* reuse GL_R16F */ +/* reuse GL_R32F */ +/* reuse GL_RG16F */ +/* reuse GL_RG32F */ +/* reuse GL_R8I */ +/* reuse GL_R8UI */ +/* reuse GL_R16I */ +/* reuse GL_R16UI */ +/* reuse GL_R32I */ +/* reuse GL_R32UI */ +/* reuse GL_RG8I */ +/* reuse GL_RG8UI */ +/* reuse GL_RG16I */ +/* reuse GL_RG16UI */ +/* reuse GL_RG32I */ +/* reuse GL_RG32UI */ +/* Reuse tokens from ARB_vertex_array_object */ +/* reuse GL_VERTEX_ARRAY_BINDING */ +#endif + +#ifndef GL_VERSION_3_0_DEPRECATED +#define GL_CLAMP_VERTEX_COLOR 0x891A +#define GL_CLAMP_FRAGMENT_COLOR 0x891B +#define GL_ALPHA_INTEGER 0x8D97 +/* Reuse tokens from ARB_framebuffer_object */ +/* reuse GL_TEXTURE_LUMINANCE_TYPE */ +/* reuse GL_TEXTURE_INTENSITY_TYPE */ +#endif + +#ifndef GL_VERSION_3_1 +#define GL_SAMPLER_2D_RECT 0x8B63 +#define GL_SAMPLER_2D_RECT_SHADOW 0x8B64 +#define GL_SAMPLER_BUFFER 0x8DC2 +#define GL_INT_SAMPLER_2D_RECT 0x8DCD +#define GL_INT_SAMPLER_BUFFER 0x8DD0 +#define GL_UNSIGNED_INT_SAMPLER_2D_RECT 0x8DD5 +#define GL_UNSIGNED_INT_SAMPLER_BUFFER 0x8DD8 +#define GL_TEXTURE_BUFFER 0x8C2A +#define GL_MAX_TEXTURE_BUFFER_SIZE 0x8C2B +#define GL_TEXTURE_BINDING_BUFFER 0x8C2C +#define GL_TEXTURE_BUFFER_DATA_STORE_BINDING 0x8C2D +#define GL_TEXTURE_BUFFER_FORMAT 0x8C2E +#define GL_TEXTURE_RECTANGLE 0x84F5 +#define GL_TEXTURE_BINDING_RECTANGLE 0x84F6 +#define GL_PROXY_TEXTURE_RECTANGLE 0x84F7 +#define GL_MAX_RECTANGLE_TEXTURE_SIZE 0x84F8 +#define GL_RED_SNORM 0x8F90 +#define GL_RG_SNORM 0x8F91 +#define GL_RGB_SNORM 0x8F92 +#define GL_RGBA_SNORM 0x8F93 +#define GL_R8_SNORM 0x8F94 +#define GL_RG8_SNORM 0x8F95 +#define GL_RGB8_SNORM 0x8F96 +#define GL_RGBA8_SNORM 0x8F97 +#define GL_R16_SNORM 0x8F98 +#define GL_RG16_SNORM 0x8F99 +#define GL_RGB16_SNORM 0x8F9A +#define GL_RGBA16_SNORM 0x8F9B +#define GL_SIGNED_NORMALIZED 0x8F9C +#define GL_PRIMITIVE_RESTART 0x8F9D +#define GL_PRIMITIVE_RESTART_INDEX 0x8F9E +/* Reuse tokens from ARB_copy_buffer */ +/* reuse GL_COPY_READ_BUFFER */ +/* reuse GL_COPY_WRITE_BUFFER */ +/* Reuse tokens from ARB_draw_instanced (none) */ +/* Reuse tokens from ARB_uniform_buffer_object */ +/* reuse GL_UNIFORM_BUFFER */ +/* reuse GL_UNIFORM_BUFFER_BINDING */ +/* reuse GL_UNIFORM_BUFFER_START */ +/* reuse GL_UNIFORM_BUFFER_SIZE */ +/* reuse GL_MAX_VERTEX_UNIFORM_BLOCKS */ +/* reuse GL_MAX_FRAGMENT_UNIFORM_BLOCKS */ +/* reuse GL_MAX_COMBINED_UNIFORM_BLOCKS */ +/* reuse GL_MAX_UNIFORM_BUFFER_BINDINGS */ +/* reuse GL_MAX_UNIFORM_BLOCK_SIZE */ +/* reuse GL_MAX_COMBINED_VERTEX_UNIFORM_COMPONENTS */ +/* reuse GL_MAX_COMBINED_FRAGMENT_UNIFORM_COMPONENTS */ +/* reuse GL_UNIFORM_BUFFER_OFFSET_ALIGNMENT */ +/* reuse GL_ACTIVE_UNIFORM_BLOCK_MAX_NAME_LENGTH */ +/* reuse GL_ACTIVE_UNIFORM_BLOCKS */ +/* reuse GL_UNIFORM_TYPE */ +/* reuse GL_UNIFORM_SIZE */ +/* reuse GL_UNIFORM_NAME_LENGTH */ +/* reuse GL_UNIFORM_BLOCK_INDEX */ +/* reuse GL_UNIFORM_OFFSET */ +/* reuse GL_UNIFORM_ARRAY_STRIDE */ +/* reuse GL_UNIFORM_MATRIX_STRIDE */ +/* reuse GL_UNIFORM_IS_ROW_MAJOR */ +/* reuse GL_UNIFORM_BLOCK_BINDING */ +/* reuse GL_UNIFORM_BLOCK_DATA_SIZE */ +/* reuse GL_UNIFORM_BLOCK_NAME_LENGTH */ +/* reuse GL_UNIFORM_BLOCK_ACTIVE_UNIFORMS */ +/* reuse GL_UNIFORM_BLOCK_ACTIVE_UNIFORM_INDICES */ +/* reuse GL_UNIFORM_BLOCK_REFERENCED_BY_VERTEX_SHADER */ +/* reuse GL_UNIFORM_BLOCK_REFERENCED_BY_FRAGMENT_SHADER */ +/* reuse GL_INVALID_INDEX */ +#endif + +#ifndef GL_VERSION_3_2 +#define GL_CONTEXT_CORE_PROFILE_BIT 0x00000001 +#define GL_CONTEXT_COMPATIBILITY_PROFILE_BIT 0x00000002 +#define GL_LINES_ADJACENCY 0x000A +#define GL_LINE_STRIP_ADJACENCY 0x000B +#define GL_TRIANGLES_ADJACENCY 0x000C +#define GL_TRIANGLE_STRIP_ADJACENCY 0x000D +#define GL_PROGRAM_POINT_SIZE 0x8642 +#define GL_MAX_GEOMETRY_TEXTURE_IMAGE_UNITS 0x8C29 +#define GL_FRAMEBUFFER_ATTACHMENT_LAYERED 0x8DA7 +#define GL_FRAMEBUFFER_INCOMPLETE_LAYER_TARGETS 0x8DA8 +#define GL_GEOMETRY_SHADER 0x8DD9 +#define GL_GEOMETRY_VERTICES_OUT 0x8916 +#define GL_GEOMETRY_INPUT_TYPE 0x8917 +#define GL_GEOMETRY_OUTPUT_TYPE 0x8918 +#define GL_MAX_GEOMETRY_UNIFORM_COMPONENTS 0x8DDF +#define GL_MAX_GEOMETRY_OUTPUT_VERTICES 0x8DE0 +#define GL_MAX_GEOMETRY_TOTAL_OUTPUT_COMPONENTS 0x8DE1 +#define GL_MAX_VERTEX_OUTPUT_COMPONENTS 0x9122 +#define GL_MAX_GEOMETRY_INPUT_COMPONENTS 0x9123 +#define GL_MAX_GEOMETRY_OUTPUT_COMPONENTS 0x9124 +#define GL_MAX_FRAGMENT_INPUT_COMPONENTS 0x9125 +#define GL_CONTEXT_PROFILE_MASK 0x9126 +/* reuse GL_MAX_VARYING_COMPONENTS */ +/* reuse GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LAYER */ +/* Reuse tokens from ARB_depth_clamp */ +/* reuse GL_DEPTH_CLAMP */ +/* Reuse tokens from ARB_draw_elements_base_vertex (none) */ +/* Reuse tokens from ARB_fragment_coord_conventions (none) */ +/* Reuse tokens from ARB_provoking_vertex */ +/* reuse GL_QUADS_FOLLOW_PROVOKING_VERTEX_CONVENTION */ +/* reuse GL_FIRST_VERTEX_CONVENTION */ +/* reuse GL_LAST_VERTEX_CONVENTION */ +/* reuse GL_PROVOKING_VERTEX */ +/* Reuse tokens from ARB_seamless_cube_map */ +/* reuse GL_TEXTURE_CUBE_MAP_SEAMLESS */ +/* Reuse tokens from ARB_sync */ +/* reuse GL_MAX_SERVER_WAIT_TIMEOUT */ +/* reuse GL_OBJECT_TYPE */ +/* reuse GL_SYNC_CONDITION */ +/* reuse GL_SYNC_STATUS */ +/* reuse GL_SYNC_FLAGS */ +/* reuse GL_SYNC_FENCE */ +/* reuse GL_SYNC_GPU_COMMANDS_COMPLETE */ +/* reuse GL_UNSIGNALED */ +/* reuse GL_SIGNALED */ +/* reuse GL_ALREADY_SIGNALED */ +/* reuse GL_TIMEOUT_EXPIRED */ +/* reuse GL_CONDITION_SATISFIED */ +/* reuse GL_WAIT_FAILED */ +/* reuse GL_TIMEOUT_IGNORED */ +/* reuse GL_SYNC_FLUSH_COMMANDS_BIT */ +/* reuse GL_TIMEOUT_IGNORED */ +/* Reuse tokens from ARB_texture_multisample */ +/* reuse GL_SAMPLE_POSITION */ +/* reuse GL_SAMPLE_MASK */ +/* reuse GL_SAMPLE_MASK_VALUE */ +/* reuse GL_MAX_SAMPLE_MASK_WORDS */ +/* reuse GL_TEXTURE_2D_MULTISAMPLE */ +/* reuse GL_PROXY_TEXTURE_2D_MULTISAMPLE */ +/* reuse GL_TEXTURE_2D_MULTISAMPLE_ARRAY */ +/* reuse GL_PROXY_TEXTURE_2D_MULTISAMPLE_ARRAY */ +/* reuse GL_TEXTURE_BINDING_2D_MULTISAMPLE */ +/* reuse GL_TEXTURE_BINDING_2D_MULTISAMPLE_ARRAY */ +/* reuse GL_TEXTURE_SAMPLES */ +/* reuse GL_TEXTURE_FIXED_SAMPLE_LOCATIONS */ +/* reuse GL_SAMPLER_2D_MULTISAMPLE */ +/* reuse GL_INT_SAMPLER_2D_MULTISAMPLE */ +/* reuse GL_UNSIGNED_INT_SAMPLER_2D_MULTISAMPLE */ +/* reuse GL_SAMPLER_2D_MULTISAMPLE_ARRAY */ +/* reuse GL_INT_SAMPLER_2D_MULTISAMPLE_ARRAY */ +/* reuse GL_UNSIGNED_INT_SAMPLER_2D_MULTISAMPLE_ARRAY */ +/* reuse GL_MAX_COLOR_TEXTURE_SAMPLES */ +/* reuse GL_MAX_DEPTH_TEXTURE_SAMPLES */ +/* reuse GL_MAX_INTEGER_SAMPLES */ +/* Don't need to reuse tokens from ARB_vertex_array_bgra since they're already in 1.2 core */ +#endif + +#ifndef GL_VERSION_3_3 +#define GL_VERTEX_ATTRIB_ARRAY_DIVISOR 0x88FE +/* Reuse tokens from ARB_blend_func_extended */ +/* reuse GL_SRC1_COLOR */ +/* reuse GL_ONE_MINUS_SRC1_COLOR */ +/* reuse GL_ONE_MINUS_SRC1_ALPHA */ +/* reuse GL_MAX_DUAL_SOURCE_DRAW_BUFFERS */ +/* Reuse tokens from ARB_explicit_attrib_location (none) */ +/* Reuse tokens from ARB_occlusion_query2 */ +/* reuse GL_ANY_SAMPLES_PASSED */ +/* Reuse tokens from ARB_sampler_objects */ +/* reuse GL_SAMPLER_BINDING */ +/* Reuse tokens from ARB_shader_bit_encoding (none) */ +/* Reuse tokens from ARB_texture_rgb10_a2ui */ +/* reuse GL_RGB10_A2UI */ +/* Reuse tokens from ARB_texture_swizzle */ +/* reuse GL_TEXTURE_SWIZZLE_R */ +/* reuse GL_TEXTURE_SWIZZLE_G */ +/* reuse GL_TEXTURE_SWIZZLE_B */ +/* reuse GL_TEXTURE_SWIZZLE_A */ +/* reuse GL_TEXTURE_SWIZZLE_RGBA */ +/* Reuse tokens from ARB_timer_query */ +/* reuse GL_TIME_ELAPSED */ +/* reuse GL_TIMESTAMP */ +/* Reuse tokens from ARB_vertex_type_2_10_10_10_rev */ +/* reuse GL_INT_2_10_10_10_REV */ +#endif + +#ifndef GL_VERSION_4_0 +#define GL_SAMPLE_SHADING 0x8C36 +#define GL_MIN_SAMPLE_SHADING_VALUE 0x8C37 +#define GL_MIN_PROGRAM_TEXTURE_GATHER_OFFSET 0x8E5E +#define GL_MAX_PROGRAM_TEXTURE_GATHER_OFFSET 0x8E5F +#define GL_TEXTURE_CUBE_MAP_ARRAY 0x9009 +#define GL_TEXTURE_BINDING_CUBE_MAP_ARRAY 0x900A +#define GL_PROXY_TEXTURE_CUBE_MAP_ARRAY 0x900B +#define GL_SAMPLER_CUBE_MAP_ARRAY 0x900C +#define GL_SAMPLER_CUBE_MAP_ARRAY_SHADOW 0x900D +#define GL_INT_SAMPLER_CUBE_MAP_ARRAY 0x900E +#define GL_UNSIGNED_INT_SAMPLER_CUBE_MAP_ARRAY 0x900F +/* Reuse tokens from ARB_texture_query_lod (none) */ +/* Reuse tokens from ARB_draw_buffers_blend (none) */ +/* Reuse tokens from ARB_draw_indirect */ +/* reuse GL_DRAW_INDIRECT_BUFFER */ +/* reuse GL_DRAW_INDIRECT_BUFFER_BINDING */ +/* Reuse tokens from ARB_gpu_shader5 */ +/* reuse GL_GEOMETRY_SHADER_INVOCATIONS */ +/* reuse GL_MAX_GEOMETRY_SHADER_INVOCATIONS */ +/* reuse GL_MIN_FRAGMENT_INTERPOLATION_OFFSET */ +/* reuse GL_MAX_FRAGMENT_INTERPOLATION_OFFSET */ +/* reuse GL_FRAGMENT_INTERPOLATION_OFFSET_BITS */ +/* reuse GL_MAX_VERTEX_STREAMS */ +/* Reuse tokens from ARB_gpu_shader_fp64 */ +/* reuse GL_DOUBLE_VEC2 */ +/* reuse GL_DOUBLE_VEC3 */ +/* reuse GL_DOUBLE_VEC4 */ +/* reuse GL_DOUBLE_MAT2 */ +/* reuse GL_DOUBLE_MAT3 */ +/* reuse GL_DOUBLE_MAT4 */ +/* reuse GL_DOUBLE_MAT2x3 */ +/* reuse GL_DOUBLE_MAT2x4 */ +/* reuse GL_DOUBLE_MAT3x2 */ +/* reuse GL_DOUBLE_MAT3x4 */ +/* reuse GL_DOUBLE_MAT4x2 */ +/* reuse GL_DOUBLE_MAT4x3 */ +/* Reuse tokens from ARB_shader_subroutine */ +/* reuse GL_ACTIVE_SUBROUTINES */ +/* reuse GL_ACTIVE_SUBROUTINE_UNIFORMS */ +/* reuse GL_ACTIVE_SUBROUTINE_UNIFORM_LOCATIONS */ +/* reuse GL_ACTIVE_SUBROUTINE_MAX_LENGTH */ +/* reuse GL_ACTIVE_SUBROUTINE_UNIFORM_MAX_LENGTH */ +/* reuse GL_MAX_SUBROUTINES */ +/* reuse GL_MAX_SUBROUTINE_UNIFORM_LOCATIONS */ +/* reuse GL_NUM_COMPATIBLE_SUBROUTINES */ +/* reuse GL_COMPATIBLE_SUBROUTINES */ +/* Reuse tokens from ARB_tessellation_shader */ +/* reuse GL_PATCHES */ +/* reuse GL_PATCH_VERTICES */ +/* reuse GL_PATCH_DEFAULT_INNER_LEVEL */ +/* reuse GL_PATCH_DEFAULT_OUTER_LEVEL */ +/* reuse GL_TESS_CONTROL_OUTPUT_VERTICES */ +/* reuse GL_TESS_GEN_MODE */ +/* reuse GL_TESS_GEN_SPACING */ +/* reuse GL_TESS_GEN_VERTEX_ORDER */ +/* reuse GL_TESS_GEN_POINT_MODE */ +/* reuse GL_ISOLINES */ +/* reuse GL_FRACTIONAL_ODD */ +/* reuse GL_FRACTIONAL_EVEN */ +/* reuse GL_MAX_PATCH_VERTICES */ +/* reuse GL_MAX_TESS_GEN_LEVEL */ +/* reuse GL_MAX_TESS_CONTROL_UNIFORM_COMPONENTS */ +/* reuse GL_MAX_TESS_EVALUATION_UNIFORM_COMPONENTS */ +/* reuse GL_MAX_TESS_CONTROL_TEXTURE_IMAGE_UNITS */ +/* reuse GL_MAX_TESS_EVALUATION_TEXTURE_IMAGE_UNITS */ +/* reuse GL_MAX_TESS_CONTROL_OUTPUT_COMPONENTS */ +/* reuse GL_MAX_TESS_PATCH_COMPONENTS */ +/* reuse GL_MAX_TESS_CONTROL_TOTAL_OUTPUT_COMPONENTS */ +/* reuse GL_MAX_TESS_EVALUATION_OUTPUT_COMPONENTS */ +/* reuse GL_MAX_TESS_CONTROL_UNIFORM_BLOCKS */ +/* reuse GL_MAX_TESS_EVALUATION_UNIFORM_BLOCKS */ +/* reuse GL_MAX_TESS_CONTROL_INPUT_COMPONENTS */ +/* reuse GL_MAX_TESS_EVALUATION_INPUT_COMPONENTS */ +/* reuse GL_MAX_COMBINED_TESS_CONTROL_UNIFORM_COMPONENTS */ +/* reuse GL_MAX_COMBINED_TESS_EVALUATION_UNIFORM_COMPONENTS */ +/* reuse GL_UNIFORM_BLOCK_REFERENCED_BY_TESS_CONTROL_SHADER */ +/* reuse GL_UNIFORM_BLOCK_REFERENCED_BY_TESS_EVALUATION_SHADER */ +/* reuse GL_TESS_EVALUATION_SHADER */ +/* reuse GL_TESS_CONTROL_SHADER */ +/* Reuse tokens from ARB_texture_buffer_object_rgb32 (none) */ +/* Reuse tokens from ARB_transform_feedback2 */ +/* reuse GL_TRANSFORM_FEEDBACK */ +/* reuse GL_TRANSFORM_FEEDBACK_BUFFER_PAUSED */ +/* reuse GL_TRANSFORM_FEEDBACK_BUFFER_ACTIVE */ +/* reuse GL_TRANSFORM_FEEDBACK_BINDING */ +/* Reuse tokens from ARB_transform_feedback3 */ +/* reuse GL_MAX_TRANSFORM_FEEDBACK_BUFFERS */ +/* reuse GL_MAX_VERTEX_STREAMS */ +#endif + +#ifndef GL_VERSION_4_1 +/* Reuse tokens from ARB_ES2_compatibility */ +/* reuse GL_FIXED */ +/* reuse GL_IMPLEMENTATION_COLOR_READ_TYPE */ +/* reuse GL_IMPLEMENTATION_COLOR_READ_FORMAT */ +/* reuse GL_LOW_FLOAT */ +/* reuse GL_MEDIUM_FLOAT */ +/* reuse GL_HIGH_FLOAT */ +/* reuse GL_LOW_INT */ +/* reuse GL_MEDIUM_INT */ +/* reuse GL_HIGH_INT */ +/* reuse GL_SHADER_COMPILER */ +/* reuse GL_NUM_SHADER_BINARY_FORMATS */ +/* reuse GL_MAX_VERTEX_UNIFORM_VECTORS */ +/* reuse GL_MAX_VARYING_VECTORS */ +/* reuse GL_MAX_FRAGMENT_UNIFORM_VECTORS */ +/* Reuse tokens from ARB_get_program_binary */ +/* reuse GL_PROGRAM_BINARY_RETRIEVABLE_HINT */ +/* reuse GL_PROGRAM_BINARY_LENGTH */ +/* reuse GL_NUM_PROGRAM_BINARY_FORMATS */ +/* reuse GL_PROGRAM_BINARY_FORMATS */ +/* Reuse tokens from ARB_separate_shader_objects */ +/* reuse GL_VERTEX_SHADER_BIT */ +/* reuse GL_FRAGMENT_SHADER_BIT */ +/* reuse GL_GEOMETRY_SHADER_BIT */ +/* reuse GL_TESS_CONTROL_SHADER_BIT */ +/* reuse GL_TESS_EVALUATION_SHADER_BIT */ +/* reuse GL_ALL_SHADER_BITS */ +/* reuse GL_PROGRAM_SEPARABLE */ +/* reuse GL_ACTIVE_PROGRAM */ +/* reuse GL_PROGRAM_PIPELINE_BINDING */ +/* Reuse tokens from ARB_shader_precision (none) */ +/* Reuse tokens from ARB_vertex_attrib_64bit - all are in GL 3.0 and 4.0 already */ +/* Reuse tokens from ARB_viewport_array - some are in GL 1.1 and ARB_provoking_vertex already */ +/* reuse GL_MAX_VIEWPORTS */ +/* reuse GL_VIEWPORT_SUBPIXEL_BITS */ +/* reuse GL_VIEWPORT_BOUNDS_RANGE */ +/* reuse GL_LAYER_PROVOKING_VERTEX */ +/* reuse GL_VIEWPORT_INDEX_PROVOKING_VERTEX */ +/* reuse GL_UNDEFINED_VERTEX */ +#endif + +#ifndef GL_ARB_multitexture +#define GL_TEXTURE0_ARB 0x84C0 +#define GL_TEXTURE1_ARB 0x84C1 +#define GL_TEXTURE2_ARB 0x84C2 +#define GL_TEXTURE3_ARB 0x84C3 +#define GL_TEXTURE4_ARB 0x84C4 +#define GL_TEXTURE5_ARB 0x84C5 +#define GL_TEXTURE6_ARB 0x84C6 +#define GL_TEXTURE7_ARB 0x84C7 +#define GL_TEXTURE8_ARB 0x84C8 +#define GL_TEXTURE9_ARB 0x84C9 +#define GL_TEXTURE10_ARB 0x84CA +#define GL_TEXTURE11_ARB 0x84CB +#define GL_TEXTURE12_ARB 0x84CC +#define GL_TEXTURE13_ARB 0x84CD +#define GL_TEXTURE14_ARB 0x84CE +#define GL_TEXTURE15_ARB 0x84CF +#define GL_TEXTURE16_ARB 0x84D0 +#define GL_TEXTURE17_ARB 0x84D1 +#define GL_TEXTURE18_ARB 0x84D2 +#define GL_TEXTURE19_ARB 0x84D3 +#define GL_TEXTURE20_ARB 0x84D4 +#define GL_TEXTURE21_ARB 0x84D5 +#define GL_TEXTURE22_ARB 0x84D6 +#define GL_TEXTURE23_ARB 0x84D7 +#define GL_TEXTURE24_ARB 0x84D8 +#define GL_TEXTURE25_ARB 0x84D9 +#define GL_TEXTURE26_ARB 0x84DA +#define GL_TEXTURE27_ARB 0x84DB +#define GL_TEXTURE28_ARB 0x84DC +#define GL_TEXTURE29_ARB 0x84DD +#define GL_TEXTURE30_ARB 0x84DE +#define GL_TEXTURE31_ARB 0x84DF +#define GL_ACTIVE_TEXTURE_ARB 0x84E0 +#define GL_CLIENT_ACTIVE_TEXTURE_ARB 0x84E1 +#define GL_MAX_TEXTURE_UNITS_ARB 0x84E2 +#endif + +#ifndef GL_ARB_transpose_matrix +#define GL_TRANSPOSE_MODELVIEW_MATRIX_ARB 0x84E3 +#define GL_TRANSPOSE_PROJECTION_MATRIX_ARB 0x84E4 +#define GL_TRANSPOSE_TEXTURE_MATRIX_ARB 0x84E5 +#define GL_TRANSPOSE_COLOR_MATRIX_ARB 0x84E6 +#endif + +#ifndef GL_ARB_multisample +#define GL_MULTISAMPLE_ARB 0x809D +#define GL_SAMPLE_ALPHA_TO_COVERAGE_ARB 0x809E +#define GL_SAMPLE_ALPHA_TO_ONE_ARB 0x809F +#define GL_SAMPLE_COVERAGE_ARB 0x80A0 +#define GL_SAMPLE_BUFFERS_ARB 0x80A8 +#define GL_SAMPLES_ARB 0x80A9 +#define GL_SAMPLE_COVERAGE_VALUE_ARB 0x80AA +#define GL_SAMPLE_COVERAGE_INVERT_ARB 0x80AB +#define GL_MULTISAMPLE_BIT_ARB 0x20000000 +#endif + +#ifndef GL_ARB_texture_env_add +#endif + +#ifndef GL_ARB_texture_cube_map +#define GL_NORMAL_MAP_ARB 0x8511 +#define GL_REFLECTION_MAP_ARB 0x8512 +#define GL_TEXTURE_CUBE_MAP_ARB 0x8513 +#define GL_TEXTURE_BINDING_CUBE_MAP_ARB 0x8514 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_X_ARB 0x8515 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X_ARB 0x8516 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y_ARB 0x8517 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y_ARB 0x8518 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z_ARB 0x8519 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z_ARB 0x851A +#define GL_PROXY_TEXTURE_CUBE_MAP_ARB 0x851B +#define GL_MAX_CUBE_MAP_TEXTURE_SIZE_ARB 0x851C +#endif + +#ifndef GL_ARB_texture_compression +#define GL_COMPRESSED_ALPHA_ARB 0x84E9 +#define GL_COMPRESSED_LUMINANCE_ARB 0x84EA +#define GL_COMPRESSED_LUMINANCE_ALPHA_ARB 0x84EB +#define GL_COMPRESSED_INTENSITY_ARB 0x84EC +#define GL_COMPRESSED_RGB_ARB 0x84ED +#define GL_COMPRESSED_RGBA_ARB 0x84EE +#define GL_TEXTURE_COMPRESSION_HINT_ARB 0x84EF +#define GL_TEXTURE_COMPRESSED_IMAGE_SIZE_ARB 0x86A0 +#define GL_TEXTURE_COMPRESSED_ARB 0x86A1 +#define GL_NUM_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A2 +#define GL_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A3 +#endif + +#ifndef GL_ARB_texture_border_clamp +#define GL_CLAMP_TO_BORDER_ARB 0x812D +#endif + +#ifndef GL_ARB_point_parameters +#define GL_POINT_SIZE_MIN_ARB 0x8126 +#define GL_POINT_SIZE_MAX_ARB 0x8127 +#define GL_POINT_FADE_THRESHOLD_SIZE_ARB 0x8128 +#define GL_POINT_DISTANCE_ATTENUATION_ARB 0x8129 +#endif + +#ifndef GL_ARB_vertex_blend +#define GL_MAX_VERTEX_UNITS_ARB 0x86A4 +#define GL_ACTIVE_VERTEX_UNITS_ARB 0x86A5 +#define GL_WEIGHT_SUM_UNITY_ARB 0x86A6 +#define GL_VERTEX_BLEND_ARB 0x86A7 +#define GL_CURRENT_WEIGHT_ARB 0x86A8 +#define GL_WEIGHT_ARRAY_TYPE_ARB 0x86A9 +#define GL_WEIGHT_ARRAY_STRIDE_ARB 0x86AA +#define GL_WEIGHT_ARRAY_SIZE_ARB 0x86AB +#define GL_WEIGHT_ARRAY_POINTER_ARB 0x86AC +#define GL_WEIGHT_ARRAY_ARB 0x86AD +#define GL_MODELVIEW0_ARB 0x1700 +#define GL_MODELVIEW1_ARB 0x850A +#define GL_MODELVIEW2_ARB 0x8722 +#define GL_MODELVIEW3_ARB 0x8723 +#define GL_MODELVIEW4_ARB 0x8724 +#define GL_MODELVIEW5_ARB 0x8725 +#define GL_MODELVIEW6_ARB 0x8726 +#define GL_MODELVIEW7_ARB 0x8727 +#define GL_MODELVIEW8_ARB 0x8728 +#define GL_MODELVIEW9_ARB 0x8729 +#define GL_MODELVIEW10_ARB 0x872A +#define GL_MODELVIEW11_ARB 0x872B +#define GL_MODELVIEW12_ARB 0x872C +#define GL_MODELVIEW13_ARB 0x872D +#define GL_MODELVIEW14_ARB 0x872E +#define GL_MODELVIEW15_ARB 0x872F +#define GL_MODELVIEW16_ARB 0x8730 +#define GL_MODELVIEW17_ARB 0x8731 +#define GL_MODELVIEW18_ARB 0x8732 +#define GL_MODELVIEW19_ARB 0x8733 +#define GL_MODELVIEW20_ARB 0x8734 +#define GL_MODELVIEW21_ARB 0x8735 +#define GL_MODELVIEW22_ARB 0x8736 +#define GL_MODELVIEW23_ARB 0x8737 +#define GL_MODELVIEW24_ARB 0x8738 +#define GL_MODELVIEW25_ARB 0x8739 +#define GL_MODELVIEW26_ARB 0x873A +#define GL_MODELVIEW27_ARB 0x873B +#define GL_MODELVIEW28_ARB 0x873C +#define GL_MODELVIEW29_ARB 0x873D +#define GL_MODELVIEW30_ARB 0x873E +#define GL_MODELVIEW31_ARB 0x873F +#endif + +#ifndef GL_ARB_matrix_palette +#define GL_MATRIX_PALETTE_ARB 0x8840 +#define GL_MAX_MATRIX_PALETTE_STACK_DEPTH_ARB 0x8841 +#define GL_MAX_PALETTE_MATRICES_ARB 0x8842 +#define GL_CURRENT_PALETTE_MATRIX_ARB 0x8843 +#define GL_MATRIX_INDEX_ARRAY_ARB 0x8844 +#define GL_CURRENT_MATRIX_INDEX_ARB 0x8845 +#define GL_MATRIX_INDEX_ARRAY_SIZE_ARB 0x8846 +#define GL_MATRIX_INDEX_ARRAY_TYPE_ARB 0x8847 +#define GL_MATRIX_INDEX_ARRAY_STRIDE_ARB 0x8848 +#define GL_MATRIX_INDEX_ARRAY_POINTER_ARB 0x8849 +#endif + +#ifndef GL_ARB_texture_env_combine +#define GL_COMBINE_ARB 0x8570 +#define GL_COMBINE_RGB_ARB 0x8571 +#define GL_COMBINE_ALPHA_ARB 0x8572 +#define GL_SOURCE0_RGB_ARB 0x8580 +#define GL_SOURCE1_RGB_ARB 0x8581 +#define GL_SOURCE2_RGB_ARB 0x8582 +#define GL_SOURCE0_ALPHA_ARB 0x8588 +#define GL_SOURCE1_ALPHA_ARB 0x8589 +#define GL_SOURCE2_ALPHA_ARB 0x858A +#define GL_OPERAND0_RGB_ARB 0x8590 +#define GL_OPERAND1_RGB_ARB 0x8591 +#define GL_OPERAND2_RGB_ARB 0x8592 +#define GL_OPERAND0_ALPHA_ARB 0x8598 +#define GL_OPERAND1_ALPHA_ARB 0x8599 +#define GL_OPERAND2_ALPHA_ARB 0x859A +#define GL_RGB_SCALE_ARB 0x8573 +#define GL_ADD_SIGNED_ARB 0x8574 +#define GL_INTERPOLATE_ARB 0x8575 +#define GL_SUBTRACT_ARB 0x84E7 +#define GL_CONSTANT_ARB 0x8576 +#define GL_PRIMARY_COLOR_ARB 0x8577 +#define GL_PREVIOUS_ARB 0x8578 +#endif + +#ifndef GL_ARB_texture_env_crossbar +#endif + +#ifndef GL_ARB_texture_env_dot3 +#define GL_DOT3_RGB_ARB 0x86AE +#define GL_DOT3_RGBA_ARB 0x86AF +#endif + +#ifndef GL_ARB_texture_mirrored_repeat +#define GL_MIRRORED_REPEAT_ARB 0x8370 +#endif + +#ifndef GL_ARB_depth_texture +#define GL_DEPTH_COMPONENT16_ARB 0x81A5 +#define GL_DEPTH_COMPONENT24_ARB 0x81A6 +#define GL_DEPTH_COMPONENT32_ARB 0x81A7 +#define GL_TEXTURE_DEPTH_SIZE_ARB 0x884A +#define GL_DEPTH_TEXTURE_MODE_ARB 0x884B +#endif + +#ifndef GL_ARB_shadow +#define GL_TEXTURE_COMPARE_MODE_ARB 0x884C +#define GL_TEXTURE_COMPARE_FUNC_ARB 0x884D +#define GL_COMPARE_R_TO_TEXTURE_ARB 0x884E +#endif + +#ifndef GL_ARB_shadow_ambient +#define GL_TEXTURE_COMPARE_FAIL_VALUE_ARB 0x80BF +#endif + +#ifndef GL_ARB_window_pos +#endif + +#ifndef GL_ARB_vertex_program +#define GL_COLOR_SUM_ARB 0x8458 +#define GL_VERTEX_PROGRAM_ARB 0x8620 +#define GL_VERTEX_ATTRIB_ARRAY_ENABLED_ARB 0x8622 +#define GL_VERTEX_ATTRIB_ARRAY_SIZE_ARB 0x8623 +#define GL_VERTEX_ATTRIB_ARRAY_STRIDE_ARB 0x8624 +#define GL_VERTEX_ATTRIB_ARRAY_TYPE_ARB 0x8625 +#define GL_CURRENT_VERTEX_ATTRIB_ARB 0x8626 +#define GL_PROGRAM_LENGTH_ARB 0x8627 +#define GL_PROGRAM_STRING_ARB 0x8628 +#define GL_MAX_PROGRAM_MATRIX_STACK_DEPTH_ARB 0x862E +#define GL_MAX_PROGRAM_MATRICES_ARB 0x862F +#define GL_CURRENT_MATRIX_STACK_DEPTH_ARB 0x8640 +#define GL_CURRENT_MATRIX_ARB 0x8641 +#define GL_VERTEX_PROGRAM_POINT_SIZE_ARB 0x8642 +#define GL_VERTEX_PROGRAM_TWO_SIDE_ARB 0x8643 +#define GL_VERTEX_ATTRIB_ARRAY_POINTER_ARB 0x8645 +#define GL_PROGRAM_ERROR_POSITION_ARB 0x864B +#define GL_PROGRAM_BINDING_ARB 0x8677 +#define GL_MAX_VERTEX_ATTRIBS_ARB 0x8869 +#define GL_VERTEX_ATTRIB_ARRAY_NORMALIZED_ARB 0x886A +#define GL_PROGRAM_ERROR_STRING_ARB 0x8874 +#define GL_PROGRAM_FORMAT_ASCII_ARB 0x8875 +#define GL_PROGRAM_FORMAT_ARB 0x8876 +#define GL_PROGRAM_INSTRUCTIONS_ARB 0x88A0 +#define GL_MAX_PROGRAM_INSTRUCTIONS_ARB 0x88A1 +#define GL_PROGRAM_NATIVE_INSTRUCTIONS_ARB 0x88A2 +#define GL_MAX_PROGRAM_NATIVE_INSTRUCTIONS_ARB 0x88A3 +#define GL_PROGRAM_TEMPORARIES_ARB 0x88A4 +#define GL_MAX_PROGRAM_TEMPORARIES_ARB 0x88A5 +#define GL_PROGRAM_NATIVE_TEMPORARIES_ARB 0x88A6 +#define GL_MAX_PROGRAM_NATIVE_TEMPORARIES_ARB 0x88A7 +#define GL_PROGRAM_PARAMETERS_ARB 0x88A8 +#define GL_MAX_PROGRAM_PARAMETERS_ARB 0x88A9 +#define GL_PROGRAM_NATIVE_PARAMETERS_ARB 0x88AA +#define GL_MAX_PROGRAM_NATIVE_PARAMETERS_ARB 0x88AB +#define GL_PROGRAM_ATTRIBS_ARB 0x88AC +#define GL_MAX_PROGRAM_ATTRIBS_ARB 0x88AD +#define GL_PROGRAM_NATIVE_ATTRIBS_ARB 0x88AE +#define GL_MAX_PROGRAM_NATIVE_ATTRIBS_ARB 0x88AF +#define GL_PROGRAM_ADDRESS_REGISTERS_ARB 0x88B0 +#define GL_MAX_PROGRAM_ADDRESS_REGISTERS_ARB 0x88B1 +#define GL_PROGRAM_NATIVE_ADDRESS_REGISTERS_ARB 0x88B2 +#define GL_MAX_PROGRAM_NATIVE_ADDRESS_REGISTERS_ARB 0x88B3 +#define GL_MAX_PROGRAM_LOCAL_PARAMETERS_ARB 0x88B4 +#define GL_MAX_PROGRAM_ENV_PARAMETERS_ARB 0x88B5 +#define GL_PROGRAM_UNDER_NATIVE_LIMITS_ARB 0x88B6 +#define GL_TRANSPOSE_CURRENT_MATRIX_ARB 0x88B7 +#define GL_MATRIX0_ARB 0x88C0 +#define GL_MATRIX1_ARB 0x88C1 +#define GL_MATRIX2_ARB 0x88C2 +#define GL_MATRIX3_ARB 0x88C3 +#define GL_MATRIX4_ARB 0x88C4 +#define GL_MATRIX5_ARB 0x88C5 +#define GL_MATRIX6_ARB 0x88C6 +#define GL_MATRIX7_ARB 0x88C7 +#define GL_MATRIX8_ARB 0x88C8 +#define GL_MATRIX9_ARB 0x88C9 +#define GL_MATRIX10_ARB 0x88CA +#define GL_MATRIX11_ARB 0x88CB +#define GL_MATRIX12_ARB 0x88CC +#define GL_MATRIX13_ARB 0x88CD +#define GL_MATRIX14_ARB 0x88CE +#define GL_MATRIX15_ARB 0x88CF +#define GL_MATRIX16_ARB 0x88D0 +#define GL_MATRIX17_ARB 0x88D1 +#define GL_MATRIX18_ARB 0x88D2 +#define GL_MATRIX19_ARB 0x88D3 +#define GL_MATRIX20_ARB 0x88D4 +#define GL_MATRIX21_ARB 0x88D5 +#define GL_MATRIX22_ARB 0x88D6 +#define GL_MATRIX23_ARB 0x88D7 +#define GL_MATRIX24_ARB 0x88D8 +#define GL_MATRIX25_ARB 0x88D9 +#define GL_MATRIX26_ARB 0x88DA +#define GL_MATRIX27_ARB 0x88DB +#define GL_MATRIX28_ARB 0x88DC +#define GL_MATRIX29_ARB 0x88DD +#define GL_MATRIX30_ARB 0x88DE +#define GL_MATRIX31_ARB 0x88DF +#endif + +#ifndef GL_ARB_fragment_program +#define GL_FRAGMENT_PROGRAM_ARB 0x8804 +#define GL_PROGRAM_ALU_INSTRUCTIONS_ARB 0x8805 +#define GL_PROGRAM_TEX_INSTRUCTIONS_ARB 0x8806 +#define GL_PROGRAM_TEX_INDIRECTIONS_ARB 0x8807 +#define GL_PROGRAM_NATIVE_ALU_INSTRUCTIONS_ARB 0x8808 +#define GL_PROGRAM_NATIVE_TEX_INSTRUCTIONS_ARB 0x8809 +#define GL_PROGRAM_NATIVE_TEX_INDIRECTIONS_ARB 0x880A +#define GL_MAX_PROGRAM_ALU_INSTRUCTIONS_ARB 0x880B +#define GL_MAX_PROGRAM_TEX_INSTRUCTIONS_ARB 0x880C +#define GL_MAX_PROGRAM_TEX_INDIRECTIONS_ARB 0x880D +#define GL_MAX_PROGRAM_NATIVE_ALU_INSTRUCTIONS_ARB 0x880E +#define GL_MAX_PROGRAM_NATIVE_TEX_INSTRUCTIONS_ARB 0x880F +#define GL_MAX_PROGRAM_NATIVE_TEX_INDIRECTIONS_ARB 0x8810 +#define GL_MAX_TEXTURE_COORDS_ARB 0x8871 +#define GL_MAX_TEXTURE_IMAGE_UNITS_ARB 0x8872 +#endif + +#ifndef GL_ARB_vertex_buffer_object +#define GL_BUFFER_SIZE_ARB 0x8764 +#define GL_BUFFER_USAGE_ARB 0x8765 +#define GL_ARRAY_BUFFER_ARB 0x8892 +#define GL_ELEMENT_ARRAY_BUFFER_ARB 0x8893 +#define GL_ARRAY_BUFFER_BINDING_ARB 0x8894 +#define GL_ELEMENT_ARRAY_BUFFER_BINDING_ARB 0x8895 +#define GL_VERTEX_ARRAY_BUFFER_BINDING_ARB 0x8896 +#define GL_NORMAL_ARRAY_BUFFER_BINDING_ARB 0x8897 +#define GL_COLOR_ARRAY_BUFFER_BINDING_ARB 0x8898 +#define GL_INDEX_ARRAY_BUFFER_BINDING_ARB 0x8899 +#define GL_TEXTURE_COORD_ARRAY_BUFFER_BINDING_ARB 0x889A +#define GL_EDGE_FLAG_ARRAY_BUFFER_BINDING_ARB 0x889B +#define GL_SECONDARY_COLOR_ARRAY_BUFFER_BINDING_ARB 0x889C +#define GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING_ARB 0x889D +#define GL_WEIGHT_ARRAY_BUFFER_BINDING_ARB 0x889E +#define GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING_ARB 0x889F +#define GL_READ_ONLY_ARB 0x88B8 +#define GL_WRITE_ONLY_ARB 0x88B9 +#define GL_READ_WRITE_ARB 0x88BA +#define GL_BUFFER_ACCESS_ARB 0x88BB +#define GL_BUFFER_MAPPED_ARB 0x88BC +#define GL_BUFFER_MAP_POINTER_ARB 0x88BD +#define GL_STREAM_DRAW_ARB 0x88E0 +#define GL_STREAM_READ_ARB 0x88E1 +#define GL_STREAM_COPY_ARB 0x88E2 +#define GL_STATIC_DRAW_ARB 0x88E4 +#define GL_STATIC_READ_ARB 0x88E5 +#define GL_STATIC_COPY_ARB 0x88E6 +#define GL_DYNAMIC_DRAW_ARB 0x88E8 +#define GL_DYNAMIC_READ_ARB 0x88E9 +#define GL_DYNAMIC_COPY_ARB 0x88EA +#endif + +#ifndef GL_ARB_occlusion_query +#define GL_QUERY_COUNTER_BITS_ARB 0x8864 +#define GL_CURRENT_QUERY_ARB 0x8865 +#define GL_QUERY_RESULT_ARB 0x8866 +#define GL_QUERY_RESULT_AVAILABLE_ARB 0x8867 +#define GL_SAMPLES_PASSED_ARB 0x8914 +#endif + +#ifndef GL_ARB_shader_objects +#define GL_PROGRAM_OBJECT_ARB 0x8B40 +#define GL_SHADER_OBJECT_ARB 0x8B48 +#define GL_OBJECT_TYPE_ARB 0x8B4E +#define GL_OBJECT_SUBTYPE_ARB 0x8B4F +#define GL_FLOAT_VEC2_ARB 0x8B50 +#define GL_FLOAT_VEC3_ARB 0x8B51 +#define GL_FLOAT_VEC4_ARB 0x8B52 +#define GL_INT_VEC2_ARB 0x8B53 +#define GL_INT_VEC3_ARB 0x8B54 +#define GL_INT_VEC4_ARB 0x8B55 +#define GL_BOOL_ARB 0x8B56 +#define GL_BOOL_VEC2_ARB 0x8B57 +#define GL_BOOL_VEC3_ARB 0x8B58 +#define GL_BOOL_VEC4_ARB 0x8B59 +#define GL_FLOAT_MAT2_ARB 0x8B5A +#define GL_FLOAT_MAT3_ARB 0x8B5B +#define GL_FLOAT_MAT4_ARB 0x8B5C +#define GL_SAMPLER_1D_ARB 0x8B5D +#define GL_SAMPLER_2D_ARB 0x8B5E +#define GL_SAMPLER_3D_ARB 0x8B5F +#define GL_SAMPLER_CUBE_ARB 0x8B60 +#define GL_SAMPLER_1D_SHADOW_ARB 0x8B61 +#define GL_SAMPLER_2D_SHADOW_ARB 0x8B62 +#define GL_SAMPLER_2D_RECT_ARB 0x8B63 +#define GL_SAMPLER_2D_RECT_SHADOW_ARB 0x8B64 +#define GL_OBJECT_DELETE_STATUS_ARB 0x8B80 +#define GL_OBJECT_COMPILE_STATUS_ARB 0x8B81 +#define GL_OBJECT_LINK_STATUS_ARB 0x8B82 +#define GL_OBJECT_VALIDATE_STATUS_ARB 0x8B83 +#define GL_OBJECT_INFO_LOG_LENGTH_ARB 0x8B84 +#define GL_OBJECT_ATTACHED_OBJECTS_ARB 0x8B85 +#define GL_OBJECT_ACTIVE_UNIFORMS_ARB 0x8B86 +#define GL_OBJECT_ACTIVE_UNIFORM_MAX_LENGTH_ARB 0x8B87 +#define GL_OBJECT_SHADER_SOURCE_LENGTH_ARB 0x8B88 +#endif + +#ifndef GL_ARB_vertex_shader +#define GL_VERTEX_SHADER_ARB 0x8B31 +#define GL_MAX_VERTEX_UNIFORM_COMPONENTS_ARB 0x8B4A +#define GL_MAX_VARYING_FLOATS_ARB 0x8B4B +#define GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS_ARB 0x8B4C +#define GL_MAX_COMBINED_TEXTURE_IMAGE_UNITS_ARB 0x8B4D +#define GL_OBJECT_ACTIVE_ATTRIBUTES_ARB 0x8B89 +#define GL_OBJECT_ACTIVE_ATTRIBUTE_MAX_LENGTH_ARB 0x8B8A +#endif + +#ifndef GL_ARB_fragment_shader +#define GL_FRAGMENT_SHADER_ARB 0x8B30 +#define GL_MAX_FRAGMENT_UNIFORM_COMPONENTS_ARB 0x8B49 +#define GL_FRAGMENT_SHADER_DERIVATIVE_HINT_ARB 0x8B8B +#endif + +#ifndef GL_ARB_shading_language_100 +#define GL_SHADING_LANGUAGE_VERSION_ARB 0x8B8C +#endif + +#ifndef GL_ARB_texture_non_power_of_two +#endif + +#ifndef GL_ARB_point_sprite +#define GL_POINT_SPRITE_ARB 0x8861 +#define GL_COORD_REPLACE_ARB 0x8862 +#endif + +#ifndef GL_ARB_fragment_program_shadow +#endif + +#ifndef GL_ARB_draw_buffers +#define GL_MAX_DRAW_BUFFERS_ARB 0x8824 +#define GL_DRAW_BUFFER0_ARB 0x8825 +#define GL_DRAW_BUFFER1_ARB 0x8826 +#define GL_DRAW_BUFFER2_ARB 0x8827 +#define GL_DRAW_BUFFER3_ARB 0x8828 +#define GL_DRAW_BUFFER4_ARB 0x8829 +#define GL_DRAW_BUFFER5_ARB 0x882A +#define GL_DRAW_BUFFER6_ARB 0x882B +#define GL_DRAW_BUFFER7_ARB 0x882C +#define GL_DRAW_BUFFER8_ARB 0x882D +#define GL_DRAW_BUFFER9_ARB 0x882E +#define GL_DRAW_BUFFER10_ARB 0x882F +#define GL_DRAW_BUFFER11_ARB 0x8830 +#define GL_DRAW_BUFFER12_ARB 0x8831 +#define GL_DRAW_BUFFER13_ARB 0x8832 +#define GL_DRAW_BUFFER14_ARB 0x8833 +#define GL_DRAW_BUFFER15_ARB 0x8834 +#endif + +#ifndef GL_ARB_texture_rectangle +#define GL_TEXTURE_RECTANGLE_ARB 0x84F5 +#define GL_TEXTURE_BINDING_RECTANGLE_ARB 0x84F6 +#define GL_PROXY_TEXTURE_RECTANGLE_ARB 0x84F7 +#define GL_MAX_RECTANGLE_TEXTURE_SIZE_ARB 0x84F8 +#endif + +#ifndef GL_ARB_color_buffer_float +#define GL_RGBA_FLOAT_MODE_ARB 0x8820 +#define GL_CLAMP_VERTEX_COLOR_ARB 0x891A +#define GL_CLAMP_FRAGMENT_COLOR_ARB 0x891B +#define GL_CLAMP_READ_COLOR_ARB 0x891C +#define GL_FIXED_ONLY_ARB 0x891D +#endif + +#ifndef GL_ARB_half_float_pixel +#define GL_HALF_FLOAT_ARB 0x140B +#endif + +#ifndef GL_ARB_texture_float +#define GL_TEXTURE_RED_TYPE_ARB 0x8C10 +#define GL_TEXTURE_GREEN_TYPE_ARB 0x8C11 +#define GL_TEXTURE_BLUE_TYPE_ARB 0x8C12 +#define GL_TEXTURE_ALPHA_TYPE_ARB 0x8C13 +#define GL_TEXTURE_LUMINANCE_TYPE_ARB 0x8C14 +#define GL_TEXTURE_INTENSITY_TYPE_ARB 0x8C15 +#define GL_TEXTURE_DEPTH_TYPE_ARB 0x8C16 +#define GL_UNSIGNED_NORMALIZED_ARB 0x8C17 +#define GL_RGBA32F_ARB 0x8814 +#define GL_RGB32F_ARB 0x8815 +#define GL_ALPHA32F_ARB 0x8816 +#define GL_INTENSITY32F_ARB 0x8817 +#define GL_LUMINANCE32F_ARB 0x8818 +#define GL_LUMINANCE_ALPHA32F_ARB 0x8819 +#define GL_RGBA16F_ARB 0x881A +#define GL_RGB16F_ARB 0x881B +#define GL_ALPHA16F_ARB 0x881C +#define GL_INTENSITY16F_ARB 0x881D +#define GL_LUMINANCE16F_ARB 0x881E +#define GL_LUMINANCE_ALPHA16F_ARB 0x881F +#endif + +#ifndef GL_ARB_pixel_buffer_object +#define GL_PIXEL_PACK_BUFFER_ARB 0x88EB +#define GL_PIXEL_UNPACK_BUFFER_ARB 0x88EC +#define GL_PIXEL_PACK_BUFFER_BINDING_ARB 0x88ED +#define GL_PIXEL_UNPACK_BUFFER_BINDING_ARB 0x88EF +#endif + +#ifndef GL_ARB_depth_buffer_float +#define GL_DEPTH_COMPONENT32F 0x8CAC +#define GL_DEPTH32F_STENCIL8 0x8CAD +#define GL_FLOAT_32_UNSIGNED_INT_24_8_REV 0x8DAD +#endif + +#ifndef GL_ARB_draw_instanced +#endif + +#ifndef GL_ARB_framebuffer_object +#define GL_INVALID_FRAMEBUFFER_OPERATION 0x0506 +#define GL_FRAMEBUFFER_ATTACHMENT_COLOR_ENCODING 0x8210 +#define GL_FRAMEBUFFER_ATTACHMENT_COMPONENT_TYPE 0x8211 +#define GL_FRAMEBUFFER_ATTACHMENT_RED_SIZE 0x8212 +#define GL_FRAMEBUFFER_ATTACHMENT_GREEN_SIZE 0x8213 +#define GL_FRAMEBUFFER_ATTACHMENT_BLUE_SIZE 0x8214 +#define GL_FRAMEBUFFER_ATTACHMENT_ALPHA_SIZE 0x8215 +#define GL_FRAMEBUFFER_ATTACHMENT_DEPTH_SIZE 0x8216 +#define GL_FRAMEBUFFER_ATTACHMENT_STENCIL_SIZE 0x8217 +#define GL_FRAMEBUFFER_DEFAULT 0x8218 +#define GL_FRAMEBUFFER_UNDEFINED 0x8219 +#define GL_DEPTH_STENCIL_ATTACHMENT 0x821A +#define GL_MAX_RENDERBUFFER_SIZE 0x84E8 +#define GL_DEPTH_STENCIL 0x84F9 +#define GL_UNSIGNED_INT_24_8 0x84FA +#define GL_DEPTH24_STENCIL8 0x88F0 +#define GL_TEXTURE_STENCIL_SIZE 0x88F1 +#define GL_TEXTURE_RED_TYPE 0x8C10 +#define GL_TEXTURE_GREEN_TYPE 0x8C11 +#define GL_TEXTURE_BLUE_TYPE 0x8C12 +#define GL_TEXTURE_ALPHA_TYPE 0x8C13 +#define GL_TEXTURE_DEPTH_TYPE 0x8C16 +#define GL_UNSIGNED_NORMALIZED 0x8C17 +#define GL_FRAMEBUFFER_BINDING 0x8CA6 +#define GL_DRAW_FRAMEBUFFER_BINDING GL_FRAMEBUFFER_BINDING +#define GL_RENDERBUFFER_BINDING 0x8CA7 +#define GL_READ_FRAMEBUFFER 0x8CA8 +#define GL_DRAW_FRAMEBUFFER 0x8CA9 +#define GL_READ_FRAMEBUFFER_BINDING 0x8CAA +#define GL_RENDERBUFFER_SAMPLES 0x8CAB +#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_TYPE 0x8CD0 +#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_NAME 0x8CD1 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LEVEL 0x8CD2 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_CUBE_MAP_FACE 0x8CD3 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LAYER 0x8CD4 +#define GL_FRAMEBUFFER_COMPLETE 0x8CD5 +#define GL_FRAMEBUFFER_INCOMPLETE_ATTACHMENT 0x8CD6 +#define GL_FRAMEBUFFER_INCOMPLETE_MISSING_ATTACHMENT 0x8CD7 +#define GL_FRAMEBUFFER_INCOMPLETE_DRAW_BUFFER 0x8CDB +#define GL_FRAMEBUFFER_INCOMPLETE_READ_BUFFER 0x8CDC +#define GL_FRAMEBUFFER_UNSUPPORTED 0x8CDD +#define GL_MAX_COLOR_ATTACHMENTS 0x8CDF +#define GL_COLOR_ATTACHMENT0 0x8CE0 +#define GL_COLOR_ATTACHMENT1 0x8CE1 +#define GL_COLOR_ATTACHMENT2 0x8CE2 +#define GL_COLOR_ATTACHMENT3 0x8CE3 +#define GL_COLOR_ATTACHMENT4 0x8CE4 +#define GL_COLOR_ATTACHMENT5 0x8CE5 +#define GL_COLOR_ATTACHMENT6 0x8CE6 +#define GL_COLOR_ATTACHMENT7 0x8CE7 +#define GL_COLOR_ATTACHMENT8 0x8CE8 +#define GL_COLOR_ATTACHMENT9 0x8CE9 +#define GL_COLOR_ATTACHMENT10 0x8CEA +#define GL_COLOR_ATTACHMENT11 0x8CEB +#define GL_COLOR_ATTACHMENT12 0x8CEC +#define GL_COLOR_ATTACHMENT13 0x8CED +#define GL_COLOR_ATTACHMENT14 0x8CEE +#define GL_COLOR_ATTACHMENT15 0x8CEF +#define GL_DEPTH_ATTACHMENT 0x8D00 +#define GL_STENCIL_ATTACHMENT 0x8D20 +#define GL_FRAMEBUFFER 0x8D40 +#define GL_RENDERBUFFER 0x8D41 +#define GL_RENDERBUFFER_WIDTH 0x8D42 +#define GL_RENDERBUFFER_HEIGHT 0x8D43 +#define GL_RENDERBUFFER_INTERNAL_FORMAT 0x8D44 +#define GL_STENCIL_INDEX1 0x8D46 +#define GL_STENCIL_INDEX4 0x8D47 +#define GL_STENCIL_INDEX8 0x8D48 +#define GL_STENCIL_INDEX16 0x8D49 +#define GL_RENDERBUFFER_RED_SIZE 0x8D50 +#define GL_RENDERBUFFER_GREEN_SIZE 0x8D51 +#define GL_RENDERBUFFER_BLUE_SIZE 0x8D52 +#define GL_RENDERBUFFER_ALPHA_SIZE 0x8D53 +#define GL_RENDERBUFFER_DEPTH_SIZE 0x8D54 +#define GL_RENDERBUFFER_STENCIL_SIZE 0x8D55 +#define GL_FRAMEBUFFER_INCOMPLETE_MULTISAMPLE 0x8D56 +#define GL_MAX_SAMPLES 0x8D57 +#endif + +#ifndef GL_ARB_framebuffer_object_DEPRECATED +#define GL_INDEX 0x8222 +#define GL_TEXTURE_LUMINANCE_TYPE 0x8C14 +#define GL_TEXTURE_INTENSITY_TYPE 0x8C15 +#endif + +#ifndef GL_ARB_framebuffer_sRGB +#define GL_FRAMEBUFFER_SRGB 0x8DB9 +#endif + +#ifndef GL_ARB_geometry_shader4 +#define GL_LINES_ADJACENCY_ARB 0x000A +#define GL_LINE_STRIP_ADJACENCY_ARB 0x000B +#define GL_TRIANGLES_ADJACENCY_ARB 0x000C +#define GL_TRIANGLE_STRIP_ADJACENCY_ARB 0x000D +#define GL_PROGRAM_POINT_SIZE_ARB 0x8642 +#define GL_MAX_GEOMETRY_TEXTURE_IMAGE_UNITS_ARB 0x8C29 +#define GL_FRAMEBUFFER_ATTACHMENT_LAYERED_ARB 0x8DA7 +#define GL_FRAMEBUFFER_INCOMPLETE_LAYER_TARGETS_ARB 0x8DA8 +#define GL_FRAMEBUFFER_INCOMPLETE_LAYER_COUNT_ARB 0x8DA9 +#define GL_GEOMETRY_SHADER_ARB 0x8DD9 +#define GL_GEOMETRY_VERTICES_OUT_ARB 0x8DDA +#define GL_GEOMETRY_INPUT_TYPE_ARB 0x8DDB +#define GL_GEOMETRY_OUTPUT_TYPE_ARB 0x8DDC +#define GL_MAX_GEOMETRY_VARYING_COMPONENTS_ARB 0x8DDD +#define GL_MAX_VERTEX_VARYING_COMPONENTS_ARB 0x8DDE +#define GL_MAX_GEOMETRY_UNIFORM_COMPONENTS_ARB 0x8DDF +#define GL_MAX_GEOMETRY_OUTPUT_VERTICES_ARB 0x8DE0 +#define GL_MAX_GEOMETRY_TOTAL_OUTPUT_COMPONENTS_ARB 0x8DE1 +/* reuse GL_MAX_VARYING_COMPONENTS */ +/* reuse GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LAYER */ +#endif + +#ifndef GL_ARB_half_float_vertex +#define GL_HALF_FLOAT 0x140B +#endif + +#ifndef GL_ARB_instanced_arrays +#define GL_VERTEX_ATTRIB_ARRAY_DIVISOR_ARB 0x88FE +#endif + +#ifndef GL_ARB_map_buffer_range +#define GL_MAP_READ_BIT 0x0001 +#define GL_MAP_WRITE_BIT 0x0002 +#define GL_MAP_INVALIDATE_RANGE_BIT 0x0004 +#define GL_MAP_INVALIDATE_BUFFER_BIT 0x0008 +#define GL_MAP_FLUSH_EXPLICIT_BIT 0x0010 +#define GL_MAP_UNSYNCHRONIZED_BIT 0x0020 +#endif + +#ifndef GL_ARB_texture_buffer_object +#define GL_TEXTURE_BUFFER_ARB 0x8C2A +#define GL_MAX_TEXTURE_BUFFER_SIZE_ARB 0x8C2B +#define GL_TEXTURE_BINDING_BUFFER_ARB 0x8C2C +#define GL_TEXTURE_BUFFER_DATA_STORE_BINDING_ARB 0x8C2D +#define GL_TEXTURE_BUFFER_FORMAT_ARB 0x8C2E +#endif + +#ifndef GL_ARB_texture_compression_rgtc +#define GL_COMPRESSED_RED_RGTC1 0x8DBB +#define GL_COMPRESSED_SIGNED_RED_RGTC1 0x8DBC +#define GL_COMPRESSED_RG_RGTC2 0x8DBD +#define GL_COMPRESSED_SIGNED_RG_RGTC2 0x8DBE +#endif + +#ifndef GL_ARB_texture_rg +#define GL_RG 0x8227 +#define GL_RG_INTEGER 0x8228 +#define GL_R8 0x8229 +#define GL_R16 0x822A +#define GL_RG8 0x822B +#define GL_RG16 0x822C +#define GL_R16F 0x822D +#define GL_R32F 0x822E +#define GL_RG16F 0x822F +#define GL_RG32F 0x8230 +#define GL_R8I 0x8231 +#define GL_R8UI 0x8232 +#define GL_R16I 0x8233 +#define GL_R16UI 0x8234 +#define GL_R32I 0x8235 +#define GL_R32UI 0x8236 +#define GL_RG8I 0x8237 +#define GL_RG8UI 0x8238 +#define GL_RG16I 0x8239 +#define GL_RG16UI 0x823A +#define GL_RG32I 0x823B +#define GL_RG32UI 0x823C +#endif + +#ifndef GL_ARB_vertex_array_object +#define GL_VERTEX_ARRAY_BINDING 0x85B5 +#endif + +#ifndef GL_ARB_uniform_buffer_object +#define GL_UNIFORM_BUFFER 0x8A11 +#define GL_UNIFORM_BUFFER_BINDING 0x8A28 +#define GL_UNIFORM_BUFFER_START 0x8A29 +#define GL_UNIFORM_BUFFER_SIZE 0x8A2A +#define GL_MAX_VERTEX_UNIFORM_BLOCKS 0x8A2B +#define GL_MAX_GEOMETRY_UNIFORM_BLOCKS 0x8A2C +#define GL_MAX_FRAGMENT_UNIFORM_BLOCKS 0x8A2D +#define GL_MAX_COMBINED_UNIFORM_BLOCKS 0x8A2E +#define GL_MAX_UNIFORM_BUFFER_BINDINGS 0x8A2F +#define GL_MAX_UNIFORM_BLOCK_SIZE 0x8A30 +#define GL_MAX_COMBINED_VERTEX_UNIFORM_COMPONENTS 0x8A31 +#define GL_MAX_COMBINED_GEOMETRY_UNIFORM_COMPONENTS 0x8A32 +#define GL_MAX_COMBINED_FRAGMENT_UNIFORM_COMPONENTS 0x8A33 +#define GL_UNIFORM_BUFFER_OFFSET_ALIGNMENT 0x8A34 +#define GL_ACTIVE_UNIFORM_BLOCK_MAX_NAME_LENGTH 0x8A35 +#define GL_ACTIVE_UNIFORM_BLOCKS 0x8A36 +#define GL_UNIFORM_TYPE 0x8A37 +#define GL_UNIFORM_SIZE 0x8A38 +#define GL_UNIFORM_NAME_LENGTH 0x8A39 +#define GL_UNIFORM_BLOCK_INDEX 0x8A3A +#define GL_UNIFORM_OFFSET 0x8A3B +#define GL_UNIFORM_ARRAY_STRIDE 0x8A3C +#define GL_UNIFORM_MATRIX_STRIDE 0x8A3D +#define GL_UNIFORM_IS_ROW_MAJOR 0x8A3E +#define GL_UNIFORM_BLOCK_BINDING 0x8A3F +#define GL_UNIFORM_BLOCK_DATA_SIZE 0x8A40 +#define GL_UNIFORM_BLOCK_NAME_LENGTH 0x8A41 +#define GL_UNIFORM_BLOCK_ACTIVE_UNIFORMS 0x8A42 +#define GL_UNIFORM_BLOCK_ACTIVE_UNIFORM_INDICES 0x8A43 +#define GL_UNIFORM_BLOCK_REFERENCED_BY_VERTEX_SHADER 0x8A44 +#define GL_UNIFORM_BLOCK_REFERENCED_BY_GEOMETRY_SHADER 0x8A45 +#define GL_UNIFORM_BLOCK_REFERENCED_BY_FRAGMENT_SHADER 0x8A46 +#define GL_INVALID_INDEX 0xFFFFFFFFu +#endif + +#ifndef GL_ARB_compatibility +/* ARB_compatibility just defines tokens from core 3.0 */ +#endif + +#ifndef GL_ARB_copy_buffer +#define GL_COPY_READ_BUFFER 0x8F36 +#define GL_COPY_WRITE_BUFFER 0x8F37 +#endif + +#ifndef GL_ARB_shader_texture_lod +#endif + +#ifndef GL_ARB_depth_clamp +#define GL_DEPTH_CLAMP 0x864F +#endif + +#ifndef GL_ARB_draw_elements_base_vertex +#endif + +#ifndef GL_ARB_fragment_coord_conventions +#endif + +#ifndef GL_ARB_provoking_vertex +#define GL_QUADS_FOLLOW_PROVOKING_VERTEX_CONVENTION 0x8E4C +#define GL_FIRST_VERTEX_CONVENTION 0x8E4D +#define GL_LAST_VERTEX_CONVENTION 0x8E4E +#define GL_PROVOKING_VERTEX 0x8E4F +#endif + +#ifndef GL_ARB_seamless_cube_map +#define GL_TEXTURE_CUBE_MAP_SEAMLESS 0x884F +#endif + +#ifndef GL_ARB_sync +#define GL_MAX_SERVER_WAIT_TIMEOUT 0x9111 +#define GL_OBJECT_TYPE 0x9112 +#define GL_SYNC_CONDITION 0x9113 +#define GL_SYNC_STATUS 0x9114 +#define GL_SYNC_FLAGS 0x9115 +#define GL_SYNC_FENCE 0x9116 +#define GL_SYNC_GPU_COMMANDS_COMPLETE 0x9117 +#define GL_UNSIGNALED 0x9118 +#define GL_SIGNALED 0x9119 +#define GL_ALREADY_SIGNALED 0x911A +#define GL_TIMEOUT_EXPIRED 0x911B +#define GL_CONDITION_SATISFIED 0x911C +#define GL_WAIT_FAILED 0x911D +#define GL_SYNC_FLUSH_COMMANDS_BIT 0x00000001 +#define GL_TIMEOUT_IGNORED 0xFFFFFFFFFFFFFFFFull +#endif + +#ifndef GL_ARB_texture_multisample +#define GL_SAMPLE_POSITION 0x8E50 +#define GL_SAMPLE_MASK 0x8E51 +#define GL_SAMPLE_MASK_VALUE 0x8E52 +#define GL_MAX_SAMPLE_MASK_WORDS 0x8E59 +#define GL_TEXTURE_2D_MULTISAMPLE 0x9100 +#define GL_PROXY_TEXTURE_2D_MULTISAMPLE 0x9101 +#define GL_TEXTURE_2D_MULTISAMPLE_ARRAY 0x9102 +#define GL_PROXY_TEXTURE_2D_MULTISAMPLE_ARRAY 0x9103 +#define GL_TEXTURE_BINDING_2D_MULTISAMPLE 0x9104 +#define GL_TEXTURE_BINDING_2D_MULTISAMPLE_ARRAY 0x9105 +#define GL_TEXTURE_SAMPLES 0x9106 +#define GL_TEXTURE_FIXED_SAMPLE_LOCATIONS 0x9107 +#define GL_SAMPLER_2D_MULTISAMPLE 0x9108 +#define GL_INT_SAMPLER_2D_MULTISAMPLE 0x9109 +#define GL_UNSIGNED_INT_SAMPLER_2D_MULTISAMPLE 0x910A +#define GL_SAMPLER_2D_MULTISAMPLE_ARRAY 0x910B +#define GL_INT_SAMPLER_2D_MULTISAMPLE_ARRAY 0x910C +#define GL_UNSIGNED_INT_SAMPLER_2D_MULTISAMPLE_ARRAY 0x910D +#define GL_MAX_COLOR_TEXTURE_SAMPLES 0x910E +#define GL_MAX_DEPTH_TEXTURE_SAMPLES 0x910F +#define GL_MAX_INTEGER_SAMPLES 0x9110 +#endif + +#ifndef GL_ARB_vertex_array_bgra +/* reuse GL_BGRA */ +#endif + +#ifndef GL_ARB_draw_buffers_blend +#endif + +#ifndef GL_ARB_sample_shading +#define GL_SAMPLE_SHADING_ARB 0x8C36 +#define GL_MIN_SAMPLE_SHADING_VALUE_ARB 0x8C37 +#endif + +#ifndef GL_ARB_texture_cube_map_array +#define GL_TEXTURE_CUBE_MAP_ARRAY_ARB 0x9009 +#define GL_TEXTURE_BINDING_CUBE_MAP_ARRAY_ARB 0x900A +#define GL_PROXY_TEXTURE_CUBE_MAP_ARRAY_ARB 0x900B +#define GL_SAMPLER_CUBE_MAP_ARRAY_ARB 0x900C +#define GL_SAMPLER_CUBE_MAP_ARRAY_SHADOW_ARB 0x900D +#define GL_INT_SAMPLER_CUBE_MAP_ARRAY_ARB 0x900E +#define GL_UNSIGNED_INT_SAMPLER_CUBE_MAP_ARRAY_ARB 0x900F +#endif + +#ifndef GL_ARB_texture_gather +#define GL_MIN_PROGRAM_TEXTURE_GATHER_OFFSET_ARB 0x8E5E +#define GL_MAX_PROGRAM_TEXTURE_GATHER_OFFSET_ARB 0x8E5F +#endif + +#ifndef GL_ARB_texture_query_lod +#endif + +#ifndef GL_ARB_shading_language_include +#define GL_SHADER_INCLUDE_ARB 0x8DAE +#define GL_NAMED_STRING_LENGTH_ARB 0x8DE9 +#define GL_NAMED_STRING_TYPE_ARB 0x8DEA +#endif + +#ifndef GL_ARB_texture_compression_bptc +#define GL_COMPRESSED_RGBA_BPTC_UNORM_ARB 0x8E8C +#define GL_COMPRESSED_SRGB_ALPHA_BPTC_UNORM_ARB 0x8E8D +#define GL_COMPRESSED_RGB_BPTC_SIGNED_FLOAT_ARB 0x8E8E +#define GL_COMPRESSED_RGB_BPTC_UNSIGNED_FLOAT_ARB 0x8E8F +#endif + +#ifndef GL_ARB_blend_func_extended +#define GL_SRC1_COLOR 0x88F9 +/* reuse GL_SRC1_ALPHA */ +#define GL_ONE_MINUS_SRC1_COLOR 0x88FA +#define GL_ONE_MINUS_SRC1_ALPHA 0x88FB +#define GL_MAX_DUAL_SOURCE_DRAW_BUFFERS 0x88FC +#endif + +#ifndef GL_ARB_explicit_attrib_location +#endif + +#ifndef GL_ARB_occlusion_query2 +#define GL_ANY_SAMPLES_PASSED 0x8C2F +#endif + +#ifndef GL_ARB_sampler_objects +#define GL_SAMPLER_BINDING 0x8919 +#endif + +#ifndef GL_ARB_shader_bit_encoding +#endif + +#ifndef GL_ARB_texture_rgb10_a2ui +#define GL_RGB10_A2UI 0x906F +#endif + +#ifndef GL_ARB_texture_swizzle +#define GL_TEXTURE_SWIZZLE_R 0x8E42 +#define GL_TEXTURE_SWIZZLE_G 0x8E43 +#define GL_TEXTURE_SWIZZLE_B 0x8E44 +#define GL_TEXTURE_SWIZZLE_A 0x8E45 +#define GL_TEXTURE_SWIZZLE_RGBA 0x8E46 +#endif + +#ifndef GL_ARB_timer_query +#define GL_TIME_ELAPSED 0x88BF +#define GL_TIMESTAMP 0x8E28 +#endif + +#ifndef GL_ARB_vertex_type_2_10_10_10_rev +/* reuse GL_UNSIGNED_INT_2_10_10_10_REV */ +#define GL_INT_2_10_10_10_REV 0x8D9F +#endif + +#ifndef GL_ARB_draw_indirect +#define GL_DRAW_INDIRECT_BUFFER 0x8F3F +#define GL_DRAW_INDIRECT_BUFFER_BINDING 0x8F43 +#endif + +#ifndef GL_ARB_gpu_shader5 +#define GL_GEOMETRY_SHADER_INVOCATIONS 0x887F +#define GL_MAX_GEOMETRY_SHADER_INVOCATIONS 0x8E5A +#define GL_MIN_FRAGMENT_INTERPOLATION_OFFSET 0x8E5B +#define GL_MAX_FRAGMENT_INTERPOLATION_OFFSET 0x8E5C +#define GL_FRAGMENT_INTERPOLATION_OFFSET_BITS 0x8E5D +/* reuse GL_MAX_VERTEX_STREAMS */ +#endif + +#ifndef GL_ARB_gpu_shader_fp64 +/* reuse GL_DOUBLE */ +#define GL_DOUBLE_VEC2 0x8FFC +#define GL_DOUBLE_VEC3 0x8FFD +#define GL_DOUBLE_VEC4 0x8FFE +#define GL_DOUBLE_MAT2 0x8F46 +#define GL_DOUBLE_MAT3 0x8F47 +#define GL_DOUBLE_MAT4 0x8F48 +#define GL_DOUBLE_MAT2x3 0x8F49 +#define GL_DOUBLE_MAT2x4 0x8F4A +#define GL_DOUBLE_MAT3x2 0x8F4B +#define GL_DOUBLE_MAT3x4 0x8F4C +#define GL_DOUBLE_MAT4x2 0x8F4D +#define GL_DOUBLE_MAT4x3 0x8F4E +#endif + +#ifndef GL_ARB_shader_subroutine +#define GL_ACTIVE_SUBROUTINES 0x8DE5 +#define GL_ACTIVE_SUBROUTINE_UNIFORMS 0x8DE6 +#define GL_ACTIVE_SUBROUTINE_UNIFORM_LOCATIONS 0x8E47 +#define GL_ACTIVE_SUBROUTINE_MAX_LENGTH 0x8E48 +#define GL_ACTIVE_SUBROUTINE_UNIFORM_MAX_LENGTH 0x8E49 +#define GL_MAX_SUBROUTINES 0x8DE7 +#define GL_MAX_SUBROUTINE_UNIFORM_LOCATIONS 0x8DE8 +#define GL_NUM_COMPATIBLE_SUBROUTINES 0x8E4A +#define GL_COMPATIBLE_SUBROUTINES 0x8E4B +/* reuse GL_UNIFORM_SIZE */ +/* reuse GL_UNIFORM_NAME_LENGTH */ +#endif + +#ifndef GL_ARB_tessellation_shader +#define GL_PATCHES 0x000E +#define GL_PATCH_VERTICES 0x8E72 +#define GL_PATCH_DEFAULT_INNER_LEVEL 0x8E73 +#define GL_PATCH_DEFAULT_OUTER_LEVEL 0x8E74 +#define GL_TESS_CONTROL_OUTPUT_VERTICES 0x8E75 +#define GL_TESS_GEN_MODE 0x8E76 +#define GL_TESS_GEN_SPACING 0x8E77 +#define GL_TESS_GEN_VERTEX_ORDER 0x8E78 +#define GL_TESS_GEN_POINT_MODE 0x8E79 +/* reuse GL_TRIANGLES */ +/* reuse GL_QUADS */ +#define GL_ISOLINES 0x8E7A +/* reuse GL_EQUAL */ +#define GL_FRACTIONAL_ODD 0x8E7B +#define GL_FRACTIONAL_EVEN 0x8E7C +/* reuse GL_CCW */ +/* reuse GL_CW */ +#define GL_MAX_PATCH_VERTICES 0x8E7D +#define GL_MAX_TESS_GEN_LEVEL 0x8E7E +#define GL_MAX_TESS_CONTROL_UNIFORM_COMPONENTS 0x8E7F +#define GL_MAX_TESS_EVALUATION_UNIFORM_COMPONENTS 0x8E80 +#define GL_MAX_TESS_CONTROL_TEXTURE_IMAGE_UNITS 0x8E81 +#define GL_MAX_TESS_EVALUATION_TEXTURE_IMAGE_UNITS 0x8E82 +#define GL_MAX_TESS_CONTROL_OUTPUT_COMPONENTS 0x8E83 +#define GL_MAX_TESS_PATCH_COMPONENTS 0x8E84 +#define GL_MAX_TESS_CONTROL_TOTAL_OUTPUT_COMPONENTS 0x8E85 +#define GL_MAX_TESS_EVALUATION_OUTPUT_COMPONENTS 0x8E86 +#define GL_MAX_TESS_CONTROL_UNIFORM_BLOCKS 0x8E89 +#define GL_MAX_TESS_EVALUATION_UNIFORM_BLOCKS 0x8E8A +#define GL_MAX_TESS_CONTROL_INPUT_COMPONENTS 0x886C +#define GL_MAX_TESS_EVALUATION_INPUT_COMPONENTS 0x886D +#define GL_MAX_COMBINED_TESS_CONTROL_UNIFORM_COMPONENTS 0x8E1E +#define GL_MAX_COMBINED_TESS_EVALUATION_UNIFORM_COMPONENTS 0x8E1F +#define GL_UNIFORM_BLOCK_REFERENCED_BY_TESS_CONTROL_SHADER 0x84F0 +#define GL_UNIFORM_BLOCK_REFERENCED_BY_TESS_EVALUATION_SHADER 0x84F1 +#define GL_TESS_EVALUATION_SHADER 0x8E87 +#define GL_TESS_CONTROL_SHADER 0x8E88 +#endif + +#ifndef GL_ARB_texture_buffer_object_rgb32 +/* reuse GL_RGB32F */ +/* reuse GL_RGB32UI */ +/* reuse GL_RGB32I */ +#endif + +#ifndef GL_ARB_transform_feedback2 +#define GL_TRANSFORM_FEEDBACK 0x8E22 +#define GL_TRANSFORM_FEEDBACK_BUFFER_PAUSED 0x8E23 +#define GL_TRANSFORM_FEEDBACK_BUFFER_ACTIVE 0x8E24 +#define GL_TRANSFORM_FEEDBACK_BINDING 0x8E25 +#endif + +#ifndef GL_ARB_transform_feedback3 +#define GL_MAX_TRANSFORM_FEEDBACK_BUFFERS 0x8E70 +#define GL_MAX_VERTEX_STREAMS 0x8E71 +#endif + +#ifndef GL_ARB_ES2_compatibility +#define GL_FIXED 0x140C +#define GL_IMPLEMENTATION_COLOR_READ_TYPE 0x8B9A +#define GL_IMPLEMENTATION_COLOR_READ_FORMAT 0x8B9B +#define GL_LOW_FLOAT 0x8DF0 +#define GL_MEDIUM_FLOAT 0x8DF1 +#define GL_HIGH_FLOAT 0x8DF2 +#define GL_LOW_INT 0x8DF3 +#define GL_MEDIUM_INT 0x8DF4 +#define GL_HIGH_INT 0x8DF5 +#define GL_SHADER_COMPILER 0x8DFA +#define GL_NUM_SHADER_BINARY_FORMATS 0x8DF9 +#define GL_MAX_VERTEX_UNIFORM_VECTORS 0x8DFB +#define GL_MAX_VARYING_VECTORS 0x8DFC +#define GL_MAX_FRAGMENT_UNIFORM_VECTORS 0x8DFD +#endif + +#ifndef GL_ARB_get_program_binary +#define GL_PROGRAM_BINARY_RETRIEVABLE_HINT 0x8257 +#define GL_PROGRAM_BINARY_LENGTH 0x8741 +#define GL_NUM_PROGRAM_BINARY_FORMATS 0x87FE +#define GL_PROGRAM_BINARY_FORMATS 0x87FF +#endif + +#ifndef GL_ARB_separate_shader_objects +#define GL_VERTEX_SHADER_BIT 0x00000001 +#define GL_FRAGMENT_SHADER_BIT 0x00000002 +#define GL_GEOMETRY_SHADER_BIT 0x00000004 +#define GL_TESS_CONTROL_SHADER_BIT 0x00000008 +#define GL_TESS_EVALUATION_SHADER_BIT 0x00000010 +#define GL_ALL_SHADER_BITS 0xFFFFFFFF +#define GL_PROGRAM_SEPARABLE 0x8258 +#define GL_ACTIVE_PROGRAM 0x8259 +#define GL_PROGRAM_PIPELINE_BINDING 0x825A +#endif + +#ifndef GL_ARB_shader_precision +#endif + +#ifndef GL_ARB_vertex_attrib_64bit +/* reuse GL_RGB32I */ +/* reuse GL_DOUBLE_VEC2 */ +/* reuse GL_DOUBLE_VEC3 */ +/* reuse GL_DOUBLE_VEC4 */ +/* reuse GL_DOUBLE_MAT2 */ +/* reuse GL_DOUBLE_MAT3 */ +/* reuse GL_DOUBLE_MAT4 */ +/* reuse GL_DOUBLE_MAT2x3 */ +/* reuse GL_DOUBLE_MAT2x4 */ +/* reuse GL_DOUBLE_MAT3x2 */ +/* reuse GL_DOUBLE_MAT3x4 */ +/* reuse GL_DOUBLE_MAT4x2 */ +/* reuse GL_DOUBLE_MAT4x3 */ +#endif + +#ifndef GL_ARB_viewport_array +/* reuse GL_SCISSOR_BOX */ +/* reuse GL_VIEWPORT */ +/* reuse GL_DEPTH_RANGE */ +/* reuse GL_SCISSOR_TEST */ +#define GL_MAX_VIEWPORTS 0x825B +#define GL_VIEWPORT_SUBPIXEL_BITS 0x825C +#define GL_VIEWPORT_BOUNDS_RANGE 0x825D +#define GL_LAYER_PROVOKING_VERTEX 0x825E +#define GL_VIEWPORT_INDEX_PROVOKING_VERTEX 0x825F +#define GL_UNDEFINED_VERTEX 0x8260 +/* reuse GL_FIRST_VERTEX_CONVENTION */ +/* reuse GL_LAST_VERTEX_CONVENTION */ +/* reuse GL_PROVOKING_VERTEX */ +#endif + +#ifndef GL_ARB_cl_event +#define GL_SYNC_CL_EVENT_ARB 0x8240 +#define GL_SYNC_CL_EVENT_COMPLETE_ARB 0x8241 +#endif + +#ifndef GL_ARB_debug_output +#define GL_DEBUG_OUTPUT_SYNCHRONOUS_ARB 0x8242 +#define GL_DEBUG_NEXT_LOGGED_MESSAGE_LENGTH_ARB 0x8243 +#define GL_DEBUG_CALLBACK_FUNCTION_ARB 0x8244 +#define GL_DEBUG_CALLBACK_USER_PARAM_ARB 0x8245 +#define GL_DEBUG_SOURCE_API_ARB 0x8246 +#define GL_DEBUG_SOURCE_WINDOW_SYSTEM_ARB 0x8247 +#define GL_DEBUG_SOURCE_SHADER_COMPILER_ARB 0x8248 +#define GL_DEBUG_SOURCE_THIRD_PARTY_ARB 0x8249 +#define GL_DEBUG_SOURCE_APPLICATION_ARB 0x824A +#define GL_DEBUG_SOURCE_OTHER_ARB 0x824B +#define GL_DEBUG_TYPE_ERROR_ARB 0x824C +#define GL_DEBUG_TYPE_DEPRECATED_BEHAVIOR_ARB 0x824D +#define GL_DEBUG_TYPE_UNDEFINED_BEHAVIOR_ARB 0x824E +#define GL_DEBUG_TYPE_PORTABILITY_ARB 0x824F +#define GL_DEBUG_TYPE_PERFORMANCE_ARB 0x8250 +#define GL_DEBUG_TYPE_OTHER_ARB 0x8251 +#define GL_MAX_DEBUG_MESSAGE_LENGTH_ARB 0x9143 +#define GL_MAX_DEBUG_LOGGED_MESSAGES_ARB 0x9144 +#define GL_DEBUG_LOGGED_MESSAGES_ARB 0x9145 +#define GL_DEBUG_SEVERITY_HIGH_ARB 0x9146 +#define GL_DEBUG_SEVERITY_MEDIUM_ARB 0x9147 +#define GL_DEBUG_SEVERITY_LOW_ARB 0x9148 +#endif + +#ifndef GL_ARB_robustness +/* reuse GL_NO_ERROR */ +#define GL_CONTEXT_FLAG_ROBUST_ACCESS_BIT_ARB 0x00000004 +#define GL_LOSE_CONTEXT_ON_RESET_ARB 0x8252 +#define GL_GUILTY_CONTEXT_RESET_ARB 0x8253 +#define GL_INNOCENT_CONTEXT_RESET_ARB 0x8254 +#define GL_UNKNOWN_CONTEXT_RESET_ARB 0x8255 +#define GL_RESET_NOTIFICATION_STRATEGY_ARB 0x8256 +#define GL_NO_RESET_NOTIFICATION_ARB 0x8261 +#endif + +#ifndef GL_ARB_shader_stencil_export +#endif + +#ifndef GL_EXT_abgr +#define GL_ABGR_EXT 0x8000 +#endif + +#ifndef GL_EXT_blend_color +#define GL_CONSTANT_COLOR_EXT 0x8001 +#define GL_ONE_MINUS_CONSTANT_COLOR_EXT 0x8002 +#define GL_CONSTANT_ALPHA_EXT 0x8003 +#define GL_ONE_MINUS_CONSTANT_ALPHA_EXT 0x8004 +#define GL_BLEND_COLOR_EXT 0x8005 +#endif + +#ifndef GL_EXT_polygon_offset +#define GL_POLYGON_OFFSET_EXT 0x8037 +#define GL_POLYGON_OFFSET_FACTOR_EXT 0x8038 +#define GL_POLYGON_OFFSET_BIAS_EXT 0x8039 +#endif + +#ifndef GL_EXT_texture +#define GL_ALPHA4_EXT 0x803B +#define GL_ALPHA8_EXT 0x803C +#define GL_ALPHA12_EXT 0x803D +#define GL_ALPHA16_EXT 0x803E +#define GL_LUMINANCE4_EXT 0x803F +#define GL_LUMINANCE8_EXT 0x8040 +#define GL_LUMINANCE12_EXT 0x8041 +#define GL_LUMINANCE16_EXT 0x8042 +#define GL_LUMINANCE4_ALPHA4_EXT 0x8043 +#define GL_LUMINANCE6_ALPHA2_EXT 0x8044 +#define GL_LUMINANCE8_ALPHA8_EXT 0x8045 +#define GL_LUMINANCE12_ALPHA4_EXT 0x8046 +#define GL_LUMINANCE12_ALPHA12_EXT 0x8047 +#define GL_LUMINANCE16_ALPHA16_EXT 0x8048 +#define GL_INTENSITY_EXT 0x8049 +#define GL_INTENSITY4_EXT 0x804A +#define GL_INTENSITY8_EXT 0x804B +#define GL_INTENSITY12_EXT 0x804C +#define GL_INTENSITY16_EXT 0x804D +#define GL_RGB2_EXT 0x804E +#define GL_RGB4_EXT 0x804F +#define GL_RGB5_EXT 0x8050 +#define GL_RGB8_EXT 0x8051 +#define GL_RGB10_EXT 0x8052 +#define GL_RGB12_EXT 0x8053 +#define GL_RGB16_EXT 0x8054 +#define GL_RGBA2_EXT 0x8055 +#define GL_RGBA4_EXT 0x8056 +#define GL_RGB5_A1_EXT 0x8057 +#define GL_RGBA8_EXT 0x8058 +#define GL_RGB10_A2_EXT 0x8059 +#define GL_RGBA12_EXT 0x805A +#define GL_RGBA16_EXT 0x805B +#define GL_TEXTURE_RED_SIZE_EXT 0x805C +#define GL_TEXTURE_GREEN_SIZE_EXT 0x805D +#define GL_TEXTURE_BLUE_SIZE_EXT 0x805E +#define GL_TEXTURE_ALPHA_SIZE_EXT 0x805F +#define GL_TEXTURE_LUMINANCE_SIZE_EXT 0x8060 +#define GL_TEXTURE_INTENSITY_SIZE_EXT 0x8061 +#define GL_REPLACE_EXT 0x8062 +#define GL_PROXY_TEXTURE_1D_EXT 0x8063 +#define GL_PROXY_TEXTURE_2D_EXT 0x8064 +#define GL_TEXTURE_TOO_LARGE_EXT 0x8065 +#endif + +#ifndef GL_EXT_texture3D +#define GL_PACK_SKIP_IMAGES_EXT 0x806B +#define GL_PACK_IMAGE_HEIGHT_EXT 0x806C +#define GL_UNPACK_SKIP_IMAGES_EXT 0x806D +#define GL_UNPACK_IMAGE_HEIGHT_EXT 0x806E +#define GL_TEXTURE_3D_EXT 0x806F +#define GL_PROXY_TEXTURE_3D_EXT 0x8070 +#define GL_TEXTURE_DEPTH_EXT 0x8071 +#define GL_TEXTURE_WRAP_R_EXT 0x8072 +#define GL_MAX_3D_TEXTURE_SIZE_EXT 0x8073 +#endif + +#ifndef GL_SGIS_texture_filter4 +#define GL_FILTER4_SGIS 0x8146 +#define GL_TEXTURE_FILTER4_SIZE_SGIS 0x8147 +#endif + +#ifndef GL_EXT_subtexture +#endif + +#ifndef GL_EXT_copy_texture +#endif + +#ifndef GL_EXT_histogram +#define GL_HISTOGRAM_EXT 0x8024 +#define GL_PROXY_HISTOGRAM_EXT 0x8025 +#define GL_HISTOGRAM_WIDTH_EXT 0x8026 +#define GL_HISTOGRAM_FORMAT_EXT 0x8027 +#define GL_HISTOGRAM_RED_SIZE_EXT 0x8028 +#define GL_HISTOGRAM_GREEN_SIZE_EXT 0x8029 +#define GL_HISTOGRAM_BLUE_SIZE_EXT 0x802A +#define GL_HISTOGRAM_ALPHA_SIZE_EXT 0x802B +#define GL_HISTOGRAM_LUMINANCE_SIZE_EXT 0x802C +#define GL_HISTOGRAM_SINK_EXT 0x802D +#define GL_MINMAX_EXT 0x802E +#define GL_MINMAX_FORMAT_EXT 0x802F +#define GL_MINMAX_SINK_EXT 0x8030 +#define GL_TABLE_TOO_LARGE_EXT 0x8031 +#endif + +#ifndef GL_EXT_convolution +#define GL_CONVOLUTION_1D_EXT 0x8010 +#define GL_CONVOLUTION_2D_EXT 0x8011 +#define GL_SEPARABLE_2D_EXT 0x8012 +#define GL_CONVOLUTION_BORDER_MODE_EXT 0x8013 +#define GL_CONVOLUTION_FILTER_SCALE_EXT 0x8014 +#define GL_CONVOLUTION_FILTER_BIAS_EXT 0x8015 +#define GL_REDUCE_EXT 0x8016 +#define GL_CONVOLUTION_FORMAT_EXT 0x8017 +#define GL_CONVOLUTION_WIDTH_EXT 0x8018 +#define GL_CONVOLUTION_HEIGHT_EXT 0x8019 +#define GL_MAX_CONVOLUTION_WIDTH_EXT 0x801A +#define GL_MAX_CONVOLUTION_HEIGHT_EXT 0x801B +#define GL_POST_CONVOLUTION_RED_SCALE_EXT 0x801C +#define GL_POST_CONVOLUTION_GREEN_SCALE_EXT 0x801D +#define GL_POST_CONVOLUTION_BLUE_SCALE_EXT 0x801E +#define GL_POST_CONVOLUTION_ALPHA_SCALE_EXT 0x801F +#define GL_POST_CONVOLUTION_RED_BIAS_EXT 0x8020 +#define GL_POST_CONVOLUTION_GREEN_BIAS_EXT 0x8021 +#define GL_POST_CONVOLUTION_BLUE_BIAS_EXT 0x8022 +#define GL_POST_CONVOLUTION_ALPHA_BIAS_EXT 0x8023 +#endif + +#ifndef GL_SGI_color_matrix +#define GL_COLOR_MATRIX_SGI 0x80B1 +#define GL_COLOR_MATRIX_STACK_DEPTH_SGI 0x80B2 +#define GL_MAX_COLOR_MATRIX_STACK_DEPTH_SGI 0x80B3 +#define GL_POST_COLOR_MATRIX_RED_SCALE_SGI 0x80B4 +#define GL_POST_COLOR_MATRIX_GREEN_SCALE_SGI 0x80B5 +#define GL_POST_COLOR_MATRIX_BLUE_SCALE_SGI 0x80B6 +#define GL_POST_COLOR_MATRIX_ALPHA_SCALE_SGI 0x80B7 +#define GL_POST_COLOR_MATRIX_RED_BIAS_SGI 0x80B8 +#define GL_POST_COLOR_MATRIX_GREEN_BIAS_SGI 0x80B9 +#define GL_POST_COLOR_MATRIX_BLUE_BIAS_SGI 0x80BA +#define GL_POST_COLOR_MATRIX_ALPHA_BIAS_SGI 0x80BB +#endif + +#ifndef GL_SGI_color_table +#define GL_COLOR_TABLE_SGI 0x80D0 +#define GL_POST_CONVOLUTION_COLOR_TABLE_SGI 0x80D1 +#define GL_POST_COLOR_MATRIX_COLOR_TABLE_SGI 0x80D2 +#define GL_PROXY_COLOR_TABLE_SGI 0x80D3 +#define GL_PROXY_POST_CONVOLUTION_COLOR_TABLE_SGI 0x80D4 +#define GL_PROXY_POST_COLOR_MATRIX_COLOR_TABLE_SGI 0x80D5 +#define GL_COLOR_TABLE_SCALE_SGI 0x80D6 +#define GL_COLOR_TABLE_BIAS_SGI 0x80D7 +#define GL_COLOR_TABLE_FORMAT_SGI 0x80D8 +#define GL_COLOR_TABLE_WIDTH_SGI 0x80D9 +#define GL_COLOR_TABLE_RED_SIZE_SGI 0x80DA +#define GL_COLOR_TABLE_GREEN_SIZE_SGI 0x80DB +#define GL_COLOR_TABLE_BLUE_SIZE_SGI 0x80DC +#define GL_COLOR_TABLE_ALPHA_SIZE_SGI 0x80DD +#define GL_COLOR_TABLE_LUMINANCE_SIZE_SGI 0x80DE +#define GL_COLOR_TABLE_INTENSITY_SIZE_SGI 0x80DF +#endif + +#ifndef GL_SGIS_pixel_texture +#define GL_PIXEL_TEXTURE_SGIS 0x8353 +#define GL_PIXEL_FRAGMENT_RGB_SOURCE_SGIS 0x8354 +#define GL_PIXEL_FRAGMENT_ALPHA_SOURCE_SGIS 0x8355 +#define GL_PIXEL_GROUP_COLOR_SGIS 0x8356 +#endif + +#ifndef GL_SGIX_pixel_texture +#define GL_PIXEL_TEX_GEN_SGIX 0x8139 +#define GL_PIXEL_TEX_GEN_MODE_SGIX 0x832B +#endif + +#ifndef GL_SGIS_texture4D +#define GL_PACK_SKIP_VOLUMES_SGIS 0x8130 +#define GL_PACK_IMAGE_DEPTH_SGIS 0x8131 +#define GL_UNPACK_SKIP_VOLUMES_SGIS 0x8132 +#define GL_UNPACK_IMAGE_DEPTH_SGIS 0x8133 +#define GL_TEXTURE_4D_SGIS 0x8134 +#define GL_PROXY_TEXTURE_4D_SGIS 0x8135 +#define GL_TEXTURE_4DSIZE_SGIS 0x8136 +#define GL_TEXTURE_WRAP_Q_SGIS 0x8137 +#define GL_MAX_4D_TEXTURE_SIZE_SGIS 0x8138 +#define GL_TEXTURE_4D_BINDING_SGIS 0x814F +#endif + +#ifndef GL_SGI_texture_color_table +#define GL_TEXTURE_COLOR_TABLE_SGI 0x80BC +#define GL_PROXY_TEXTURE_COLOR_TABLE_SGI 0x80BD +#endif + +#ifndef GL_EXT_cmyka +#define GL_CMYK_EXT 0x800C +#define GL_CMYKA_EXT 0x800D +#define GL_PACK_CMYK_HINT_EXT 0x800E +#define GL_UNPACK_CMYK_HINT_EXT 0x800F +#endif + +#ifndef GL_EXT_texture_object +#define GL_TEXTURE_PRIORITY_EXT 0x8066 +#define GL_TEXTURE_RESIDENT_EXT 0x8067 +#define GL_TEXTURE_1D_BINDING_EXT 0x8068 +#define GL_TEXTURE_2D_BINDING_EXT 0x8069 +#define GL_TEXTURE_3D_BINDING_EXT 0x806A +#endif + +#ifndef GL_SGIS_detail_texture +#define GL_DETAIL_TEXTURE_2D_SGIS 0x8095 +#define GL_DETAIL_TEXTURE_2D_BINDING_SGIS 0x8096 +#define GL_LINEAR_DETAIL_SGIS 0x8097 +#define GL_LINEAR_DETAIL_ALPHA_SGIS 0x8098 +#define GL_LINEAR_DETAIL_COLOR_SGIS 0x8099 +#define GL_DETAIL_TEXTURE_LEVEL_SGIS 0x809A +#define GL_DETAIL_TEXTURE_MODE_SGIS 0x809B +#define GL_DETAIL_TEXTURE_FUNC_POINTS_SGIS 0x809C +#endif + +#ifndef GL_SGIS_sharpen_texture +#define GL_LINEAR_SHARPEN_SGIS 0x80AD +#define GL_LINEAR_SHARPEN_ALPHA_SGIS 0x80AE +#define GL_LINEAR_SHARPEN_COLOR_SGIS 0x80AF +#define GL_SHARPEN_TEXTURE_FUNC_POINTS_SGIS 0x80B0 +#endif + +#ifndef GL_EXT_packed_pixels +#define GL_UNSIGNED_BYTE_3_3_2_EXT 0x8032 +#define GL_UNSIGNED_SHORT_4_4_4_4_EXT 0x8033 +#define GL_UNSIGNED_SHORT_5_5_5_1_EXT 0x8034 +#define GL_UNSIGNED_INT_8_8_8_8_EXT 0x8035 +#define GL_UNSIGNED_INT_10_10_10_2_EXT 0x8036 +#endif + +#ifndef GL_SGIS_texture_lod +#define GL_TEXTURE_MIN_LOD_SGIS 0x813A +#define GL_TEXTURE_MAX_LOD_SGIS 0x813B +#define GL_TEXTURE_BASE_LEVEL_SGIS 0x813C +#define GL_TEXTURE_MAX_LEVEL_SGIS 0x813D +#endif + +#ifndef GL_SGIS_multisample +#define GL_MULTISAMPLE_SGIS 0x809D +#define GL_SAMPLE_ALPHA_TO_MASK_SGIS 0x809E +#define GL_SAMPLE_ALPHA_TO_ONE_SGIS 0x809F +#define GL_SAMPLE_MASK_SGIS 0x80A0 +#define GL_1PASS_SGIS 0x80A1 +#define GL_2PASS_0_SGIS 0x80A2 +#define GL_2PASS_1_SGIS 0x80A3 +#define GL_4PASS_0_SGIS 0x80A4 +#define GL_4PASS_1_SGIS 0x80A5 +#define GL_4PASS_2_SGIS 0x80A6 +#define GL_4PASS_3_SGIS 0x80A7 +#define GL_SAMPLE_BUFFERS_SGIS 0x80A8 +#define GL_SAMPLES_SGIS 0x80A9 +#define GL_SAMPLE_MASK_VALUE_SGIS 0x80AA +#define GL_SAMPLE_MASK_INVERT_SGIS 0x80AB +#define GL_SAMPLE_PATTERN_SGIS 0x80AC +#endif + +#ifndef GL_EXT_rescale_normal +#define GL_RESCALE_NORMAL_EXT 0x803A +#endif + +#ifndef GL_EXT_vertex_array +#define GL_VERTEX_ARRAY_EXT 0x8074 +#define GL_NORMAL_ARRAY_EXT 0x8075 +#define GL_COLOR_ARRAY_EXT 0x8076 +#define GL_INDEX_ARRAY_EXT 0x8077 +#define GL_TEXTURE_COORD_ARRAY_EXT 0x8078 +#define GL_EDGE_FLAG_ARRAY_EXT 0x8079 +#define GL_VERTEX_ARRAY_SIZE_EXT 0x807A +#define GL_VERTEX_ARRAY_TYPE_EXT 0x807B +#define GL_VERTEX_ARRAY_STRIDE_EXT 0x807C +#define GL_VERTEX_ARRAY_COUNT_EXT 0x807D +#define GL_NORMAL_ARRAY_TYPE_EXT 0x807E +#define GL_NORMAL_ARRAY_STRIDE_EXT 0x807F +#define GL_NORMAL_ARRAY_COUNT_EXT 0x8080 +#define GL_COLOR_ARRAY_SIZE_EXT 0x8081 +#define GL_COLOR_ARRAY_TYPE_EXT 0x8082 +#define GL_COLOR_ARRAY_STRIDE_EXT 0x8083 +#define GL_COLOR_ARRAY_COUNT_EXT 0x8084 +#define GL_INDEX_ARRAY_TYPE_EXT 0x8085 +#define GL_INDEX_ARRAY_STRIDE_EXT 0x8086 +#define GL_INDEX_ARRAY_COUNT_EXT 0x8087 +#define GL_TEXTURE_COORD_ARRAY_SIZE_EXT 0x8088 +#define GL_TEXTURE_COORD_ARRAY_TYPE_EXT 0x8089 +#define GL_TEXTURE_COORD_ARRAY_STRIDE_EXT 0x808A +#define GL_TEXTURE_COORD_ARRAY_COUNT_EXT 0x808B +#define GL_EDGE_FLAG_ARRAY_STRIDE_EXT 0x808C +#define GL_EDGE_FLAG_ARRAY_COUNT_EXT 0x808D +#define GL_VERTEX_ARRAY_POINTER_EXT 0x808E +#define GL_NORMAL_ARRAY_POINTER_EXT 0x808F +#define GL_COLOR_ARRAY_POINTER_EXT 0x8090 +#define GL_INDEX_ARRAY_POINTER_EXT 0x8091 +#define GL_TEXTURE_COORD_ARRAY_POINTER_EXT 0x8092 +#define GL_EDGE_FLAG_ARRAY_POINTER_EXT 0x8093 +#endif + +#ifndef GL_EXT_misc_attribute +#endif + +#ifndef GL_SGIS_generate_mipmap +#define GL_GENERATE_MIPMAP_SGIS 0x8191 +#define GL_GENERATE_MIPMAP_HINT_SGIS 0x8192 +#endif + +#ifndef GL_SGIX_clipmap +#define GL_LINEAR_CLIPMAP_LINEAR_SGIX 0x8170 +#define GL_TEXTURE_CLIPMAP_CENTER_SGIX 0x8171 +#define GL_TEXTURE_CLIPMAP_FRAME_SGIX 0x8172 +#define GL_TEXTURE_CLIPMAP_OFFSET_SGIX 0x8173 +#define GL_TEXTURE_CLIPMAP_VIRTUAL_DEPTH_SGIX 0x8174 +#define GL_TEXTURE_CLIPMAP_LOD_OFFSET_SGIX 0x8175 +#define GL_TEXTURE_CLIPMAP_DEPTH_SGIX 0x8176 +#define GL_MAX_CLIPMAP_DEPTH_SGIX 0x8177 +#define GL_MAX_CLIPMAP_VIRTUAL_DEPTH_SGIX 0x8178 +#define GL_NEAREST_CLIPMAP_NEAREST_SGIX 0x844D +#define GL_NEAREST_CLIPMAP_LINEAR_SGIX 0x844E +#define GL_LINEAR_CLIPMAP_NEAREST_SGIX 0x844F +#endif + +#ifndef GL_SGIX_shadow +#define GL_TEXTURE_COMPARE_SGIX 0x819A +#define GL_TEXTURE_COMPARE_OPERATOR_SGIX 0x819B +#define GL_TEXTURE_LEQUAL_R_SGIX 0x819C +#define GL_TEXTURE_GEQUAL_R_SGIX 0x819D +#endif + +#ifndef GL_SGIS_texture_edge_clamp +#define GL_CLAMP_TO_EDGE_SGIS 0x812F +#endif + +#ifndef GL_SGIS_texture_border_clamp +#define GL_CLAMP_TO_BORDER_SGIS 0x812D +#endif + +#ifndef GL_EXT_blend_minmax +#define GL_FUNC_ADD_EXT 0x8006 +#define GL_MIN_EXT 0x8007 +#define GL_MAX_EXT 0x8008 +#define GL_BLEND_EQUATION_EXT 0x8009 +#endif + +#ifndef GL_EXT_blend_subtract +#define GL_FUNC_SUBTRACT_EXT 0x800A +#define GL_FUNC_REVERSE_SUBTRACT_EXT 0x800B +#endif + +#ifndef GL_EXT_blend_logic_op +#endif + +#ifndef GL_SGIX_interlace +#define GL_INTERLACE_SGIX 0x8094 +#endif + +#ifndef GL_SGIX_pixel_tiles +#define GL_PIXEL_TILE_BEST_ALIGNMENT_SGIX 0x813E +#define GL_PIXEL_TILE_CACHE_INCREMENT_SGIX 0x813F +#define GL_PIXEL_TILE_WIDTH_SGIX 0x8140 +#define GL_PIXEL_TILE_HEIGHT_SGIX 0x8141 +#define GL_PIXEL_TILE_GRID_WIDTH_SGIX 0x8142 +#define GL_PIXEL_TILE_GRID_HEIGHT_SGIX 0x8143 +#define GL_PIXEL_TILE_GRID_DEPTH_SGIX 0x8144 +#define GL_PIXEL_TILE_CACHE_SIZE_SGIX 0x8145 +#endif + +#ifndef GL_SGIS_texture_select +#define GL_DUAL_ALPHA4_SGIS 0x8110 +#define GL_DUAL_ALPHA8_SGIS 0x8111 +#define GL_DUAL_ALPHA12_SGIS 0x8112 +#define GL_DUAL_ALPHA16_SGIS 0x8113 +#define GL_DUAL_LUMINANCE4_SGIS 0x8114 +#define GL_DUAL_LUMINANCE8_SGIS 0x8115 +#define GL_DUAL_LUMINANCE12_SGIS 0x8116 +#define GL_DUAL_LUMINANCE16_SGIS 0x8117 +#define GL_DUAL_INTENSITY4_SGIS 0x8118 +#define GL_DUAL_INTENSITY8_SGIS 0x8119 +#define GL_DUAL_INTENSITY12_SGIS 0x811A +#define GL_DUAL_INTENSITY16_SGIS 0x811B +#define GL_DUAL_LUMINANCE_ALPHA4_SGIS 0x811C +#define GL_DUAL_LUMINANCE_ALPHA8_SGIS 0x811D +#define GL_QUAD_ALPHA4_SGIS 0x811E +#define GL_QUAD_ALPHA8_SGIS 0x811F +#define GL_QUAD_LUMINANCE4_SGIS 0x8120 +#define GL_QUAD_LUMINANCE8_SGIS 0x8121 +#define GL_QUAD_INTENSITY4_SGIS 0x8122 +#define GL_QUAD_INTENSITY8_SGIS 0x8123 +#define GL_DUAL_TEXTURE_SELECT_SGIS 0x8124 +#define GL_QUAD_TEXTURE_SELECT_SGIS 0x8125 +#endif + +#ifndef GL_SGIX_sprite +#define GL_SPRITE_SGIX 0x8148 +#define GL_SPRITE_MODE_SGIX 0x8149 +#define GL_SPRITE_AXIS_SGIX 0x814A +#define GL_SPRITE_TRANSLATION_SGIX 0x814B +#define GL_SPRITE_AXIAL_SGIX 0x814C +#define GL_SPRITE_OBJECT_ALIGNED_SGIX 0x814D +#define GL_SPRITE_EYE_ALIGNED_SGIX 0x814E +#endif + +#ifndef GL_SGIX_texture_multi_buffer +#define GL_TEXTURE_MULTI_BUFFER_HINT_SGIX 0x812E +#endif + +#ifndef GL_EXT_point_parameters +#define GL_POINT_SIZE_MIN_EXT 0x8126 +#define GL_POINT_SIZE_MAX_EXT 0x8127 +#define GL_POINT_FADE_THRESHOLD_SIZE_EXT 0x8128 +#define GL_DISTANCE_ATTENUATION_EXT 0x8129 +#endif + +#ifndef GL_SGIS_point_parameters +#define GL_POINT_SIZE_MIN_SGIS 0x8126 +#define GL_POINT_SIZE_MAX_SGIS 0x8127 +#define GL_POINT_FADE_THRESHOLD_SIZE_SGIS 0x8128 +#define GL_DISTANCE_ATTENUATION_SGIS 0x8129 +#endif + +#ifndef GL_SGIX_instruments +#define GL_INSTRUMENT_BUFFER_POINTER_SGIX 0x8180 +#define GL_INSTRUMENT_MEASUREMENTS_SGIX 0x8181 +#endif + +#ifndef GL_SGIX_texture_scale_bias +#define GL_POST_TEXTURE_FILTER_BIAS_SGIX 0x8179 +#define GL_POST_TEXTURE_FILTER_SCALE_SGIX 0x817A +#define GL_POST_TEXTURE_FILTER_BIAS_RANGE_SGIX 0x817B +#define GL_POST_TEXTURE_FILTER_SCALE_RANGE_SGIX 0x817C +#endif + +#ifndef GL_SGIX_framezoom +#define GL_FRAMEZOOM_SGIX 0x818B +#define GL_FRAMEZOOM_FACTOR_SGIX 0x818C +#define GL_MAX_FRAMEZOOM_FACTOR_SGIX 0x818D +#endif + +#ifndef GL_SGIX_tag_sample_buffer +#endif + +#ifndef GL_FfdMaskSGIX +#define GL_TEXTURE_DEFORMATION_BIT_SGIX 0x00000001 +#define GL_GEOMETRY_DEFORMATION_BIT_SGIX 0x00000002 +#endif + +#ifndef GL_SGIX_polynomial_ffd +#define GL_GEOMETRY_DEFORMATION_SGIX 0x8194 +#define GL_TEXTURE_DEFORMATION_SGIX 0x8195 +#define GL_DEFORMATIONS_MASK_SGIX 0x8196 +#define GL_MAX_DEFORMATION_ORDER_SGIX 0x8197 +#endif + +#ifndef GL_SGIX_reference_plane +#define GL_REFERENCE_PLANE_SGIX 0x817D +#define GL_REFERENCE_PLANE_EQUATION_SGIX 0x817E +#endif + +#ifndef GL_SGIX_flush_raster +#endif + +#ifndef GL_SGIX_depth_texture +#define GL_DEPTH_COMPONENT16_SGIX 0x81A5 +#define GL_DEPTH_COMPONENT24_SGIX 0x81A6 +#define GL_DEPTH_COMPONENT32_SGIX 0x81A7 +#endif + +#ifndef GL_SGIS_fog_function +#define GL_FOG_FUNC_SGIS 0x812A +#define GL_FOG_FUNC_POINTS_SGIS 0x812B +#define GL_MAX_FOG_FUNC_POINTS_SGIS 0x812C +#endif + +#ifndef GL_SGIX_fog_offset +#define GL_FOG_OFFSET_SGIX 0x8198 +#define GL_FOG_OFFSET_VALUE_SGIX 0x8199 +#endif + +#ifndef GL_HP_image_transform +#define GL_IMAGE_SCALE_X_HP 0x8155 +#define GL_IMAGE_SCALE_Y_HP 0x8156 +#define GL_IMAGE_TRANSLATE_X_HP 0x8157 +#define GL_IMAGE_TRANSLATE_Y_HP 0x8158 +#define GL_IMAGE_ROTATE_ANGLE_HP 0x8159 +#define GL_IMAGE_ROTATE_ORIGIN_X_HP 0x815A +#define GL_IMAGE_ROTATE_ORIGIN_Y_HP 0x815B +#define GL_IMAGE_MAG_FILTER_HP 0x815C +#define GL_IMAGE_MIN_FILTER_HP 0x815D +#define GL_IMAGE_CUBIC_WEIGHT_HP 0x815E +#define GL_CUBIC_HP 0x815F +#define GL_AVERAGE_HP 0x8160 +#define GL_IMAGE_TRANSFORM_2D_HP 0x8161 +#define GL_POST_IMAGE_TRANSFORM_COLOR_TABLE_HP 0x8162 +#define GL_PROXY_POST_IMAGE_TRANSFORM_COLOR_TABLE_HP 0x8163 +#endif + +#ifndef GL_HP_convolution_border_modes +#define GL_IGNORE_BORDER_HP 0x8150 +#define GL_CONSTANT_BORDER_HP 0x8151 +#define GL_REPLICATE_BORDER_HP 0x8153 +#define GL_CONVOLUTION_BORDER_COLOR_HP 0x8154 +#endif + +#ifndef GL_INGR_palette_buffer +#endif + +#ifndef GL_SGIX_texture_add_env +#define GL_TEXTURE_ENV_BIAS_SGIX 0x80BE +#endif + +#ifndef GL_EXT_color_subtable +#endif + +#ifndef GL_PGI_vertex_hints +#define GL_VERTEX_DATA_HINT_PGI 0x1A22A +#define GL_VERTEX_CONSISTENT_HINT_PGI 0x1A22B +#define GL_MATERIAL_SIDE_HINT_PGI 0x1A22C +#define GL_MAX_VERTEX_HINT_PGI 0x1A22D +#define GL_COLOR3_BIT_PGI 0x00010000 +#define GL_COLOR4_BIT_PGI 0x00020000 +#define GL_EDGEFLAG_BIT_PGI 0x00040000 +#define GL_INDEX_BIT_PGI 0x00080000 +#define GL_MAT_AMBIENT_BIT_PGI 0x00100000 +#define GL_MAT_AMBIENT_AND_DIFFUSE_BIT_PGI 0x00200000 +#define GL_MAT_DIFFUSE_BIT_PGI 0x00400000 +#define GL_MAT_EMISSION_BIT_PGI 0x00800000 +#define GL_MAT_COLOR_INDEXES_BIT_PGI 0x01000000 +#define GL_MAT_SHININESS_BIT_PGI 0x02000000 +#define GL_MAT_SPECULAR_BIT_PGI 0x04000000 +#define GL_NORMAL_BIT_PGI 0x08000000 +#define GL_TEXCOORD1_BIT_PGI 0x10000000 +#define GL_TEXCOORD2_BIT_PGI 0x20000000 +#define GL_TEXCOORD3_BIT_PGI 0x40000000 +#define GL_TEXCOORD4_BIT_PGI 0x80000000 +#define GL_VERTEX23_BIT_PGI 0x00000004 +#define GL_VERTEX4_BIT_PGI 0x00000008 +#endif + +#ifndef GL_PGI_misc_hints +#define GL_PREFER_DOUBLEBUFFER_HINT_PGI 0x1A1F8 +#define GL_CONSERVE_MEMORY_HINT_PGI 0x1A1FD +#define GL_RECLAIM_MEMORY_HINT_PGI 0x1A1FE +#define GL_NATIVE_GRAPHICS_HANDLE_PGI 0x1A202 +#define GL_NATIVE_GRAPHICS_BEGIN_HINT_PGI 0x1A203 +#define GL_NATIVE_GRAPHICS_END_HINT_PGI 0x1A204 +#define GL_ALWAYS_FAST_HINT_PGI 0x1A20C +#define GL_ALWAYS_SOFT_HINT_PGI 0x1A20D +#define GL_ALLOW_DRAW_OBJ_HINT_PGI 0x1A20E +#define GL_ALLOW_DRAW_WIN_HINT_PGI 0x1A20F +#define GL_ALLOW_DRAW_FRG_HINT_PGI 0x1A210 +#define GL_ALLOW_DRAW_MEM_HINT_PGI 0x1A211 +#define GL_STRICT_DEPTHFUNC_HINT_PGI 0x1A216 +#define GL_STRICT_LIGHTING_HINT_PGI 0x1A217 +#define GL_STRICT_SCISSOR_HINT_PGI 0x1A218 +#define GL_FULL_STIPPLE_HINT_PGI 0x1A219 +#define GL_CLIP_NEAR_HINT_PGI 0x1A220 +#define GL_CLIP_FAR_HINT_PGI 0x1A221 +#define GL_WIDE_LINE_HINT_PGI 0x1A222 +#define GL_BACK_NORMALS_HINT_PGI 0x1A223 +#endif + +#ifndef GL_EXT_paletted_texture +#define GL_COLOR_INDEX1_EXT 0x80E2 +#define GL_COLOR_INDEX2_EXT 0x80E3 +#define GL_COLOR_INDEX4_EXT 0x80E4 +#define GL_COLOR_INDEX8_EXT 0x80E5 +#define GL_COLOR_INDEX12_EXT 0x80E6 +#define GL_COLOR_INDEX16_EXT 0x80E7 +#define GL_TEXTURE_INDEX_SIZE_EXT 0x80ED +#endif + +#ifndef GL_EXT_clip_volume_hint +#define GL_CLIP_VOLUME_CLIPPING_HINT_EXT 0x80F0 +#endif + +#ifndef GL_SGIX_list_priority +#define GL_LIST_PRIORITY_SGIX 0x8182 +#endif + +#ifndef GL_SGIX_ir_instrument1 +#define GL_IR_INSTRUMENT1_SGIX 0x817F +#endif + +#ifndef GL_SGIX_calligraphic_fragment +#define GL_CALLIGRAPHIC_FRAGMENT_SGIX 0x8183 +#endif + +#ifndef GL_SGIX_texture_lod_bias +#define GL_TEXTURE_LOD_BIAS_S_SGIX 0x818E +#define GL_TEXTURE_LOD_BIAS_T_SGIX 0x818F +#define GL_TEXTURE_LOD_BIAS_R_SGIX 0x8190 +#endif + +#ifndef GL_SGIX_shadow_ambient +#define GL_SHADOW_AMBIENT_SGIX 0x80BF +#endif + +#ifndef GL_EXT_index_texture +#endif + +#ifndef GL_EXT_index_material +#define GL_INDEX_MATERIAL_EXT 0x81B8 +#define GL_INDEX_MATERIAL_PARAMETER_EXT 0x81B9 +#define GL_INDEX_MATERIAL_FACE_EXT 0x81BA +#endif + +#ifndef GL_EXT_index_func +#define GL_INDEX_TEST_EXT 0x81B5 +#define GL_INDEX_TEST_FUNC_EXT 0x81B6 +#define GL_INDEX_TEST_REF_EXT 0x81B7 +#endif + +#ifndef GL_EXT_index_array_formats +#define GL_IUI_V2F_EXT 0x81AD +#define GL_IUI_V3F_EXT 0x81AE +#define GL_IUI_N3F_V2F_EXT 0x81AF +#define GL_IUI_N3F_V3F_EXT 0x81B0 +#define GL_T2F_IUI_V2F_EXT 0x81B1 +#define GL_T2F_IUI_V3F_EXT 0x81B2 +#define GL_T2F_IUI_N3F_V2F_EXT 0x81B3 +#define GL_T2F_IUI_N3F_V3F_EXT 0x81B4 +#endif + +#ifndef GL_EXT_compiled_vertex_array +#define GL_ARRAY_ELEMENT_LOCK_FIRST_EXT 0x81A8 +#define GL_ARRAY_ELEMENT_LOCK_COUNT_EXT 0x81A9 +#endif + +#ifndef GL_EXT_cull_vertex +#define GL_CULL_VERTEX_EXT 0x81AA +#define GL_CULL_VERTEX_EYE_POSITION_EXT 0x81AB +#define GL_CULL_VERTEX_OBJECT_POSITION_EXT 0x81AC +#endif + +#ifndef GL_SGIX_ycrcb +#define GL_YCRCB_422_SGIX 0x81BB +#define GL_YCRCB_444_SGIX 0x81BC +#endif + +#ifndef GL_SGIX_fragment_lighting +#define GL_FRAGMENT_LIGHTING_SGIX 0x8400 +#define GL_FRAGMENT_COLOR_MATERIAL_SGIX 0x8401 +#define GL_FRAGMENT_COLOR_MATERIAL_FACE_SGIX 0x8402 +#define GL_FRAGMENT_COLOR_MATERIAL_PARAMETER_SGIX 0x8403 +#define GL_MAX_FRAGMENT_LIGHTS_SGIX 0x8404 +#define GL_MAX_ACTIVE_LIGHTS_SGIX 0x8405 +#define GL_CURRENT_RASTER_NORMAL_SGIX 0x8406 +#define GL_LIGHT_ENV_MODE_SGIX 0x8407 +#define GL_FRAGMENT_LIGHT_MODEL_LOCAL_VIEWER_SGIX 0x8408 +#define GL_FRAGMENT_LIGHT_MODEL_TWO_SIDE_SGIX 0x8409 +#define GL_FRAGMENT_LIGHT_MODEL_AMBIENT_SGIX 0x840A +#define GL_FRAGMENT_LIGHT_MODEL_NORMAL_INTERPOLATION_SGIX 0x840B +#define GL_FRAGMENT_LIGHT0_SGIX 0x840C +#define GL_FRAGMENT_LIGHT1_SGIX 0x840D +#define GL_FRAGMENT_LIGHT2_SGIX 0x840E +#define GL_FRAGMENT_LIGHT3_SGIX 0x840F +#define GL_FRAGMENT_LIGHT4_SGIX 0x8410 +#define GL_FRAGMENT_LIGHT5_SGIX 0x8411 +#define GL_FRAGMENT_LIGHT6_SGIX 0x8412 +#define GL_FRAGMENT_LIGHT7_SGIX 0x8413 +#endif + +#ifndef GL_IBM_rasterpos_clip +#define GL_RASTER_POSITION_UNCLIPPED_IBM 0x19262 +#endif + +#ifndef GL_HP_texture_lighting +#define GL_TEXTURE_LIGHTING_MODE_HP 0x8167 +#define GL_TEXTURE_POST_SPECULAR_HP 0x8168 +#define GL_TEXTURE_PRE_SPECULAR_HP 0x8169 +#endif + +#ifndef GL_EXT_draw_range_elements +#define GL_MAX_ELEMENTS_VERTICES_EXT 0x80E8 +#define GL_MAX_ELEMENTS_INDICES_EXT 0x80E9 +#endif + +#ifndef GL_WIN_phong_shading +#define GL_PHONG_WIN 0x80EA +#define GL_PHONG_HINT_WIN 0x80EB +#endif + +#ifndef GL_WIN_specular_fog +#define GL_FOG_SPECULAR_TEXTURE_WIN 0x80EC +#endif + +#ifndef GL_EXT_light_texture +#define GL_FRAGMENT_MATERIAL_EXT 0x8349 +#define GL_FRAGMENT_NORMAL_EXT 0x834A +#define GL_FRAGMENT_COLOR_EXT 0x834C +#define GL_ATTENUATION_EXT 0x834D +#define GL_SHADOW_ATTENUATION_EXT 0x834E +#define GL_TEXTURE_APPLICATION_MODE_EXT 0x834F +#define GL_TEXTURE_LIGHT_EXT 0x8350 +#define GL_TEXTURE_MATERIAL_FACE_EXT 0x8351 +#define GL_TEXTURE_MATERIAL_PARAMETER_EXT 0x8352 +/* reuse GL_FRAGMENT_DEPTH_EXT */ +#endif + +#ifndef GL_SGIX_blend_alpha_minmax +#define GL_ALPHA_MIN_SGIX 0x8320 +#define GL_ALPHA_MAX_SGIX 0x8321 +#endif + +#ifndef GL_SGIX_impact_pixel_texture +#define GL_PIXEL_TEX_GEN_Q_CEILING_SGIX 0x8184 +#define GL_PIXEL_TEX_GEN_Q_ROUND_SGIX 0x8185 +#define GL_PIXEL_TEX_GEN_Q_FLOOR_SGIX 0x8186 +#define GL_PIXEL_TEX_GEN_ALPHA_REPLACE_SGIX 0x8187 +#define GL_PIXEL_TEX_GEN_ALPHA_NO_REPLACE_SGIX 0x8188 +#define GL_PIXEL_TEX_GEN_ALPHA_LS_SGIX 0x8189 +#define GL_PIXEL_TEX_GEN_ALPHA_MS_SGIX 0x818A +#endif + +#ifndef GL_EXT_bgra +#define GL_BGR_EXT 0x80E0 +#define GL_BGRA_EXT 0x80E1 +#endif + +#ifndef GL_SGIX_async +#define GL_ASYNC_MARKER_SGIX 0x8329 +#endif + +#ifndef GL_SGIX_async_pixel +#define GL_ASYNC_TEX_IMAGE_SGIX 0x835C +#define GL_ASYNC_DRAW_PIXELS_SGIX 0x835D +#define GL_ASYNC_READ_PIXELS_SGIX 0x835E +#define GL_MAX_ASYNC_TEX_IMAGE_SGIX 0x835F +#define GL_MAX_ASYNC_DRAW_PIXELS_SGIX 0x8360 +#define GL_MAX_ASYNC_READ_PIXELS_SGIX 0x8361 +#endif + +#ifndef GL_SGIX_async_histogram +#define GL_ASYNC_HISTOGRAM_SGIX 0x832C +#define GL_MAX_ASYNC_HISTOGRAM_SGIX 0x832D +#endif + +#ifndef GL_INTEL_texture_scissor +#endif + +#ifndef GL_INTEL_parallel_arrays +#define GL_PARALLEL_ARRAYS_INTEL 0x83F4 +#define GL_VERTEX_ARRAY_PARALLEL_POINTERS_INTEL 0x83F5 +#define GL_NORMAL_ARRAY_PARALLEL_POINTERS_INTEL 0x83F6 +#define GL_COLOR_ARRAY_PARALLEL_POINTERS_INTEL 0x83F7 +#define GL_TEXTURE_COORD_ARRAY_PARALLEL_POINTERS_INTEL 0x83F8 +#endif + +#ifndef GL_HP_occlusion_test +#define GL_OCCLUSION_TEST_HP 0x8165 +#define GL_OCCLUSION_TEST_RESULT_HP 0x8166 +#endif + +#ifndef GL_EXT_pixel_transform +#define GL_PIXEL_TRANSFORM_2D_EXT 0x8330 +#define GL_PIXEL_MAG_FILTER_EXT 0x8331 +#define GL_PIXEL_MIN_FILTER_EXT 0x8332 +#define GL_PIXEL_CUBIC_WEIGHT_EXT 0x8333 +#define GL_CUBIC_EXT 0x8334 +#define GL_AVERAGE_EXT 0x8335 +#define GL_PIXEL_TRANSFORM_2D_STACK_DEPTH_EXT 0x8336 +#define GL_MAX_PIXEL_TRANSFORM_2D_STACK_DEPTH_EXT 0x8337 +#define GL_PIXEL_TRANSFORM_2D_MATRIX_EXT 0x8338 +#endif + +#ifndef GL_EXT_pixel_transform_color_table +#endif + +#ifndef GL_EXT_shared_texture_palette +#define GL_SHARED_TEXTURE_PALETTE_EXT 0x81FB +#endif + +#ifndef GL_EXT_separate_specular_color +#define GL_LIGHT_MODEL_COLOR_CONTROL_EXT 0x81F8 +#define GL_SINGLE_COLOR_EXT 0x81F9 +#define GL_SEPARATE_SPECULAR_COLOR_EXT 0x81FA +#endif + +#ifndef GL_EXT_secondary_color +#define GL_COLOR_SUM_EXT 0x8458 +#define GL_CURRENT_SECONDARY_COLOR_EXT 0x8459 +#define GL_SECONDARY_COLOR_ARRAY_SIZE_EXT 0x845A +#define GL_SECONDARY_COLOR_ARRAY_TYPE_EXT 0x845B +#define GL_SECONDARY_COLOR_ARRAY_STRIDE_EXT 0x845C +#define GL_SECONDARY_COLOR_ARRAY_POINTER_EXT 0x845D +#define GL_SECONDARY_COLOR_ARRAY_EXT 0x845E +#endif + +#ifndef GL_EXT_texture_perturb_normal +#define GL_PERTURB_EXT 0x85AE +#define GL_TEXTURE_NORMAL_EXT 0x85AF +#endif + +#ifndef GL_EXT_multi_draw_arrays +#endif + +#ifndef GL_EXT_fog_coord +#define GL_FOG_COORDINATE_SOURCE_EXT 0x8450 +#define GL_FOG_COORDINATE_EXT 0x8451 +#define GL_FRAGMENT_DEPTH_EXT 0x8452 +#define GL_CURRENT_FOG_COORDINATE_EXT 0x8453 +#define GL_FOG_COORDINATE_ARRAY_TYPE_EXT 0x8454 +#define GL_FOG_COORDINATE_ARRAY_STRIDE_EXT 0x8455 +#define GL_FOG_COORDINATE_ARRAY_POINTER_EXT 0x8456 +#define GL_FOG_COORDINATE_ARRAY_EXT 0x8457 +#endif + +#ifndef GL_REND_screen_coordinates +#define GL_SCREEN_COORDINATES_REND 0x8490 +#define GL_INVERTED_SCREEN_W_REND 0x8491 +#endif + +#ifndef GL_EXT_coordinate_frame +#define GL_TANGENT_ARRAY_EXT 0x8439 +#define GL_BINORMAL_ARRAY_EXT 0x843A +#define GL_CURRENT_TANGENT_EXT 0x843B +#define GL_CURRENT_BINORMAL_EXT 0x843C +#define GL_TANGENT_ARRAY_TYPE_EXT 0x843E +#define GL_TANGENT_ARRAY_STRIDE_EXT 0x843F +#define GL_BINORMAL_ARRAY_TYPE_EXT 0x8440 +#define GL_BINORMAL_ARRAY_STRIDE_EXT 0x8441 +#define GL_TANGENT_ARRAY_POINTER_EXT 0x8442 +#define GL_BINORMAL_ARRAY_POINTER_EXT 0x8443 +#define GL_MAP1_TANGENT_EXT 0x8444 +#define GL_MAP2_TANGENT_EXT 0x8445 +#define GL_MAP1_BINORMAL_EXT 0x8446 +#define GL_MAP2_BINORMAL_EXT 0x8447 +#endif + +#ifndef GL_EXT_texture_env_combine +#define GL_COMBINE_EXT 0x8570 +#define GL_COMBINE_RGB_EXT 0x8571 +#define GL_COMBINE_ALPHA_EXT 0x8572 +#define GL_RGB_SCALE_EXT 0x8573 +#define GL_ADD_SIGNED_EXT 0x8574 +#define GL_INTERPOLATE_EXT 0x8575 +#define GL_CONSTANT_EXT 0x8576 +#define GL_PRIMARY_COLOR_EXT 0x8577 +#define GL_PREVIOUS_EXT 0x8578 +#define GL_SOURCE0_RGB_EXT 0x8580 +#define GL_SOURCE1_RGB_EXT 0x8581 +#define GL_SOURCE2_RGB_EXT 0x8582 +#define GL_SOURCE0_ALPHA_EXT 0x8588 +#define GL_SOURCE1_ALPHA_EXT 0x8589 +#define GL_SOURCE2_ALPHA_EXT 0x858A +#define GL_OPERAND0_RGB_EXT 0x8590 +#define GL_OPERAND1_RGB_EXT 0x8591 +#define GL_OPERAND2_RGB_EXT 0x8592 +#define GL_OPERAND0_ALPHA_EXT 0x8598 +#define GL_OPERAND1_ALPHA_EXT 0x8599 +#define GL_OPERAND2_ALPHA_EXT 0x859A +#endif + +#ifndef GL_APPLE_specular_vector +#define GL_LIGHT_MODEL_SPECULAR_VECTOR_APPLE 0x85B0 +#endif + +#ifndef GL_APPLE_transform_hint +#define GL_TRANSFORM_HINT_APPLE 0x85B1 +#endif + +#ifndef GL_SGIX_fog_scale +#define GL_FOG_SCALE_SGIX 0x81FC +#define GL_FOG_SCALE_VALUE_SGIX 0x81FD +#endif + +#ifndef GL_SUNX_constant_data +#define GL_UNPACK_CONSTANT_DATA_SUNX 0x81D5 +#define GL_TEXTURE_CONSTANT_DATA_SUNX 0x81D6 +#endif + +#ifndef GL_SUN_global_alpha +#define GL_GLOBAL_ALPHA_SUN 0x81D9 +#define GL_GLOBAL_ALPHA_FACTOR_SUN 0x81DA +#endif + +#ifndef GL_SUN_triangle_list +#define GL_RESTART_SUN 0x0001 +#define GL_REPLACE_MIDDLE_SUN 0x0002 +#define GL_REPLACE_OLDEST_SUN 0x0003 +#define GL_TRIANGLE_LIST_SUN 0x81D7 +#define GL_REPLACEMENT_CODE_SUN 0x81D8 +#define GL_REPLACEMENT_CODE_ARRAY_SUN 0x85C0 +#define GL_REPLACEMENT_CODE_ARRAY_TYPE_SUN 0x85C1 +#define GL_REPLACEMENT_CODE_ARRAY_STRIDE_SUN 0x85C2 +#define GL_REPLACEMENT_CODE_ARRAY_POINTER_SUN 0x85C3 +#define GL_R1UI_V3F_SUN 0x85C4 +#define GL_R1UI_C4UB_V3F_SUN 0x85C5 +#define GL_R1UI_C3F_V3F_SUN 0x85C6 +#define GL_R1UI_N3F_V3F_SUN 0x85C7 +#define GL_R1UI_C4F_N3F_V3F_SUN 0x85C8 +#define GL_R1UI_T2F_V3F_SUN 0x85C9 +#define GL_R1UI_T2F_N3F_V3F_SUN 0x85CA +#define GL_R1UI_T2F_C4F_N3F_V3F_SUN 0x85CB +#endif + +#ifndef GL_SUN_vertex +#endif + +#ifndef GL_EXT_blend_func_separate +#define GL_BLEND_DST_RGB_EXT 0x80C8 +#define GL_BLEND_SRC_RGB_EXT 0x80C9 +#define GL_BLEND_DST_ALPHA_EXT 0x80CA +#define GL_BLEND_SRC_ALPHA_EXT 0x80CB +#endif + +#ifndef GL_INGR_color_clamp +#define GL_RED_MIN_CLAMP_INGR 0x8560 +#define GL_GREEN_MIN_CLAMP_INGR 0x8561 +#define GL_BLUE_MIN_CLAMP_INGR 0x8562 +#define GL_ALPHA_MIN_CLAMP_INGR 0x8563 +#define GL_RED_MAX_CLAMP_INGR 0x8564 +#define GL_GREEN_MAX_CLAMP_INGR 0x8565 +#define GL_BLUE_MAX_CLAMP_INGR 0x8566 +#define GL_ALPHA_MAX_CLAMP_INGR 0x8567 +#endif + +#ifndef GL_INGR_interlace_read +#define GL_INTERLACE_READ_INGR 0x8568 +#endif + +#ifndef GL_EXT_stencil_wrap +#define GL_INCR_WRAP_EXT 0x8507 +#define GL_DECR_WRAP_EXT 0x8508 +#endif + +#ifndef GL_EXT_422_pixels +#define GL_422_EXT 0x80CC +#define GL_422_REV_EXT 0x80CD +#define GL_422_AVERAGE_EXT 0x80CE +#define GL_422_REV_AVERAGE_EXT 0x80CF +#endif + +#ifndef GL_NV_texgen_reflection +#define GL_NORMAL_MAP_NV 0x8511 +#define GL_REFLECTION_MAP_NV 0x8512 +#endif + +#ifndef GL_EXT_texture_cube_map +#define GL_NORMAL_MAP_EXT 0x8511 +#define GL_REFLECTION_MAP_EXT 0x8512 +#define GL_TEXTURE_CUBE_MAP_EXT 0x8513 +#define GL_TEXTURE_BINDING_CUBE_MAP_EXT 0x8514 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_X_EXT 0x8515 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X_EXT 0x8516 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y_EXT 0x8517 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y_EXT 0x8518 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z_EXT 0x8519 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z_EXT 0x851A +#define GL_PROXY_TEXTURE_CUBE_MAP_EXT 0x851B +#define GL_MAX_CUBE_MAP_TEXTURE_SIZE_EXT 0x851C +#endif + +#ifndef GL_SUN_convolution_border_modes +#define GL_WRAP_BORDER_SUN 0x81D4 +#endif + +#ifndef GL_EXT_texture_env_add +#endif + +#ifndef GL_EXT_texture_lod_bias +#define GL_MAX_TEXTURE_LOD_BIAS_EXT 0x84FD +#define GL_TEXTURE_FILTER_CONTROL_EXT 0x8500 +#define GL_TEXTURE_LOD_BIAS_EXT 0x8501 +#endif + +#ifndef GL_EXT_texture_filter_anisotropic +#define GL_TEXTURE_MAX_ANISOTROPY_EXT 0x84FE +#define GL_MAX_TEXTURE_MAX_ANISOTROPY_EXT 0x84FF +#endif + +#ifndef GL_EXT_vertex_weighting +#define GL_MODELVIEW0_STACK_DEPTH_EXT GL_MODELVIEW_STACK_DEPTH +#define GL_MODELVIEW1_STACK_DEPTH_EXT 0x8502 +#define GL_MODELVIEW0_MATRIX_EXT GL_MODELVIEW_MATRIX +#define GL_MODELVIEW1_MATRIX_EXT 0x8506 +#define GL_VERTEX_WEIGHTING_EXT 0x8509 +#define GL_MODELVIEW0_EXT GL_MODELVIEW +#define GL_MODELVIEW1_EXT 0x850A +#define GL_CURRENT_VERTEX_WEIGHT_EXT 0x850B +#define GL_VERTEX_WEIGHT_ARRAY_EXT 0x850C +#define GL_VERTEX_WEIGHT_ARRAY_SIZE_EXT 0x850D +#define GL_VERTEX_WEIGHT_ARRAY_TYPE_EXT 0x850E +#define GL_VERTEX_WEIGHT_ARRAY_STRIDE_EXT 0x850F +#define GL_VERTEX_WEIGHT_ARRAY_POINTER_EXT 0x8510 +#endif + +#ifndef GL_NV_light_max_exponent +#define GL_MAX_SHININESS_NV 0x8504 +#define GL_MAX_SPOT_EXPONENT_NV 0x8505 +#endif + +#ifndef GL_NV_vertex_array_range +#define GL_VERTEX_ARRAY_RANGE_NV 0x851D +#define GL_VERTEX_ARRAY_RANGE_LENGTH_NV 0x851E +#define GL_VERTEX_ARRAY_RANGE_VALID_NV 0x851F +#define GL_MAX_VERTEX_ARRAY_RANGE_ELEMENT_NV 0x8520 +#define GL_VERTEX_ARRAY_RANGE_POINTER_NV 0x8521 +#endif + +#ifndef GL_NV_register_combiners +#define GL_REGISTER_COMBINERS_NV 0x8522 +#define GL_VARIABLE_A_NV 0x8523 +#define GL_VARIABLE_B_NV 0x8524 +#define GL_VARIABLE_C_NV 0x8525 +#define GL_VARIABLE_D_NV 0x8526 +#define GL_VARIABLE_E_NV 0x8527 +#define GL_VARIABLE_F_NV 0x8528 +#define GL_VARIABLE_G_NV 0x8529 +#define GL_CONSTANT_COLOR0_NV 0x852A +#define GL_CONSTANT_COLOR1_NV 0x852B +#define GL_PRIMARY_COLOR_NV 0x852C +#define GL_SECONDARY_COLOR_NV 0x852D +#define GL_SPARE0_NV 0x852E +#define GL_SPARE1_NV 0x852F +#define GL_DISCARD_NV 0x8530 +#define GL_E_TIMES_F_NV 0x8531 +#define GL_SPARE0_PLUS_SECONDARY_COLOR_NV 0x8532 +#define GL_UNSIGNED_IDENTITY_NV 0x8536 +#define GL_UNSIGNED_INVERT_NV 0x8537 +#define GL_EXPAND_NORMAL_NV 0x8538 +#define GL_EXPAND_NEGATE_NV 0x8539 +#define GL_HALF_BIAS_NORMAL_NV 0x853A +#define GL_HALF_BIAS_NEGATE_NV 0x853B +#define GL_SIGNED_IDENTITY_NV 0x853C +#define GL_SIGNED_NEGATE_NV 0x853D +#define GL_SCALE_BY_TWO_NV 0x853E +#define GL_SCALE_BY_FOUR_NV 0x853F +#define GL_SCALE_BY_ONE_HALF_NV 0x8540 +#define GL_BIAS_BY_NEGATIVE_ONE_HALF_NV 0x8541 +#define GL_COMBINER_INPUT_NV 0x8542 +#define GL_COMBINER_MAPPING_NV 0x8543 +#define GL_COMBINER_COMPONENT_USAGE_NV 0x8544 +#define GL_COMBINER_AB_DOT_PRODUCT_NV 0x8545 +#define GL_COMBINER_CD_DOT_PRODUCT_NV 0x8546 +#define GL_COMBINER_MUX_SUM_NV 0x8547 +#define GL_COMBINER_SCALE_NV 0x8548 +#define GL_COMBINER_BIAS_NV 0x8549 +#define GL_COMBINER_AB_OUTPUT_NV 0x854A +#define GL_COMBINER_CD_OUTPUT_NV 0x854B +#define GL_COMBINER_SUM_OUTPUT_NV 0x854C +#define GL_MAX_GENERAL_COMBINERS_NV 0x854D +#define GL_NUM_GENERAL_COMBINERS_NV 0x854E +#define GL_COLOR_SUM_CLAMP_NV 0x854F +#define GL_COMBINER0_NV 0x8550 +#define GL_COMBINER1_NV 0x8551 +#define GL_COMBINER2_NV 0x8552 +#define GL_COMBINER3_NV 0x8553 +#define GL_COMBINER4_NV 0x8554 +#define GL_COMBINER5_NV 0x8555 +#define GL_COMBINER6_NV 0x8556 +#define GL_COMBINER7_NV 0x8557 +/* reuse GL_TEXTURE0_ARB */ +/* reuse GL_TEXTURE1_ARB */ +/* reuse GL_ZERO */ +/* reuse GL_NONE */ +/* reuse GL_FOG */ +#endif + +#ifndef GL_NV_fog_distance +#define GL_FOG_DISTANCE_MODE_NV 0x855A +#define GL_EYE_RADIAL_NV 0x855B +#define GL_EYE_PLANE_ABSOLUTE_NV 0x855C +/* reuse GL_EYE_PLANE */ +#endif + +#ifndef GL_NV_texgen_emboss +#define GL_EMBOSS_LIGHT_NV 0x855D +#define GL_EMBOSS_CONSTANT_NV 0x855E +#define GL_EMBOSS_MAP_NV 0x855F +#endif + +#ifndef GL_NV_blend_square +#endif + +#ifndef GL_NV_texture_env_combine4 +#define GL_COMBINE4_NV 0x8503 +#define GL_SOURCE3_RGB_NV 0x8583 +#define GL_SOURCE3_ALPHA_NV 0x858B +#define GL_OPERAND3_RGB_NV 0x8593 +#define GL_OPERAND3_ALPHA_NV 0x859B +#endif + +#ifndef GL_MESA_resize_buffers +#endif + +#ifndef GL_MESA_window_pos +#endif + +#ifndef GL_EXT_texture_compression_s3tc +#define GL_COMPRESSED_RGB_S3TC_DXT1_EXT 0x83F0 +#define GL_COMPRESSED_RGBA_S3TC_DXT1_EXT 0x83F1 +#define GL_COMPRESSED_RGBA_S3TC_DXT3_EXT 0x83F2 +#define GL_COMPRESSED_RGBA_S3TC_DXT5_EXT 0x83F3 +#endif + +#ifndef GL_IBM_cull_vertex +#define GL_CULL_VERTEX_IBM 103050 +#endif + +#ifndef GL_IBM_multimode_draw_arrays +#endif + +#ifndef GL_IBM_vertex_array_lists +#define GL_VERTEX_ARRAY_LIST_IBM 103070 +#define GL_NORMAL_ARRAY_LIST_IBM 103071 +#define GL_COLOR_ARRAY_LIST_IBM 103072 +#define GL_INDEX_ARRAY_LIST_IBM 103073 +#define GL_TEXTURE_COORD_ARRAY_LIST_IBM 103074 +#define GL_EDGE_FLAG_ARRAY_LIST_IBM 103075 +#define GL_FOG_COORDINATE_ARRAY_LIST_IBM 103076 +#define GL_SECONDARY_COLOR_ARRAY_LIST_IBM 103077 +#define GL_VERTEX_ARRAY_LIST_STRIDE_IBM 103080 +#define GL_NORMAL_ARRAY_LIST_STRIDE_IBM 103081 +#define GL_COLOR_ARRAY_LIST_STRIDE_IBM 103082 +#define GL_INDEX_ARRAY_LIST_STRIDE_IBM 103083 +#define GL_TEXTURE_COORD_ARRAY_LIST_STRIDE_IBM 103084 +#define GL_EDGE_FLAG_ARRAY_LIST_STRIDE_IBM 103085 +#define GL_FOG_COORDINATE_ARRAY_LIST_STRIDE_IBM 103086 +#define GL_SECONDARY_COLOR_ARRAY_LIST_STRIDE_IBM 103087 +#endif + +#ifndef GL_SGIX_subsample +#define GL_PACK_SUBSAMPLE_RATE_SGIX 0x85A0 +#define GL_UNPACK_SUBSAMPLE_RATE_SGIX 0x85A1 +#define GL_PIXEL_SUBSAMPLE_4444_SGIX 0x85A2 +#define GL_PIXEL_SUBSAMPLE_2424_SGIX 0x85A3 +#define GL_PIXEL_SUBSAMPLE_4242_SGIX 0x85A4 +#endif + +#ifndef GL_SGIX_ycrcb_subsample +#endif + +#ifndef GL_SGIX_ycrcba +#define GL_YCRCB_SGIX 0x8318 +#define GL_YCRCBA_SGIX 0x8319 +#endif + +#ifndef GL_SGI_depth_pass_instrument +#define GL_DEPTH_PASS_INSTRUMENT_SGIX 0x8310 +#define GL_DEPTH_PASS_INSTRUMENT_COUNTERS_SGIX 0x8311 +#define GL_DEPTH_PASS_INSTRUMENT_MAX_SGIX 0x8312 +#endif + +#ifndef GL_3DFX_texture_compression_FXT1 +#define GL_COMPRESSED_RGB_FXT1_3DFX 0x86B0 +#define GL_COMPRESSED_RGBA_FXT1_3DFX 0x86B1 +#endif + +#ifndef GL_3DFX_multisample +#define GL_MULTISAMPLE_3DFX 0x86B2 +#define GL_SAMPLE_BUFFERS_3DFX 0x86B3 +#define GL_SAMPLES_3DFX 0x86B4 +#define GL_MULTISAMPLE_BIT_3DFX 0x20000000 +#endif + +#ifndef GL_3DFX_tbuffer +#endif + +#ifndef GL_EXT_multisample +#define GL_MULTISAMPLE_EXT 0x809D +#define GL_SAMPLE_ALPHA_TO_MASK_EXT 0x809E +#define GL_SAMPLE_ALPHA_TO_ONE_EXT 0x809F +#define GL_SAMPLE_MASK_EXT 0x80A0 +#define GL_1PASS_EXT 0x80A1 +#define GL_2PASS_0_EXT 0x80A2 +#define GL_2PASS_1_EXT 0x80A3 +#define GL_4PASS_0_EXT 0x80A4 +#define GL_4PASS_1_EXT 0x80A5 +#define GL_4PASS_2_EXT 0x80A6 +#define GL_4PASS_3_EXT 0x80A7 +#define GL_SAMPLE_BUFFERS_EXT 0x80A8 +#define GL_SAMPLES_EXT 0x80A9 +#define GL_SAMPLE_MASK_VALUE_EXT 0x80AA +#define GL_SAMPLE_MASK_INVERT_EXT 0x80AB +#define GL_SAMPLE_PATTERN_EXT 0x80AC +#define GL_MULTISAMPLE_BIT_EXT 0x20000000 +#endif + +#ifndef GL_SGIX_vertex_preclip +#define GL_VERTEX_PRECLIP_SGIX 0x83EE +#define GL_VERTEX_PRECLIP_HINT_SGIX 0x83EF +#endif + +#ifndef GL_SGIX_convolution_accuracy +#define GL_CONVOLUTION_HINT_SGIX 0x8316 +#endif + +#ifndef GL_SGIX_resample +#define GL_PACK_RESAMPLE_SGIX 0x842C +#define GL_UNPACK_RESAMPLE_SGIX 0x842D +#define GL_RESAMPLE_REPLICATE_SGIX 0x842E +#define GL_RESAMPLE_ZERO_FILL_SGIX 0x842F +#define GL_RESAMPLE_DECIMATE_SGIX 0x8430 +#endif + +#ifndef GL_SGIS_point_line_texgen +#define GL_EYE_DISTANCE_TO_POINT_SGIS 0x81F0 +#define GL_OBJECT_DISTANCE_TO_POINT_SGIS 0x81F1 +#define GL_EYE_DISTANCE_TO_LINE_SGIS 0x81F2 +#define GL_OBJECT_DISTANCE_TO_LINE_SGIS 0x81F3 +#define GL_EYE_POINT_SGIS 0x81F4 +#define GL_OBJECT_POINT_SGIS 0x81F5 +#define GL_EYE_LINE_SGIS 0x81F6 +#define GL_OBJECT_LINE_SGIS 0x81F7 +#endif + +#ifndef GL_SGIS_texture_color_mask +#define GL_TEXTURE_COLOR_WRITEMASK_SGIS 0x81EF +#endif + +#ifndef GL_EXT_texture_env_dot3 +#define GL_DOT3_RGB_EXT 0x8740 +#define GL_DOT3_RGBA_EXT 0x8741 +#endif + +#ifndef GL_ATI_texture_mirror_once +#define GL_MIRROR_CLAMP_ATI 0x8742 +#define GL_MIRROR_CLAMP_TO_EDGE_ATI 0x8743 +#endif + +#ifndef GL_NV_fence +#define GL_ALL_COMPLETED_NV 0x84F2 +#define GL_FENCE_STATUS_NV 0x84F3 +#define GL_FENCE_CONDITION_NV 0x84F4 +#endif + +#ifndef GL_IBM_texture_mirrored_repeat +#define GL_MIRRORED_REPEAT_IBM 0x8370 +#endif + +#ifndef GL_NV_evaluators +#define GL_EVAL_2D_NV 0x86C0 +#define GL_EVAL_TRIANGULAR_2D_NV 0x86C1 +#define GL_MAP_TESSELLATION_NV 0x86C2 +#define GL_MAP_ATTRIB_U_ORDER_NV 0x86C3 +#define GL_MAP_ATTRIB_V_ORDER_NV 0x86C4 +#define GL_EVAL_FRACTIONAL_TESSELLATION_NV 0x86C5 +#define GL_EVAL_VERTEX_ATTRIB0_NV 0x86C6 +#define GL_EVAL_VERTEX_ATTRIB1_NV 0x86C7 +#define GL_EVAL_VERTEX_ATTRIB2_NV 0x86C8 +#define GL_EVAL_VERTEX_ATTRIB3_NV 0x86C9 +#define GL_EVAL_VERTEX_ATTRIB4_NV 0x86CA +#define GL_EVAL_VERTEX_ATTRIB5_NV 0x86CB +#define GL_EVAL_VERTEX_ATTRIB6_NV 0x86CC +#define GL_EVAL_VERTEX_ATTRIB7_NV 0x86CD +#define GL_EVAL_VERTEX_ATTRIB8_NV 0x86CE +#define GL_EVAL_VERTEX_ATTRIB9_NV 0x86CF +#define GL_EVAL_VERTEX_ATTRIB10_NV 0x86D0 +#define GL_EVAL_VERTEX_ATTRIB11_NV 0x86D1 +#define GL_EVAL_VERTEX_ATTRIB12_NV 0x86D2 +#define GL_EVAL_VERTEX_ATTRIB13_NV 0x86D3 +#define GL_EVAL_VERTEX_ATTRIB14_NV 0x86D4 +#define GL_EVAL_VERTEX_ATTRIB15_NV 0x86D5 +#define GL_MAX_MAP_TESSELLATION_NV 0x86D6 +#define GL_MAX_RATIONAL_EVAL_ORDER_NV 0x86D7 +#endif + +#ifndef GL_NV_packed_depth_stencil +#define GL_DEPTH_STENCIL_NV 0x84F9 +#define GL_UNSIGNED_INT_24_8_NV 0x84FA +#endif + +#ifndef GL_NV_register_combiners2 +#define GL_PER_STAGE_CONSTANTS_NV 0x8535 +#endif + +#ifndef GL_NV_texture_compression_vtc +#endif + +#ifndef GL_NV_texture_rectangle +#define GL_TEXTURE_RECTANGLE_NV 0x84F5 +#define GL_TEXTURE_BINDING_RECTANGLE_NV 0x84F6 +#define GL_PROXY_TEXTURE_RECTANGLE_NV 0x84F7 +#define GL_MAX_RECTANGLE_TEXTURE_SIZE_NV 0x84F8 +#endif + +#ifndef GL_NV_texture_shader +#define GL_OFFSET_TEXTURE_RECTANGLE_NV 0x864C +#define GL_OFFSET_TEXTURE_RECTANGLE_SCALE_NV 0x864D +#define GL_DOT_PRODUCT_TEXTURE_RECTANGLE_NV 0x864E +#define GL_RGBA_UNSIGNED_DOT_PRODUCT_MAPPING_NV 0x86D9 +#define GL_UNSIGNED_INT_S8_S8_8_8_NV 0x86DA +#define GL_UNSIGNED_INT_8_8_S8_S8_REV_NV 0x86DB +#define GL_DSDT_MAG_INTENSITY_NV 0x86DC +#define GL_SHADER_CONSISTENT_NV 0x86DD +#define GL_TEXTURE_SHADER_NV 0x86DE +#define GL_SHADER_OPERATION_NV 0x86DF +#define GL_CULL_MODES_NV 0x86E0 +#define GL_OFFSET_TEXTURE_MATRIX_NV 0x86E1 +#define GL_OFFSET_TEXTURE_SCALE_NV 0x86E2 +#define GL_OFFSET_TEXTURE_BIAS_NV 0x86E3 +#define GL_OFFSET_TEXTURE_2D_MATRIX_NV GL_OFFSET_TEXTURE_MATRIX_NV +#define GL_OFFSET_TEXTURE_2D_SCALE_NV GL_OFFSET_TEXTURE_SCALE_NV +#define GL_OFFSET_TEXTURE_2D_BIAS_NV GL_OFFSET_TEXTURE_BIAS_NV +#define GL_PREVIOUS_TEXTURE_INPUT_NV 0x86E4 +#define GL_CONST_EYE_NV 0x86E5 +#define GL_PASS_THROUGH_NV 0x86E6 +#define GL_CULL_FRAGMENT_NV 0x86E7 +#define GL_OFFSET_TEXTURE_2D_NV 0x86E8 +#define GL_DEPENDENT_AR_TEXTURE_2D_NV 0x86E9 +#define GL_DEPENDENT_GB_TEXTURE_2D_NV 0x86EA +#define GL_DOT_PRODUCT_NV 0x86EC +#define GL_DOT_PRODUCT_DEPTH_REPLACE_NV 0x86ED +#define GL_DOT_PRODUCT_TEXTURE_2D_NV 0x86EE +#define GL_DOT_PRODUCT_TEXTURE_CUBE_MAP_NV 0x86F0 +#define GL_DOT_PRODUCT_DIFFUSE_CUBE_MAP_NV 0x86F1 +#define GL_DOT_PRODUCT_REFLECT_CUBE_MAP_NV 0x86F2 +#define GL_DOT_PRODUCT_CONST_EYE_REFLECT_CUBE_MAP_NV 0x86F3 +#define GL_HILO_NV 0x86F4 +#define GL_DSDT_NV 0x86F5 +#define GL_DSDT_MAG_NV 0x86F6 +#define GL_DSDT_MAG_VIB_NV 0x86F7 +#define GL_HILO16_NV 0x86F8 +#define GL_SIGNED_HILO_NV 0x86F9 +#define GL_SIGNED_HILO16_NV 0x86FA +#define GL_SIGNED_RGBA_NV 0x86FB +#define GL_SIGNED_RGBA8_NV 0x86FC +#define GL_SIGNED_RGB_NV 0x86FE +#define GL_SIGNED_RGB8_NV 0x86FF +#define GL_SIGNED_LUMINANCE_NV 0x8701 +#define GL_SIGNED_LUMINANCE8_NV 0x8702 +#define GL_SIGNED_LUMINANCE_ALPHA_NV 0x8703 +#define GL_SIGNED_LUMINANCE8_ALPHA8_NV 0x8704 +#define GL_SIGNED_ALPHA_NV 0x8705 +#define GL_SIGNED_ALPHA8_NV 0x8706 +#define GL_SIGNED_INTENSITY_NV 0x8707 +#define GL_SIGNED_INTENSITY8_NV 0x8708 +#define GL_DSDT8_NV 0x8709 +#define GL_DSDT8_MAG8_NV 0x870A +#define GL_DSDT8_MAG8_INTENSITY8_NV 0x870B +#define GL_SIGNED_RGB_UNSIGNED_ALPHA_NV 0x870C +#define GL_SIGNED_RGB8_UNSIGNED_ALPHA8_NV 0x870D +#define GL_HI_SCALE_NV 0x870E +#define GL_LO_SCALE_NV 0x870F +#define GL_DS_SCALE_NV 0x8710 +#define GL_DT_SCALE_NV 0x8711 +#define GL_MAGNITUDE_SCALE_NV 0x8712 +#define GL_VIBRANCE_SCALE_NV 0x8713 +#define GL_HI_BIAS_NV 0x8714 +#define GL_LO_BIAS_NV 0x8715 +#define GL_DS_BIAS_NV 0x8716 +#define GL_DT_BIAS_NV 0x8717 +#define GL_MAGNITUDE_BIAS_NV 0x8718 +#define GL_VIBRANCE_BIAS_NV 0x8719 +#define GL_TEXTURE_BORDER_VALUES_NV 0x871A +#define GL_TEXTURE_HI_SIZE_NV 0x871B +#define GL_TEXTURE_LO_SIZE_NV 0x871C +#define GL_TEXTURE_DS_SIZE_NV 0x871D +#define GL_TEXTURE_DT_SIZE_NV 0x871E +#define GL_TEXTURE_MAG_SIZE_NV 0x871F +#endif + +#ifndef GL_NV_texture_shader2 +#define GL_DOT_PRODUCT_TEXTURE_3D_NV 0x86EF +#endif + +#ifndef GL_NV_vertex_array_range2 +#define GL_VERTEX_ARRAY_RANGE_WITHOUT_FLUSH_NV 0x8533 +#endif + +#ifndef GL_NV_vertex_program +#define GL_VERTEX_PROGRAM_NV 0x8620 +#define GL_VERTEX_STATE_PROGRAM_NV 0x8621 +#define GL_ATTRIB_ARRAY_SIZE_NV 0x8623 +#define GL_ATTRIB_ARRAY_STRIDE_NV 0x8624 +#define GL_ATTRIB_ARRAY_TYPE_NV 0x8625 +#define GL_CURRENT_ATTRIB_NV 0x8626 +#define GL_PROGRAM_LENGTH_NV 0x8627 +#define GL_PROGRAM_STRING_NV 0x8628 +#define GL_MODELVIEW_PROJECTION_NV 0x8629 +#define GL_IDENTITY_NV 0x862A +#define GL_INVERSE_NV 0x862B +#define GL_TRANSPOSE_NV 0x862C +#define GL_INVERSE_TRANSPOSE_NV 0x862D +#define GL_MAX_TRACK_MATRIX_STACK_DEPTH_NV 0x862E +#define GL_MAX_TRACK_MATRICES_NV 0x862F +#define GL_MATRIX0_NV 0x8630 +#define GL_MATRIX1_NV 0x8631 +#define GL_MATRIX2_NV 0x8632 +#define GL_MATRIX3_NV 0x8633 +#define GL_MATRIX4_NV 0x8634 +#define GL_MATRIX5_NV 0x8635 +#define GL_MATRIX6_NV 0x8636 +#define GL_MATRIX7_NV 0x8637 +#define GL_CURRENT_MATRIX_STACK_DEPTH_NV 0x8640 +#define GL_CURRENT_MATRIX_NV 0x8641 +#define GL_VERTEX_PROGRAM_POINT_SIZE_NV 0x8642 +#define GL_VERTEX_PROGRAM_TWO_SIDE_NV 0x8643 +#define GL_PROGRAM_PARAMETER_NV 0x8644 +#define GL_ATTRIB_ARRAY_POINTER_NV 0x8645 +#define GL_PROGRAM_TARGET_NV 0x8646 +#define GL_PROGRAM_RESIDENT_NV 0x8647 +#define GL_TRACK_MATRIX_NV 0x8648 +#define GL_TRACK_MATRIX_TRANSFORM_NV 0x8649 +#define GL_VERTEX_PROGRAM_BINDING_NV 0x864A +#define GL_PROGRAM_ERROR_POSITION_NV 0x864B +#define GL_VERTEX_ATTRIB_ARRAY0_NV 0x8650 +#define GL_VERTEX_ATTRIB_ARRAY1_NV 0x8651 +#define GL_VERTEX_ATTRIB_ARRAY2_NV 0x8652 +#define GL_VERTEX_ATTRIB_ARRAY3_NV 0x8653 +#define GL_VERTEX_ATTRIB_ARRAY4_NV 0x8654 +#define GL_VERTEX_ATTRIB_ARRAY5_NV 0x8655 +#define GL_VERTEX_ATTRIB_ARRAY6_NV 0x8656 +#define GL_VERTEX_ATTRIB_ARRAY7_NV 0x8657 +#define GL_VERTEX_ATTRIB_ARRAY8_NV 0x8658 +#define GL_VERTEX_ATTRIB_ARRAY9_NV 0x8659 +#define GL_VERTEX_ATTRIB_ARRAY10_NV 0x865A +#define GL_VERTEX_ATTRIB_ARRAY11_NV 0x865B +#define GL_VERTEX_ATTRIB_ARRAY12_NV 0x865C +#define GL_VERTEX_ATTRIB_ARRAY13_NV 0x865D +#define GL_VERTEX_ATTRIB_ARRAY14_NV 0x865E +#define GL_VERTEX_ATTRIB_ARRAY15_NV 0x865F +#define GL_MAP1_VERTEX_ATTRIB0_4_NV 0x8660 +#define GL_MAP1_VERTEX_ATTRIB1_4_NV 0x8661 +#define GL_MAP1_VERTEX_ATTRIB2_4_NV 0x8662 +#define GL_MAP1_VERTEX_ATTRIB3_4_NV 0x8663 +#define GL_MAP1_VERTEX_ATTRIB4_4_NV 0x8664 +#define GL_MAP1_VERTEX_ATTRIB5_4_NV 0x8665 +#define GL_MAP1_VERTEX_ATTRIB6_4_NV 0x8666 +#define GL_MAP1_VERTEX_ATTRIB7_4_NV 0x8667 +#define GL_MAP1_VERTEX_ATTRIB8_4_NV 0x8668 +#define GL_MAP1_VERTEX_ATTRIB9_4_NV 0x8669 +#define GL_MAP1_VERTEX_ATTRIB10_4_NV 0x866A +#define GL_MAP1_VERTEX_ATTRIB11_4_NV 0x866B +#define GL_MAP1_VERTEX_ATTRIB12_4_NV 0x866C +#define GL_MAP1_VERTEX_ATTRIB13_4_NV 0x866D +#define GL_MAP1_VERTEX_ATTRIB14_4_NV 0x866E +#define GL_MAP1_VERTEX_ATTRIB15_4_NV 0x866F +#define GL_MAP2_VERTEX_ATTRIB0_4_NV 0x8670 +#define GL_MAP2_VERTEX_ATTRIB1_4_NV 0x8671 +#define GL_MAP2_VERTEX_ATTRIB2_4_NV 0x8672 +#define GL_MAP2_VERTEX_ATTRIB3_4_NV 0x8673 +#define GL_MAP2_VERTEX_ATTRIB4_4_NV 0x8674 +#define GL_MAP2_VERTEX_ATTRIB5_4_NV 0x8675 +#define GL_MAP2_VERTEX_ATTRIB6_4_NV 0x8676 +#define GL_MAP2_VERTEX_ATTRIB7_4_NV 0x8677 +#define GL_MAP2_VERTEX_ATTRIB8_4_NV 0x8678 +#define GL_MAP2_VERTEX_ATTRIB9_4_NV 0x8679 +#define GL_MAP2_VERTEX_ATTRIB10_4_NV 0x867A +#define GL_MAP2_VERTEX_ATTRIB11_4_NV 0x867B +#define GL_MAP2_VERTEX_ATTRIB12_4_NV 0x867C +#define GL_MAP2_VERTEX_ATTRIB13_4_NV 0x867D +#define GL_MAP2_VERTEX_ATTRIB14_4_NV 0x867E +#define GL_MAP2_VERTEX_ATTRIB15_4_NV 0x867F +#endif + +#ifndef GL_SGIX_texture_coordinate_clamp +#define GL_TEXTURE_MAX_CLAMP_S_SGIX 0x8369 +#define GL_TEXTURE_MAX_CLAMP_T_SGIX 0x836A +#define GL_TEXTURE_MAX_CLAMP_R_SGIX 0x836B +#endif + +#ifndef GL_SGIX_scalebias_hint +#define GL_SCALEBIAS_HINT_SGIX 0x8322 +#endif + +#ifndef GL_OML_interlace +#define GL_INTERLACE_OML 0x8980 +#define GL_INTERLACE_READ_OML 0x8981 +#endif + +#ifndef GL_OML_subsample +#define GL_FORMAT_SUBSAMPLE_24_24_OML 0x8982 +#define GL_FORMAT_SUBSAMPLE_244_244_OML 0x8983 +#endif + +#ifndef GL_OML_resample +#define GL_PACK_RESAMPLE_OML 0x8984 +#define GL_UNPACK_RESAMPLE_OML 0x8985 +#define GL_RESAMPLE_REPLICATE_OML 0x8986 +#define GL_RESAMPLE_ZERO_FILL_OML 0x8987 +#define GL_RESAMPLE_AVERAGE_OML 0x8988 +#define GL_RESAMPLE_DECIMATE_OML 0x8989 +#endif + +#ifndef GL_NV_copy_depth_to_color +#define GL_DEPTH_STENCIL_TO_RGBA_NV 0x886E +#define GL_DEPTH_STENCIL_TO_BGRA_NV 0x886F +#endif + +#ifndef GL_ATI_envmap_bumpmap +#define GL_BUMP_ROT_MATRIX_ATI 0x8775 +#define GL_BUMP_ROT_MATRIX_SIZE_ATI 0x8776 +#define GL_BUMP_NUM_TEX_UNITS_ATI 0x8777 +#define GL_BUMP_TEX_UNITS_ATI 0x8778 +#define GL_DUDV_ATI 0x8779 +#define GL_DU8DV8_ATI 0x877A +#define GL_BUMP_ENVMAP_ATI 0x877B +#define GL_BUMP_TARGET_ATI 0x877C +#endif + +#ifndef GL_ATI_fragment_shader +#define GL_FRAGMENT_SHADER_ATI 0x8920 +#define GL_REG_0_ATI 0x8921 +#define GL_REG_1_ATI 0x8922 +#define GL_REG_2_ATI 0x8923 +#define GL_REG_3_ATI 0x8924 +#define GL_REG_4_ATI 0x8925 +#define GL_REG_5_ATI 0x8926 +#define GL_REG_6_ATI 0x8927 +#define GL_REG_7_ATI 0x8928 +#define GL_REG_8_ATI 0x8929 +#define GL_REG_9_ATI 0x892A +#define GL_REG_10_ATI 0x892B +#define GL_REG_11_ATI 0x892C +#define GL_REG_12_ATI 0x892D +#define GL_REG_13_ATI 0x892E +#define GL_REG_14_ATI 0x892F +#define GL_REG_15_ATI 0x8930 +#define GL_REG_16_ATI 0x8931 +#define GL_REG_17_ATI 0x8932 +#define GL_REG_18_ATI 0x8933 +#define GL_REG_19_ATI 0x8934 +#define GL_REG_20_ATI 0x8935 +#define GL_REG_21_ATI 0x8936 +#define GL_REG_22_ATI 0x8937 +#define GL_REG_23_ATI 0x8938 +#define GL_REG_24_ATI 0x8939 +#define GL_REG_25_ATI 0x893A +#define GL_REG_26_ATI 0x893B +#define GL_REG_27_ATI 0x893C +#define GL_REG_28_ATI 0x893D +#define GL_REG_29_ATI 0x893E +#define GL_REG_30_ATI 0x893F +#define GL_REG_31_ATI 0x8940 +#define GL_CON_0_ATI 0x8941 +#define GL_CON_1_ATI 0x8942 +#define GL_CON_2_ATI 0x8943 +#define GL_CON_3_ATI 0x8944 +#define GL_CON_4_ATI 0x8945 +#define GL_CON_5_ATI 0x8946 +#define GL_CON_6_ATI 0x8947 +#define GL_CON_7_ATI 0x8948 +#define GL_CON_8_ATI 0x8949 +#define GL_CON_9_ATI 0x894A +#define GL_CON_10_ATI 0x894B +#define GL_CON_11_ATI 0x894C +#define GL_CON_12_ATI 0x894D +#define GL_CON_13_ATI 0x894E +#define GL_CON_14_ATI 0x894F +#define GL_CON_15_ATI 0x8950 +#define GL_CON_16_ATI 0x8951 +#define GL_CON_17_ATI 0x8952 +#define GL_CON_18_ATI 0x8953 +#define GL_CON_19_ATI 0x8954 +#define GL_CON_20_ATI 0x8955 +#define GL_CON_21_ATI 0x8956 +#define GL_CON_22_ATI 0x8957 +#define GL_CON_23_ATI 0x8958 +#define GL_CON_24_ATI 0x8959 +#define GL_CON_25_ATI 0x895A +#define GL_CON_26_ATI 0x895B +#define GL_CON_27_ATI 0x895C +#define GL_CON_28_ATI 0x895D +#define GL_CON_29_ATI 0x895E +#define GL_CON_30_ATI 0x895F +#define GL_CON_31_ATI 0x8960 +#define GL_MOV_ATI 0x8961 +#define GL_ADD_ATI 0x8963 +#define GL_MUL_ATI 0x8964 +#define GL_SUB_ATI 0x8965 +#define GL_DOT3_ATI 0x8966 +#define GL_DOT4_ATI 0x8967 +#define GL_MAD_ATI 0x8968 +#define GL_LERP_ATI 0x8969 +#define GL_CND_ATI 0x896A +#define GL_CND0_ATI 0x896B +#define GL_DOT2_ADD_ATI 0x896C +#define GL_SECONDARY_INTERPOLATOR_ATI 0x896D +#define GL_NUM_FRAGMENT_REGISTERS_ATI 0x896E +#define GL_NUM_FRAGMENT_CONSTANTS_ATI 0x896F +#define GL_NUM_PASSES_ATI 0x8970 +#define GL_NUM_INSTRUCTIONS_PER_PASS_ATI 0x8971 +#define GL_NUM_INSTRUCTIONS_TOTAL_ATI 0x8972 +#define GL_NUM_INPUT_INTERPOLATOR_COMPONENTS_ATI 0x8973 +#define GL_NUM_LOOPBACK_COMPONENTS_ATI 0x8974 +#define GL_COLOR_ALPHA_PAIRING_ATI 0x8975 +#define GL_SWIZZLE_STR_ATI 0x8976 +#define GL_SWIZZLE_STQ_ATI 0x8977 +#define GL_SWIZZLE_STR_DR_ATI 0x8978 +#define GL_SWIZZLE_STQ_DQ_ATI 0x8979 +#define GL_SWIZZLE_STRQ_ATI 0x897A +#define GL_SWIZZLE_STRQ_DQ_ATI 0x897B +#define GL_RED_BIT_ATI 0x00000001 +#define GL_GREEN_BIT_ATI 0x00000002 +#define GL_BLUE_BIT_ATI 0x00000004 +#define GL_2X_BIT_ATI 0x00000001 +#define GL_4X_BIT_ATI 0x00000002 +#define GL_8X_BIT_ATI 0x00000004 +#define GL_HALF_BIT_ATI 0x00000008 +#define GL_QUARTER_BIT_ATI 0x00000010 +#define GL_EIGHTH_BIT_ATI 0x00000020 +#define GL_SATURATE_BIT_ATI 0x00000040 +#define GL_COMP_BIT_ATI 0x00000002 +#define GL_NEGATE_BIT_ATI 0x00000004 +#define GL_BIAS_BIT_ATI 0x00000008 +#endif + +#ifndef GL_ATI_pn_triangles +#define GL_PN_TRIANGLES_ATI 0x87F0 +#define GL_MAX_PN_TRIANGLES_TESSELATION_LEVEL_ATI 0x87F1 +#define GL_PN_TRIANGLES_POINT_MODE_ATI 0x87F2 +#define GL_PN_TRIANGLES_NORMAL_MODE_ATI 0x87F3 +#define GL_PN_TRIANGLES_TESSELATION_LEVEL_ATI 0x87F4 +#define GL_PN_TRIANGLES_POINT_MODE_LINEAR_ATI 0x87F5 +#define GL_PN_TRIANGLES_POINT_MODE_CUBIC_ATI 0x87F6 +#define GL_PN_TRIANGLES_NORMAL_MODE_LINEAR_ATI 0x87F7 +#define GL_PN_TRIANGLES_NORMAL_MODE_QUADRATIC_ATI 0x87F8 +#endif + +#ifndef GL_ATI_vertex_array_object +#define GL_STATIC_ATI 0x8760 +#define GL_DYNAMIC_ATI 0x8761 +#define GL_PRESERVE_ATI 0x8762 +#define GL_DISCARD_ATI 0x8763 +#define GL_OBJECT_BUFFER_SIZE_ATI 0x8764 +#define GL_OBJECT_BUFFER_USAGE_ATI 0x8765 +#define GL_ARRAY_OBJECT_BUFFER_ATI 0x8766 +#define GL_ARRAY_OBJECT_OFFSET_ATI 0x8767 +#endif + +#ifndef GL_EXT_vertex_shader +#define GL_VERTEX_SHADER_EXT 0x8780 +#define GL_VERTEX_SHADER_BINDING_EXT 0x8781 +#define GL_OP_INDEX_EXT 0x8782 +#define GL_OP_NEGATE_EXT 0x8783 +#define GL_OP_DOT3_EXT 0x8784 +#define GL_OP_DOT4_EXT 0x8785 +#define GL_OP_MUL_EXT 0x8786 +#define GL_OP_ADD_EXT 0x8787 +#define GL_OP_MADD_EXT 0x8788 +#define GL_OP_FRAC_EXT 0x8789 +#define GL_OP_MAX_EXT 0x878A +#define GL_OP_MIN_EXT 0x878B +#define GL_OP_SET_GE_EXT 0x878C +#define GL_OP_SET_LT_EXT 0x878D +#define GL_OP_CLAMP_EXT 0x878E +#define GL_OP_FLOOR_EXT 0x878F +#define GL_OP_ROUND_EXT 0x8790 +#define GL_OP_EXP_BASE_2_EXT 0x8791 +#define GL_OP_LOG_BASE_2_EXT 0x8792 +#define GL_OP_POWER_EXT 0x8793 +#define GL_OP_RECIP_EXT 0x8794 +#define GL_OP_RECIP_SQRT_EXT 0x8795 +#define GL_OP_SUB_EXT 0x8796 +#define GL_OP_CROSS_PRODUCT_EXT 0x8797 +#define GL_OP_MULTIPLY_MATRIX_EXT 0x8798 +#define GL_OP_MOV_EXT 0x8799 +#define GL_OUTPUT_VERTEX_EXT 0x879A +#define GL_OUTPUT_COLOR0_EXT 0x879B +#define GL_OUTPUT_COLOR1_EXT 0x879C +#define GL_OUTPUT_TEXTURE_COORD0_EXT 0x879D +#define GL_OUTPUT_TEXTURE_COORD1_EXT 0x879E +#define GL_OUTPUT_TEXTURE_COORD2_EXT 0x879F +#define GL_OUTPUT_TEXTURE_COORD3_EXT 0x87A0 +#define GL_OUTPUT_TEXTURE_COORD4_EXT 0x87A1 +#define GL_OUTPUT_TEXTURE_COORD5_EXT 0x87A2 +#define GL_OUTPUT_TEXTURE_COORD6_EXT 0x87A3 +#define GL_OUTPUT_TEXTURE_COORD7_EXT 0x87A4 +#define GL_OUTPUT_TEXTURE_COORD8_EXT 0x87A5 +#define GL_OUTPUT_TEXTURE_COORD9_EXT 0x87A6 +#define GL_OUTPUT_TEXTURE_COORD10_EXT 0x87A7 +#define GL_OUTPUT_TEXTURE_COORD11_EXT 0x87A8 +#define GL_OUTPUT_TEXTURE_COORD12_EXT 0x87A9 +#define GL_OUTPUT_TEXTURE_COORD13_EXT 0x87AA +#define GL_OUTPUT_TEXTURE_COORD14_EXT 0x87AB +#define GL_OUTPUT_TEXTURE_COORD15_EXT 0x87AC +#define GL_OUTPUT_TEXTURE_COORD16_EXT 0x87AD +#define GL_OUTPUT_TEXTURE_COORD17_EXT 0x87AE +#define GL_OUTPUT_TEXTURE_COORD18_EXT 0x87AF +#define GL_OUTPUT_TEXTURE_COORD19_EXT 0x87B0 +#define GL_OUTPUT_TEXTURE_COORD20_EXT 0x87B1 +#define GL_OUTPUT_TEXTURE_COORD21_EXT 0x87B2 +#define GL_OUTPUT_TEXTURE_COORD22_EXT 0x87B3 +#define GL_OUTPUT_TEXTURE_COORD23_EXT 0x87B4 +#define GL_OUTPUT_TEXTURE_COORD24_EXT 0x87B5 +#define GL_OUTPUT_TEXTURE_COORD25_EXT 0x87B6 +#define GL_OUTPUT_TEXTURE_COORD26_EXT 0x87B7 +#define GL_OUTPUT_TEXTURE_COORD27_EXT 0x87B8 +#define GL_OUTPUT_TEXTURE_COORD28_EXT 0x87B9 +#define GL_OUTPUT_TEXTURE_COORD29_EXT 0x87BA +#define GL_OUTPUT_TEXTURE_COORD30_EXT 0x87BB +#define GL_OUTPUT_TEXTURE_COORD31_EXT 0x87BC +#define GL_OUTPUT_FOG_EXT 0x87BD +#define GL_SCALAR_EXT 0x87BE +#define GL_VECTOR_EXT 0x87BF +#define GL_MATRIX_EXT 0x87C0 +#define GL_VARIANT_EXT 0x87C1 +#define GL_INVARIANT_EXT 0x87C2 +#define GL_LOCAL_CONSTANT_EXT 0x87C3 +#define GL_LOCAL_EXT 0x87C4 +#define GL_MAX_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87C5 +#define GL_MAX_VERTEX_SHADER_VARIANTS_EXT 0x87C6 +#define GL_MAX_VERTEX_SHADER_INVARIANTS_EXT 0x87C7 +#define GL_MAX_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87C8 +#define GL_MAX_VERTEX_SHADER_LOCALS_EXT 0x87C9 +#define GL_MAX_OPTIMIZED_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87CA +#define GL_MAX_OPTIMIZED_VERTEX_SHADER_VARIANTS_EXT 0x87CB +#define GL_MAX_OPTIMIZED_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87CC +#define GL_MAX_OPTIMIZED_VERTEX_SHADER_INVARIANTS_EXT 0x87CD +#define GL_MAX_OPTIMIZED_VERTEX_SHADER_LOCALS_EXT 0x87CE +#define GL_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87CF +#define GL_VERTEX_SHADER_VARIANTS_EXT 0x87D0 +#define GL_VERTEX_SHADER_INVARIANTS_EXT 0x87D1 +#define GL_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87D2 +#define GL_VERTEX_SHADER_LOCALS_EXT 0x87D3 +#define GL_VERTEX_SHADER_OPTIMIZED_EXT 0x87D4 +#define GL_X_EXT 0x87D5 +#define GL_Y_EXT 0x87D6 +#define GL_Z_EXT 0x87D7 +#define GL_W_EXT 0x87D8 +#define GL_NEGATIVE_X_EXT 0x87D9 +#define GL_NEGATIVE_Y_EXT 0x87DA +#define GL_NEGATIVE_Z_EXT 0x87DB +#define GL_NEGATIVE_W_EXT 0x87DC +#define GL_ZERO_EXT 0x87DD +#define GL_ONE_EXT 0x87DE +#define GL_NEGATIVE_ONE_EXT 0x87DF +#define GL_NORMALIZED_RANGE_EXT 0x87E0 +#define GL_FULL_RANGE_EXT 0x87E1 +#define GL_CURRENT_VERTEX_EXT 0x87E2 +#define GL_MVP_MATRIX_EXT 0x87E3 +#define GL_VARIANT_VALUE_EXT 0x87E4 +#define GL_VARIANT_DATATYPE_EXT 0x87E5 +#define GL_VARIANT_ARRAY_STRIDE_EXT 0x87E6 +#define GL_VARIANT_ARRAY_TYPE_EXT 0x87E7 +#define GL_VARIANT_ARRAY_EXT 0x87E8 +#define GL_VARIANT_ARRAY_POINTER_EXT 0x87E9 +#define GL_INVARIANT_VALUE_EXT 0x87EA +#define GL_INVARIANT_DATATYPE_EXT 0x87EB +#define GL_LOCAL_CONSTANT_VALUE_EXT 0x87EC +#define GL_LOCAL_CONSTANT_DATATYPE_EXT 0x87ED +#endif + +#ifndef GL_ATI_vertex_streams +#define GL_MAX_VERTEX_STREAMS_ATI 0x876B +#define GL_VERTEX_STREAM0_ATI 0x876C +#define GL_VERTEX_STREAM1_ATI 0x876D +#define GL_VERTEX_STREAM2_ATI 0x876E +#define GL_VERTEX_STREAM3_ATI 0x876F +#define GL_VERTEX_STREAM4_ATI 0x8770 +#define GL_VERTEX_STREAM5_ATI 0x8771 +#define GL_VERTEX_STREAM6_ATI 0x8772 +#define GL_VERTEX_STREAM7_ATI 0x8773 +#define GL_VERTEX_SOURCE_ATI 0x8774 +#endif + +#ifndef GL_ATI_element_array +#define GL_ELEMENT_ARRAY_ATI 0x8768 +#define GL_ELEMENT_ARRAY_TYPE_ATI 0x8769 +#define GL_ELEMENT_ARRAY_POINTER_ATI 0x876A +#endif + +#ifndef GL_SUN_mesh_array +#define GL_QUAD_MESH_SUN 0x8614 +#define GL_TRIANGLE_MESH_SUN 0x8615 +#endif + +#ifndef GL_SUN_slice_accum +#define GL_SLICE_ACCUM_SUN 0x85CC +#endif + +#ifndef GL_NV_multisample_filter_hint +#define GL_MULTISAMPLE_FILTER_HINT_NV 0x8534 +#endif + +#ifndef GL_NV_depth_clamp +#define GL_DEPTH_CLAMP_NV 0x864F +#endif + +#ifndef GL_NV_occlusion_query +#define GL_PIXEL_COUNTER_BITS_NV 0x8864 +#define GL_CURRENT_OCCLUSION_QUERY_ID_NV 0x8865 +#define GL_PIXEL_COUNT_NV 0x8866 +#define GL_PIXEL_COUNT_AVAILABLE_NV 0x8867 +#endif + +#ifndef GL_NV_point_sprite +#define GL_POINT_SPRITE_NV 0x8861 +#define GL_COORD_REPLACE_NV 0x8862 +#define GL_POINT_SPRITE_R_MODE_NV 0x8863 +#endif + +#ifndef GL_NV_texture_shader3 +#define GL_OFFSET_PROJECTIVE_TEXTURE_2D_NV 0x8850 +#define GL_OFFSET_PROJECTIVE_TEXTURE_2D_SCALE_NV 0x8851 +#define GL_OFFSET_PROJECTIVE_TEXTURE_RECTANGLE_NV 0x8852 +#define GL_OFFSET_PROJECTIVE_TEXTURE_RECTANGLE_SCALE_NV 0x8853 +#define GL_OFFSET_HILO_TEXTURE_2D_NV 0x8854 +#define GL_OFFSET_HILO_TEXTURE_RECTANGLE_NV 0x8855 +#define GL_OFFSET_HILO_PROJECTIVE_TEXTURE_2D_NV 0x8856 +#define GL_OFFSET_HILO_PROJECTIVE_TEXTURE_RECTANGLE_NV 0x8857 +#define GL_DEPENDENT_HILO_TEXTURE_2D_NV 0x8858 +#define GL_DEPENDENT_RGB_TEXTURE_3D_NV 0x8859 +#define GL_DEPENDENT_RGB_TEXTURE_CUBE_MAP_NV 0x885A +#define GL_DOT_PRODUCT_PASS_THROUGH_NV 0x885B +#define GL_DOT_PRODUCT_TEXTURE_1D_NV 0x885C +#define GL_DOT_PRODUCT_AFFINE_DEPTH_REPLACE_NV 0x885D +#define GL_HILO8_NV 0x885E +#define GL_SIGNED_HILO8_NV 0x885F +#define GL_FORCE_BLUE_TO_ONE_NV 0x8860 +#endif + +#ifndef GL_NV_vertex_program1_1 +#endif + +#ifndef GL_EXT_shadow_funcs +#endif + +#ifndef GL_EXT_stencil_two_side +#define GL_STENCIL_TEST_TWO_SIDE_EXT 0x8910 +#define GL_ACTIVE_STENCIL_FACE_EXT 0x8911 +#endif + +#ifndef GL_ATI_text_fragment_shader +#define GL_TEXT_FRAGMENT_SHADER_ATI 0x8200 +#endif + +#ifndef GL_APPLE_client_storage +#define GL_UNPACK_CLIENT_STORAGE_APPLE 0x85B2 +#endif + +#ifndef GL_APPLE_element_array +#define GL_ELEMENT_ARRAY_APPLE 0x8A0C +#define GL_ELEMENT_ARRAY_TYPE_APPLE 0x8A0D +#define GL_ELEMENT_ARRAY_POINTER_APPLE 0x8A0E +#endif + +#ifndef GL_APPLE_fence +#define GL_DRAW_PIXELS_APPLE 0x8A0A +#define GL_FENCE_APPLE 0x8A0B +#endif + +#ifndef GL_APPLE_vertex_array_object +#define GL_VERTEX_ARRAY_BINDING_APPLE 0x85B5 +#endif + +#ifndef GL_APPLE_vertex_array_range +#define GL_VERTEX_ARRAY_RANGE_APPLE 0x851D +#define GL_VERTEX_ARRAY_RANGE_LENGTH_APPLE 0x851E +#define GL_VERTEX_ARRAY_STORAGE_HINT_APPLE 0x851F +#define GL_VERTEX_ARRAY_RANGE_POINTER_APPLE 0x8521 +#define GL_STORAGE_CLIENT_APPLE 0x85B4 +#define GL_STORAGE_CACHED_APPLE 0x85BE +#define GL_STORAGE_SHARED_APPLE 0x85BF +#endif + +#ifndef GL_APPLE_ycbcr_422 +#define GL_YCBCR_422_APPLE 0x85B9 +#define GL_UNSIGNED_SHORT_8_8_APPLE 0x85BA +#define GL_UNSIGNED_SHORT_8_8_REV_APPLE 0x85BB +#endif + +#ifndef GL_S3_s3tc +#define GL_RGB_S3TC 0x83A0 +#define GL_RGB4_S3TC 0x83A1 +#define GL_RGBA_S3TC 0x83A2 +#define GL_RGBA4_S3TC 0x83A3 +#endif + +#ifndef GL_ATI_draw_buffers +#define GL_MAX_DRAW_BUFFERS_ATI 0x8824 +#define GL_DRAW_BUFFER0_ATI 0x8825 +#define GL_DRAW_BUFFER1_ATI 0x8826 +#define GL_DRAW_BUFFER2_ATI 0x8827 +#define GL_DRAW_BUFFER3_ATI 0x8828 +#define GL_DRAW_BUFFER4_ATI 0x8829 +#define GL_DRAW_BUFFER5_ATI 0x882A +#define GL_DRAW_BUFFER6_ATI 0x882B +#define GL_DRAW_BUFFER7_ATI 0x882C +#define GL_DRAW_BUFFER8_ATI 0x882D +#define GL_DRAW_BUFFER9_ATI 0x882E +#define GL_DRAW_BUFFER10_ATI 0x882F +#define GL_DRAW_BUFFER11_ATI 0x8830 +#define GL_DRAW_BUFFER12_ATI 0x8831 +#define GL_DRAW_BUFFER13_ATI 0x8832 +#define GL_DRAW_BUFFER14_ATI 0x8833 +#define GL_DRAW_BUFFER15_ATI 0x8834 +#endif + +#ifndef GL_ATI_pixel_format_float +#define GL_TYPE_RGBA_FLOAT_ATI 0x8820 +#define GL_COLOR_CLEAR_UNCLAMPED_VALUE_ATI 0x8835 +#endif + +#ifndef GL_ATI_texture_env_combine3 +#define GL_MODULATE_ADD_ATI 0x8744 +#define GL_MODULATE_SIGNED_ADD_ATI 0x8745 +#define GL_MODULATE_SUBTRACT_ATI 0x8746 +#endif + +#ifndef GL_ATI_texture_float +#define GL_RGBA_FLOAT32_ATI 0x8814 +#define GL_RGB_FLOAT32_ATI 0x8815 +#define GL_ALPHA_FLOAT32_ATI 0x8816 +#define GL_INTENSITY_FLOAT32_ATI 0x8817 +#define GL_LUMINANCE_FLOAT32_ATI 0x8818 +#define GL_LUMINANCE_ALPHA_FLOAT32_ATI 0x8819 +#define GL_RGBA_FLOAT16_ATI 0x881A +#define GL_RGB_FLOAT16_ATI 0x881B +#define GL_ALPHA_FLOAT16_ATI 0x881C +#define GL_INTENSITY_FLOAT16_ATI 0x881D +#define GL_LUMINANCE_FLOAT16_ATI 0x881E +#define GL_LUMINANCE_ALPHA_FLOAT16_ATI 0x881F +#endif + +#ifndef GL_NV_float_buffer +#define GL_FLOAT_R_NV 0x8880 +#define GL_FLOAT_RG_NV 0x8881 +#define GL_FLOAT_RGB_NV 0x8882 +#define GL_FLOAT_RGBA_NV 0x8883 +#define GL_FLOAT_R16_NV 0x8884 +#define GL_FLOAT_R32_NV 0x8885 +#define GL_FLOAT_RG16_NV 0x8886 +#define GL_FLOAT_RG32_NV 0x8887 +#define GL_FLOAT_RGB16_NV 0x8888 +#define GL_FLOAT_RGB32_NV 0x8889 +#define GL_FLOAT_RGBA16_NV 0x888A +#define GL_FLOAT_RGBA32_NV 0x888B +#define GL_TEXTURE_FLOAT_COMPONENTS_NV 0x888C +#define GL_FLOAT_CLEAR_COLOR_VALUE_NV 0x888D +#define GL_FLOAT_RGBA_MODE_NV 0x888E +#endif + +#ifndef GL_NV_fragment_program +#define GL_MAX_FRAGMENT_PROGRAM_LOCAL_PARAMETERS_NV 0x8868 +#define GL_FRAGMENT_PROGRAM_NV 0x8870 +#define GL_MAX_TEXTURE_COORDS_NV 0x8871 +#define GL_MAX_TEXTURE_IMAGE_UNITS_NV 0x8872 +#define GL_FRAGMENT_PROGRAM_BINDING_NV 0x8873 +#define GL_PROGRAM_ERROR_STRING_NV 0x8874 +#endif + +#ifndef GL_NV_half_float +#define GL_HALF_FLOAT_NV 0x140B +#endif + +#ifndef GL_NV_pixel_data_range +#define GL_WRITE_PIXEL_DATA_RANGE_NV 0x8878 +#define GL_READ_PIXEL_DATA_RANGE_NV 0x8879 +#define GL_WRITE_PIXEL_DATA_RANGE_LENGTH_NV 0x887A +#define GL_READ_PIXEL_DATA_RANGE_LENGTH_NV 0x887B +#define GL_WRITE_PIXEL_DATA_RANGE_POINTER_NV 0x887C +#define GL_READ_PIXEL_DATA_RANGE_POINTER_NV 0x887D +#endif + +#ifndef GL_NV_primitive_restart +#define GL_PRIMITIVE_RESTART_NV 0x8558 +#define GL_PRIMITIVE_RESTART_INDEX_NV 0x8559 +#endif + +#ifndef GL_NV_texture_expand_normal +#define GL_TEXTURE_UNSIGNED_REMAP_MODE_NV 0x888F +#endif + +#ifndef GL_NV_vertex_program2 +#endif + +#ifndef GL_ATI_map_object_buffer +#endif + +#ifndef GL_ATI_separate_stencil +#define GL_STENCIL_BACK_FUNC_ATI 0x8800 +#define GL_STENCIL_BACK_FAIL_ATI 0x8801 +#define GL_STENCIL_BACK_PASS_DEPTH_FAIL_ATI 0x8802 +#define GL_STENCIL_BACK_PASS_DEPTH_PASS_ATI 0x8803 +#endif + +#ifndef GL_ATI_vertex_attrib_array_object +#endif + +#ifndef GL_OES_read_format +#define GL_IMPLEMENTATION_COLOR_READ_TYPE_OES 0x8B9A +#define GL_IMPLEMENTATION_COLOR_READ_FORMAT_OES 0x8B9B +#endif + +#ifndef GL_EXT_depth_bounds_test +#define GL_DEPTH_BOUNDS_TEST_EXT 0x8890 +#define GL_DEPTH_BOUNDS_EXT 0x8891 +#endif + +#ifndef GL_EXT_texture_mirror_clamp +#define GL_MIRROR_CLAMP_EXT 0x8742 +#define GL_MIRROR_CLAMP_TO_EDGE_EXT 0x8743 +#define GL_MIRROR_CLAMP_TO_BORDER_EXT 0x8912 +#endif + +#ifndef GL_EXT_blend_equation_separate +#define GL_BLEND_EQUATION_RGB_EXT 0x8009 +#define GL_BLEND_EQUATION_ALPHA_EXT 0x883D +#endif + +#ifndef GL_MESA_pack_invert +#define GL_PACK_INVERT_MESA 0x8758 +#endif + +#ifndef GL_MESA_ycbcr_texture +#define GL_UNSIGNED_SHORT_8_8_MESA 0x85BA +#define GL_UNSIGNED_SHORT_8_8_REV_MESA 0x85BB +#define GL_YCBCR_MESA 0x8757 +#endif + +#ifndef GL_EXT_pixel_buffer_object +#define GL_PIXEL_PACK_BUFFER_EXT 0x88EB +#define GL_PIXEL_UNPACK_BUFFER_EXT 0x88EC +#define GL_PIXEL_PACK_BUFFER_BINDING_EXT 0x88ED +#define GL_PIXEL_UNPACK_BUFFER_BINDING_EXT 0x88EF +#endif + +#ifndef GL_NV_fragment_program_option +#endif + +#ifndef GL_NV_fragment_program2 +#define GL_MAX_PROGRAM_EXEC_INSTRUCTIONS_NV 0x88F4 +#define GL_MAX_PROGRAM_CALL_DEPTH_NV 0x88F5 +#define GL_MAX_PROGRAM_IF_DEPTH_NV 0x88F6 +#define GL_MAX_PROGRAM_LOOP_DEPTH_NV 0x88F7 +#define GL_MAX_PROGRAM_LOOP_COUNT_NV 0x88F8 +#endif + +#ifndef GL_NV_vertex_program2_option +/* reuse GL_MAX_PROGRAM_EXEC_INSTRUCTIONS_NV */ +/* reuse GL_MAX_PROGRAM_CALL_DEPTH_NV */ +#endif + +#ifndef GL_NV_vertex_program3 +/* reuse GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS_ARB */ +#endif + +#ifndef GL_EXT_framebuffer_object +#define GL_INVALID_FRAMEBUFFER_OPERATION_EXT 0x0506 +#define GL_MAX_RENDERBUFFER_SIZE_EXT 0x84E8 +#define GL_FRAMEBUFFER_BINDING_EXT 0x8CA6 +#define GL_RENDERBUFFER_BINDING_EXT 0x8CA7 +#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_TYPE_EXT 0x8CD0 +#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_NAME_EXT 0x8CD1 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LEVEL_EXT 0x8CD2 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_CUBE_MAP_FACE_EXT 0x8CD3 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_3D_ZOFFSET_EXT 0x8CD4 +#define GL_FRAMEBUFFER_COMPLETE_EXT 0x8CD5 +#define GL_FRAMEBUFFER_INCOMPLETE_ATTACHMENT_EXT 0x8CD6 +#define GL_FRAMEBUFFER_INCOMPLETE_MISSING_ATTACHMENT_EXT 0x8CD7 +#define GL_FRAMEBUFFER_INCOMPLETE_DIMENSIONS_EXT 0x8CD9 +#define GL_FRAMEBUFFER_INCOMPLETE_FORMATS_EXT 0x8CDA +#define GL_FRAMEBUFFER_INCOMPLETE_DRAW_BUFFER_EXT 0x8CDB +#define GL_FRAMEBUFFER_INCOMPLETE_READ_BUFFER_EXT 0x8CDC +#define GL_FRAMEBUFFER_UNSUPPORTED_EXT 0x8CDD +#define GL_MAX_COLOR_ATTACHMENTS_EXT 0x8CDF +#define GL_COLOR_ATTACHMENT0_EXT 0x8CE0 +#define GL_COLOR_ATTACHMENT1_EXT 0x8CE1 +#define GL_COLOR_ATTACHMENT2_EXT 0x8CE2 +#define GL_COLOR_ATTACHMENT3_EXT 0x8CE3 +#define GL_COLOR_ATTACHMENT4_EXT 0x8CE4 +#define GL_COLOR_ATTACHMENT5_EXT 0x8CE5 +#define GL_COLOR_ATTACHMENT6_EXT 0x8CE6 +#define GL_COLOR_ATTACHMENT7_EXT 0x8CE7 +#define GL_COLOR_ATTACHMENT8_EXT 0x8CE8 +#define GL_COLOR_ATTACHMENT9_EXT 0x8CE9 +#define GL_COLOR_ATTACHMENT10_EXT 0x8CEA +#define GL_COLOR_ATTACHMENT11_EXT 0x8CEB +#define GL_COLOR_ATTACHMENT12_EXT 0x8CEC +#define GL_COLOR_ATTACHMENT13_EXT 0x8CED +#define GL_COLOR_ATTACHMENT14_EXT 0x8CEE +#define GL_COLOR_ATTACHMENT15_EXT 0x8CEF +#define GL_DEPTH_ATTACHMENT_EXT 0x8D00 +#define GL_STENCIL_ATTACHMENT_EXT 0x8D20 +#define GL_FRAMEBUFFER_EXT 0x8D40 +#define GL_RENDERBUFFER_EXT 0x8D41 +#define GL_RENDERBUFFER_WIDTH_EXT 0x8D42 +#define GL_RENDERBUFFER_HEIGHT_EXT 0x8D43 +#define GL_RENDERBUFFER_INTERNAL_FORMAT_EXT 0x8D44 +#define GL_STENCIL_INDEX1_EXT 0x8D46 +#define GL_STENCIL_INDEX4_EXT 0x8D47 +#define GL_STENCIL_INDEX8_EXT 0x8D48 +#define GL_STENCIL_INDEX16_EXT 0x8D49 +#define GL_RENDERBUFFER_RED_SIZE_EXT 0x8D50 +#define GL_RENDERBUFFER_GREEN_SIZE_EXT 0x8D51 +#define GL_RENDERBUFFER_BLUE_SIZE_EXT 0x8D52 +#define GL_RENDERBUFFER_ALPHA_SIZE_EXT 0x8D53 +#define GL_RENDERBUFFER_DEPTH_SIZE_EXT 0x8D54 +#define GL_RENDERBUFFER_STENCIL_SIZE_EXT 0x8D55 +#endif + +#ifndef GL_GREMEDY_string_marker +#endif + +#ifndef GL_EXT_packed_depth_stencil +#define GL_DEPTH_STENCIL_EXT 0x84F9 +#define GL_UNSIGNED_INT_24_8_EXT 0x84FA +#define GL_DEPTH24_STENCIL8_EXT 0x88F0 +#define GL_TEXTURE_STENCIL_SIZE_EXT 0x88F1 +#endif + +#ifndef GL_EXT_stencil_clear_tag +#define GL_STENCIL_TAG_BITS_EXT 0x88F2 +#define GL_STENCIL_CLEAR_TAG_VALUE_EXT 0x88F3 +#endif + +#ifndef GL_EXT_texture_sRGB +#define GL_SRGB_EXT 0x8C40 +#define GL_SRGB8_EXT 0x8C41 +#define GL_SRGB_ALPHA_EXT 0x8C42 +#define GL_SRGB8_ALPHA8_EXT 0x8C43 +#define GL_SLUMINANCE_ALPHA_EXT 0x8C44 +#define GL_SLUMINANCE8_ALPHA8_EXT 0x8C45 +#define GL_SLUMINANCE_EXT 0x8C46 +#define GL_SLUMINANCE8_EXT 0x8C47 +#define GL_COMPRESSED_SRGB_EXT 0x8C48 +#define GL_COMPRESSED_SRGB_ALPHA_EXT 0x8C49 +#define GL_COMPRESSED_SLUMINANCE_EXT 0x8C4A +#define GL_COMPRESSED_SLUMINANCE_ALPHA_EXT 0x8C4B +#define GL_COMPRESSED_SRGB_S3TC_DXT1_EXT 0x8C4C +#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT1_EXT 0x8C4D +#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT3_EXT 0x8C4E +#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT5_EXT 0x8C4F +#endif + +#ifndef GL_EXT_framebuffer_blit +#define GL_READ_FRAMEBUFFER_EXT 0x8CA8 +#define GL_DRAW_FRAMEBUFFER_EXT 0x8CA9 +#define GL_DRAW_FRAMEBUFFER_BINDING_EXT GL_FRAMEBUFFER_BINDING_EXT +#define GL_READ_FRAMEBUFFER_BINDING_EXT 0x8CAA +#endif + +#ifndef GL_EXT_framebuffer_multisample +#define GL_RENDERBUFFER_SAMPLES_EXT 0x8CAB +#define GL_FRAMEBUFFER_INCOMPLETE_MULTISAMPLE_EXT 0x8D56 +#define GL_MAX_SAMPLES_EXT 0x8D57 +#endif + +#ifndef GL_MESAX_texture_stack +#define GL_TEXTURE_1D_STACK_MESAX 0x8759 +#define GL_TEXTURE_2D_STACK_MESAX 0x875A +#define GL_PROXY_TEXTURE_1D_STACK_MESAX 0x875B +#define GL_PROXY_TEXTURE_2D_STACK_MESAX 0x875C +#define GL_TEXTURE_1D_STACK_BINDING_MESAX 0x875D +#define GL_TEXTURE_2D_STACK_BINDING_MESAX 0x875E +#endif + +#ifndef GL_EXT_timer_query +#define GL_TIME_ELAPSED_EXT 0x88BF +#endif + +#ifndef GL_EXT_gpu_program_parameters +#endif + +#ifndef GL_APPLE_flush_buffer_range +#define GL_BUFFER_SERIALIZED_MODIFY_APPLE 0x8A12 +#define GL_BUFFER_FLUSHING_UNMAP_APPLE 0x8A13 +#endif + +#ifndef GL_NV_gpu_program4 +#define GL_MIN_PROGRAM_TEXEL_OFFSET_NV 0x8904 +#define GL_MAX_PROGRAM_TEXEL_OFFSET_NV 0x8905 +#define GL_PROGRAM_ATTRIB_COMPONENTS_NV 0x8906 +#define GL_PROGRAM_RESULT_COMPONENTS_NV 0x8907 +#define GL_MAX_PROGRAM_ATTRIB_COMPONENTS_NV 0x8908 +#define GL_MAX_PROGRAM_RESULT_COMPONENTS_NV 0x8909 +#define GL_MAX_PROGRAM_GENERIC_ATTRIBS_NV 0x8DA5 +#define GL_MAX_PROGRAM_GENERIC_RESULTS_NV 0x8DA6 +#endif + +#ifndef GL_NV_geometry_program4 +#define GL_LINES_ADJACENCY_EXT 0x000A +#define GL_LINE_STRIP_ADJACENCY_EXT 0x000B +#define GL_TRIANGLES_ADJACENCY_EXT 0x000C +#define GL_TRIANGLE_STRIP_ADJACENCY_EXT 0x000D +#define GL_GEOMETRY_PROGRAM_NV 0x8C26 +#define GL_MAX_PROGRAM_OUTPUT_VERTICES_NV 0x8C27 +#define GL_MAX_PROGRAM_TOTAL_OUTPUT_COMPONENTS_NV 0x8C28 +#define GL_GEOMETRY_VERTICES_OUT_EXT 0x8DDA +#define GL_GEOMETRY_INPUT_TYPE_EXT 0x8DDB +#define GL_GEOMETRY_OUTPUT_TYPE_EXT 0x8DDC +#define GL_MAX_GEOMETRY_TEXTURE_IMAGE_UNITS_EXT 0x8C29 +#define GL_FRAMEBUFFER_ATTACHMENT_LAYERED_EXT 0x8DA7 +#define GL_FRAMEBUFFER_INCOMPLETE_LAYER_TARGETS_EXT 0x8DA8 +#define GL_FRAMEBUFFER_INCOMPLETE_LAYER_COUNT_EXT 0x8DA9 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LAYER_EXT 0x8CD4 +#define GL_PROGRAM_POINT_SIZE_EXT 0x8642 +#endif + +#ifndef GL_EXT_geometry_shader4 +#define GL_GEOMETRY_SHADER_EXT 0x8DD9 +/* reuse GL_GEOMETRY_VERTICES_OUT_EXT */ +/* reuse GL_GEOMETRY_INPUT_TYPE_EXT */ +/* reuse GL_GEOMETRY_OUTPUT_TYPE_EXT */ +/* reuse GL_MAX_GEOMETRY_TEXTURE_IMAGE_UNITS_EXT */ +#define GL_MAX_GEOMETRY_VARYING_COMPONENTS_EXT 0x8DDD +#define GL_MAX_VERTEX_VARYING_COMPONENTS_EXT 0x8DDE +#define GL_MAX_VARYING_COMPONENTS_EXT 0x8B4B +#define GL_MAX_GEOMETRY_UNIFORM_COMPONENTS_EXT 0x8DDF +#define GL_MAX_GEOMETRY_OUTPUT_VERTICES_EXT 0x8DE0 +#define GL_MAX_GEOMETRY_TOTAL_OUTPUT_COMPONENTS_EXT 0x8DE1 +/* reuse GL_LINES_ADJACENCY_EXT */ +/* reuse GL_LINE_STRIP_ADJACENCY_EXT */ +/* reuse GL_TRIANGLES_ADJACENCY_EXT */ +/* reuse GL_TRIANGLE_STRIP_ADJACENCY_EXT */ +/* reuse GL_FRAMEBUFFER_INCOMPLETE_LAYER_TARGETS_EXT */ +/* reuse GL_FRAMEBUFFER_INCOMPLETE_LAYER_COUNT_EXT */ +/* reuse GL_FRAMEBUFFER_ATTACHMENT_LAYERED_EXT */ +/* reuse GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LAYER_EXT */ +/* reuse GL_PROGRAM_POINT_SIZE_EXT */ +#endif + +#ifndef GL_NV_vertex_program4 +#define GL_VERTEX_ATTRIB_ARRAY_INTEGER_NV 0x88FD +#endif + +#ifndef GL_EXT_gpu_shader4 +#define GL_SAMPLER_1D_ARRAY_EXT 0x8DC0 +#define GL_SAMPLER_2D_ARRAY_EXT 0x8DC1 +#define GL_SAMPLER_BUFFER_EXT 0x8DC2 +#define GL_SAMPLER_1D_ARRAY_SHADOW_EXT 0x8DC3 +#define GL_SAMPLER_2D_ARRAY_SHADOW_EXT 0x8DC4 +#define GL_SAMPLER_CUBE_SHADOW_EXT 0x8DC5 +#define GL_UNSIGNED_INT_VEC2_EXT 0x8DC6 +#define GL_UNSIGNED_INT_VEC3_EXT 0x8DC7 +#define GL_UNSIGNED_INT_VEC4_EXT 0x8DC8 +#define GL_INT_SAMPLER_1D_EXT 0x8DC9 +#define GL_INT_SAMPLER_2D_EXT 0x8DCA +#define GL_INT_SAMPLER_3D_EXT 0x8DCB +#define GL_INT_SAMPLER_CUBE_EXT 0x8DCC +#define GL_INT_SAMPLER_2D_RECT_EXT 0x8DCD +#define GL_INT_SAMPLER_1D_ARRAY_EXT 0x8DCE +#define GL_INT_SAMPLER_2D_ARRAY_EXT 0x8DCF +#define GL_INT_SAMPLER_BUFFER_EXT 0x8DD0 +#define GL_UNSIGNED_INT_SAMPLER_1D_EXT 0x8DD1 +#define GL_UNSIGNED_INT_SAMPLER_2D_EXT 0x8DD2 +#define GL_UNSIGNED_INT_SAMPLER_3D_EXT 0x8DD3 +#define GL_UNSIGNED_INT_SAMPLER_CUBE_EXT 0x8DD4 +#define GL_UNSIGNED_INT_SAMPLER_2D_RECT_EXT 0x8DD5 +#define GL_UNSIGNED_INT_SAMPLER_1D_ARRAY_EXT 0x8DD6 +#define GL_UNSIGNED_INT_SAMPLER_2D_ARRAY_EXT 0x8DD7 +#define GL_UNSIGNED_INT_SAMPLER_BUFFER_EXT 0x8DD8 +#endif + +#ifndef GL_EXT_draw_instanced +#endif + +#ifndef GL_EXT_packed_float +#define GL_R11F_G11F_B10F_EXT 0x8C3A +#define GL_UNSIGNED_INT_10F_11F_11F_REV_EXT 0x8C3B +#define GL_RGBA_SIGNED_COMPONENTS_EXT 0x8C3C +#endif + +#ifndef GL_EXT_texture_array +#define GL_TEXTURE_1D_ARRAY_EXT 0x8C18 +#define GL_PROXY_TEXTURE_1D_ARRAY_EXT 0x8C19 +#define GL_TEXTURE_2D_ARRAY_EXT 0x8C1A +#define GL_PROXY_TEXTURE_2D_ARRAY_EXT 0x8C1B +#define GL_TEXTURE_BINDING_1D_ARRAY_EXT 0x8C1C +#define GL_TEXTURE_BINDING_2D_ARRAY_EXT 0x8C1D +#define GL_MAX_ARRAY_TEXTURE_LAYERS_EXT 0x88FF +#define GL_COMPARE_REF_DEPTH_TO_TEXTURE_EXT 0x884E +/* reuse GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LAYER_EXT */ +#endif + +#ifndef GL_EXT_texture_buffer_object +#define GL_TEXTURE_BUFFER_EXT 0x8C2A +#define GL_MAX_TEXTURE_BUFFER_SIZE_EXT 0x8C2B +#define GL_TEXTURE_BINDING_BUFFER_EXT 0x8C2C +#define GL_TEXTURE_BUFFER_DATA_STORE_BINDING_EXT 0x8C2D +#define GL_TEXTURE_BUFFER_FORMAT_EXT 0x8C2E +#endif + +#ifndef GL_EXT_texture_compression_latc +#define GL_COMPRESSED_LUMINANCE_LATC1_EXT 0x8C70 +#define GL_COMPRESSED_SIGNED_LUMINANCE_LATC1_EXT 0x8C71 +#define GL_COMPRESSED_LUMINANCE_ALPHA_LATC2_EXT 0x8C72 +#define GL_COMPRESSED_SIGNED_LUMINANCE_ALPHA_LATC2_EXT 0x8C73 +#endif + +#ifndef GL_EXT_texture_compression_rgtc +#define GL_COMPRESSED_RED_RGTC1_EXT 0x8DBB +#define GL_COMPRESSED_SIGNED_RED_RGTC1_EXT 0x8DBC +#define GL_COMPRESSED_RED_GREEN_RGTC2_EXT 0x8DBD +#define GL_COMPRESSED_SIGNED_RED_GREEN_RGTC2_EXT 0x8DBE +#endif + +#ifndef GL_EXT_texture_shared_exponent +#define GL_RGB9_E5_EXT 0x8C3D +#define GL_UNSIGNED_INT_5_9_9_9_REV_EXT 0x8C3E +#define GL_TEXTURE_SHARED_SIZE_EXT 0x8C3F +#endif + +#ifndef GL_NV_depth_buffer_float +#define GL_DEPTH_COMPONENT32F_NV 0x8DAB +#define GL_DEPTH32F_STENCIL8_NV 0x8DAC +#define GL_FLOAT_32_UNSIGNED_INT_24_8_REV_NV 0x8DAD +#define GL_DEPTH_BUFFER_FLOAT_MODE_NV 0x8DAF +#endif + +#ifndef GL_NV_fragment_program4 +#endif + +#ifndef GL_NV_framebuffer_multisample_coverage +#define GL_RENDERBUFFER_COVERAGE_SAMPLES_NV 0x8CAB +#define GL_RENDERBUFFER_COLOR_SAMPLES_NV 0x8E10 +#define GL_MAX_MULTISAMPLE_COVERAGE_MODES_NV 0x8E11 +#define GL_MULTISAMPLE_COVERAGE_MODES_NV 0x8E12 +#endif + +#ifndef GL_EXT_framebuffer_sRGB +#define GL_FRAMEBUFFER_SRGB_EXT 0x8DB9 +#define GL_FRAMEBUFFER_SRGB_CAPABLE_EXT 0x8DBA +#endif + +#ifndef GL_NV_geometry_shader4 +#endif + +#ifndef GL_NV_parameter_buffer_object +#define GL_MAX_PROGRAM_PARAMETER_BUFFER_BINDINGS_NV 0x8DA0 +#define GL_MAX_PROGRAM_PARAMETER_BUFFER_SIZE_NV 0x8DA1 +#define GL_VERTEX_PROGRAM_PARAMETER_BUFFER_NV 0x8DA2 +#define GL_GEOMETRY_PROGRAM_PARAMETER_BUFFER_NV 0x8DA3 +#define GL_FRAGMENT_PROGRAM_PARAMETER_BUFFER_NV 0x8DA4 +#endif + +#ifndef GL_EXT_draw_buffers2 +#endif + +#ifndef GL_NV_transform_feedback +#define GL_BACK_PRIMARY_COLOR_NV 0x8C77 +#define GL_BACK_SECONDARY_COLOR_NV 0x8C78 +#define GL_TEXTURE_COORD_NV 0x8C79 +#define GL_CLIP_DISTANCE_NV 0x8C7A +#define GL_VERTEX_ID_NV 0x8C7B +#define GL_PRIMITIVE_ID_NV 0x8C7C +#define GL_GENERIC_ATTRIB_NV 0x8C7D +#define GL_TRANSFORM_FEEDBACK_ATTRIBS_NV 0x8C7E +#define GL_TRANSFORM_FEEDBACK_BUFFER_MODE_NV 0x8C7F +#define GL_MAX_TRANSFORM_FEEDBACK_SEPARATE_COMPONENTS_NV 0x8C80 +#define GL_ACTIVE_VARYINGS_NV 0x8C81 +#define GL_ACTIVE_VARYING_MAX_LENGTH_NV 0x8C82 +#define GL_TRANSFORM_FEEDBACK_VARYINGS_NV 0x8C83 +#define GL_TRANSFORM_FEEDBACK_BUFFER_START_NV 0x8C84 +#define GL_TRANSFORM_FEEDBACK_BUFFER_SIZE_NV 0x8C85 +#define GL_TRANSFORM_FEEDBACK_RECORD_NV 0x8C86 +#define GL_PRIMITIVES_GENERATED_NV 0x8C87 +#define GL_TRANSFORM_FEEDBACK_PRIMITIVES_WRITTEN_NV 0x8C88 +#define GL_RASTERIZER_DISCARD_NV 0x8C89 +#define GL_MAX_TRANSFORM_FEEDBACK_INTERLEAVED_ATTRIBS_NV 0x8C8A +#define GL_MAX_TRANSFORM_FEEDBACK_SEPARATE_ATTRIBS_NV 0x8C8B +#define GL_INTERLEAVED_ATTRIBS_NV 0x8C8C +#define GL_SEPARATE_ATTRIBS_NV 0x8C8D +#define GL_TRANSFORM_FEEDBACK_BUFFER_NV 0x8C8E +#define GL_TRANSFORM_FEEDBACK_BUFFER_BINDING_NV 0x8C8F +#define GL_LAYER_NV 0x8DAA +#define GL_NEXT_BUFFER_NV -2 +#define GL_SKIP_COMPONENTS4_NV -3 +#define GL_SKIP_COMPONENTS3_NV -4 +#define GL_SKIP_COMPONENTS2_NV -5 +#define GL_SKIP_COMPONENTS1_NV -6 +#endif + +#ifndef GL_EXT_bindable_uniform +#define GL_MAX_VERTEX_BINDABLE_UNIFORMS_EXT 0x8DE2 +#define GL_MAX_FRAGMENT_BINDABLE_UNIFORMS_EXT 0x8DE3 +#define GL_MAX_GEOMETRY_BINDABLE_UNIFORMS_EXT 0x8DE4 +#define GL_MAX_BINDABLE_UNIFORM_SIZE_EXT 0x8DED +#define GL_UNIFORM_BUFFER_EXT 0x8DEE +#define GL_UNIFORM_BUFFER_BINDING_EXT 0x8DEF +#endif + +#ifndef GL_EXT_texture_integer +#define GL_RGBA32UI_EXT 0x8D70 +#define GL_RGB32UI_EXT 0x8D71 +#define GL_ALPHA32UI_EXT 0x8D72 +#define GL_INTENSITY32UI_EXT 0x8D73 +#define GL_LUMINANCE32UI_EXT 0x8D74 +#define GL_LUMINANCE_ALPHA32UI_EXT 0x8D75 +#define GL_RGBA16UI_EXT 0x8D76 +#define GL_RGB16UI_EXT 0x8D77 +#define GL_ALPHA16UI_EXT 0x8D78 +#define GL_INTENSITY16UI_EXT 0x8D79 +#define GL_LUMINANCE16UI_EXT 0x8D7A +#define GL_LUMINANCE_ALPHA16UI_EXT 0x8D7B +#define GL_RGBA8UI_EXT 0x8D7C +#define GL_RGB8UI_EXT 0x8D7D +#define GL_ALPHA8UI_EXT 0x8D7E +#define GL_INTENSITY8UI_EXT 0x8D7F +#define GL_LUMINANCE8UI_EXT 0x8D80 +#define GL_LUMINANCE_ALPHA8UI_EXT 0x8D81 +#define GL_RGBA32I_EXT 0x8D82 +#define GL_RGB32I_EXT 0x8D83 +#define GL_ALPHA32I_EXT 0x8D84 +#define GL_INTENSITY32I_EXT 0x8D85 +#define GL_LUMINANCE32I_EXT 0x8D86 +#define GL_LUMINANCE_ALPHA32I_EXT 0x8D87 +#define GL_RGBA16I_EXT 0x8D88 +#define GL_RGB16I_EXT 0x8D89 +#define GL_ALPHA16I_EXT 0x8D8A +#define GL_INTENSITY16I_EXT 0x8D8B +#define GL_LUMINANCE16I_EXT 0x8D8C +#define GL_LUMINANCE_ALPHA16I_EXT 0x8D8D +#define GL_RGBA8I_EXT 0x8D8E +#define GL_RGB8I_EXT 0x8D8F +#define GL_ALPHA8I_EXT 0x8D90 +#define GL_INTENSITY8I_EXT 0x8D91 +#define GL_LUMINANCE8I_EXT 0x8D92 +#define GL_LUMINANCE_ALPHA8I_EXT 0x8D93 +#define GL_RED_INTEGER_EXT 0x8D94 +#define GL_GREEN_INTEGER_EXT 0x8D95 +#define GL_BLUE_INTEGER_EXT 0x8D96 +#define GL_ALPHA_INTEGER_EXT 0x8D97 +#define GL_RGB_INTEGER_EXT 0x8D98 +#define GL_RGBA_INTEGER_EXT 0x8D99 +#define GL_BGR_INTEGER_EXT 0x8D9A +#define GL_BGRA_INTEGER_EXT 0x8D9B +#define GL_LUMINANCE_INTEGER_EXT 0x8D9C +#define GL_LUMINANCE_ALPHA_INTEGER_EXT 0x8D9D +#define GL_RGBA_INTEGER_MODE_EXT 0x8D9E +#endif + +#ifndef GL_GREMEDY_frame_terminator +#endif + +#ifndef GL_NV_conditional_render +#define GL_QUERY_WAIT_NV 0x8E13 +#define GL_QUERY_NO_WAIT_NV 0x8E14 +#define GL_QUERY_BY_REGION_WAIT_NV 0x8E15 +#define GL_QUERY_BY_REGION_NO_WAIT_NV 0x8E16 +#endif + +#ifndef GL_NV_present_video +#define GL_FRAME_NV 0x8E26 +#define GL_FIELDS_NV 0x8E27 +#define GL_CURRENT_TIME_NV 0x8E28 +#define GL_NUM_FILL_STREAMS_NV 0x8E29 +#define GL_PRESENT_TIME_NV 0x8E2A +#define GL_PRESENT_DURATION_NV 0x8E2B +#endif + +#ifndef GL_EXT_transform_feedback +#define GL_TRANSFORM_FEEDBACK_BUFFER_EXT 0x8C8E +#define GL_TRANSFORM_FEEDBACK_BUFFER_START_EXT 0x8C84 +#define GL_TRANSFORM_FEEDBACK_BUFFER_SIZE_EXT 0x8C85 +#define GL_TRANSFORM_FEEDBACK_BUFFER_BINDING_EXT 0x8C8F +#define GL_INTERLEAVED_ATTRIBS_EXT 0x8C8C +#define GL_SEPARATE_ATTRIBS_EXT 0x8C8D +#define GL_PRIMITIVES_GENERATED_EXT 0x8C87 +#define GL_TRANSFORM_FEEDBACK_PRIMITIVES_WRITTEN_EXT 0x8C88 +#define GL_RASTERIZER_DISCARD_EXT 0x8C89 +#define GL_MAX_TRANSFORM_FEEDBACK_INTERLEAVED_COMPONENTS_EXT 0x8C8A +#define GL_MAX_TRANSFORM_FEEDBACK_SEPARATE_ATTRIBS_EXT 0x8C8B +#define GL_MAX_TRANSFORM_FEEDBACK_SEPARATE_COMPONENTS_EXT 0x8C80 +#define GL_TRANSFORM_FEEDBACK_VARYINGS_EXT 0x8C83 +#define GL_TRANSFORM_FEEDBACK_BUFFER_MODE_EXT 0x8C7F +#define GL_TRANSFORM_FEEDBACK_VARYING_MAX_LENGTH_EXT 0x8C76 +#endif + +#ifndef GL_EXT_direct_state_access +#define GL_PROGRAM_MATRIX_EXT 0x8E2D +#define GL_TRANSPOSE_PROGRAM_MATRIX_EXT 0x8E2E +#define GL_PROGRAM_MATRIX_STACK_DEPTH_EXT 0x8E2F +#endif + +#ifndef GL_EXT_vertex_array_bgra +/* reuse GL_BGRA */ +#endif + +#ifndef GL_EXT_texture_swizzle +#define GL_TEXTURE_SWIZZLE_R_EXT 0x8E42 +#define GL_TEXTURE_SWIZZLE_G_EXT 0x8E43 +#define GL_TEXTURE_SWIZZLE_B_EXT 0x8E44 +#define GL_TEXTURE_SWIZZLE_A_EXT 0x8E45 +#define GL_TEXTURE_SWIZZLE_RGBA_EXT 0x8E46 +#endif + +#ifndef GL_NV_explicit_multisample +#define GL_SAMPLE_POSITION_NV 0x8E50 +#define GL_SAMPLE_MASK_NV 0x8E51 +#define GL_SAMPLE_MASK_VALUE_NV 0x8E52 +#define GL_TEXTURE_BINDING_RENDERBUFFER_NV 0x8E53 +#define GL_TEXTURE_RENDERBUFFER_DATA_STORE_BINDING_NV 0x8E54 +#define GL_TEXTURE_RENDERBUFFER_NV 0x8E55 +#define GL_SAMPLER_RENDERBUFFER_NV 0x8E56 +#define GL_INT_SAMPLER_RENDERBUFFER_NV 0x8E57 +#define GL_UNSIGNED_INT_SAMPLER_RENDERBUFFER_NV 0x8E58 +#define GL_MAX_SAMPLE_MASK_WORDS_NV 0x8E59 +#endif + +#ifndef GL_NV_transform_feedback2 +#define GL_TRANSFORM_FEEDBACK_NV 0x8E22 +#define GL_TRANSFORM_FEEDBACK_BUFFER_PAUSED_NV 0x8E23 +#define GL_TRANSFORM_FEEDBACK_BUFFER_ACTIVE_NV 0x8E24 +#define GL_TRANSFORM_FEEDBACK_BINDING_NV 0x8E25 +#endif + +#ifndef GL_ATI_meminfo +#define GL_VBO_FREE_MEMORY_ATI 0x87FB +#define GL_TEXTURE_FREE_MEMORY_ATI 0x87FC +#define GL_RENDERBUFFER_FREE_MEMORY_ATI 0x87FD +#endif + +#ifndef GL_AMD_performance_monitor +#define GL_COUNTER_TYPE_AMD 0x8BC0 +#define GL_COUNTER_RANGE_AMD 0x8BC1 +#define GL_UNSIGNED_INT64_AMD 0x8BC2 +#define GL_PERCENTAGE_AMD 0x8BC3 +#define GL_PERFMON_RESULT_AVAILABLE_AMD 0x8BC4 +#define GL_PERFMON_RESULT_SIZE_AMD 0x8BC5 +#define GL_PERFMON_RESULT_AMD 0x8BC6 +#endif + +#ifndef GL_AMD_texture_texture4 +#endif + +#ifndef GL_AMD_vertex_shader_tesselator +#define GL_SAMPLER_BUFFER_AMD 0x9001 +#define GL_INT_SAMPLER_BUFFER_AMD 0x9002 +#define GL_UNSIGNED_INT_SAMPLER_BUFFER_AMD 0x9003 +#define GL_TESSELLATION_MODE_AMD 0x9004 +#define GL_TESSELLATION_FACTOR_AMD 0x9005 +#define GL_DISCRETE_AMD 0x9006 +#define GL_CONTINUOUS_AMD 0x9007 +#endif + +#ifndef GL_EXT_provoking_vertex +#define GL_QUADS_FOLLOW_PROVOKING_VERTEX_CONVENTION_EXT 0x8E4C +#define GL_FIRST_VERTEX_CONVENTION_EXT 0x8E4D +#define GL_LAST_VERTEX_CONVENTION_EXT 0x8E4E +#define GL_PROVOKING_VERTEX_EXT 0x8E4F +#endif + +#ifndef GL_EXT_texture_snorm +#define GL_ALPHA_SNORM 0x9010 +#define GL_LUMINANCE_SNORM 0x9011 +#define GL_LUMINANCE_ALPHA_SNORM 0x9012 +#define GL_INTENSITY_SNORM 0x9013 +#define GL_ALPHA8_SNORM 0x9014 +#define GL_LUMINANCE8_SNORM 0x9015 +#define GL_LUMINANCE8_ALPHA8_SNORM 0x9016 +#define GL_INTENSITY8_SNORM 0x9017 +#define GL_ALPHA16_SNORM 0x9018 +#define GL_LUMINANCE16_SNORM 0x9019 +#define GL_LUMINANCE16_ALPHA16_SNORM 0x901A +#define GL_INTENSITY16_SNORM 0x901B +/* reuse GL_RED_SNORM */ +/* reuse GL_RG_SNORM */ +/* reuse GL_RGB_SNORM */ +/* reuse GL_RGBA_SNORM */ +/* reuse GL_R8_SNORM */ +/* reuse GL_RG8_SNORM */ +/* reuse GL_RGB8_SNORM */ +/* reuse GL_RGBA8_SNORM */ +/* reuse GL_R16_SNORM */ +/* reuse GL_RG16_SNORM */ +/* reuse GL_RGB16_SNORM */ +/* reuse GL_RGBA16_SNORM */ +/* reuse GL_SIGNED_NORMALIZED */ +#endif + +#ifndef GL_AMD_draw_buffers_blend +#endif + +#ifndef GL_APPLE_texture_range +#define GL_TEXTURE_RANGE_LENGTH_APPLE 0x85B7 +#define GL_TEXTURE_RANGE_POINTER_APPLE 0x85B8 +#define GL_TEXTURE_STORAGE_HINT_APPLE 0x85BC +#define GL_STORAGE_PRIVATE_APPLE 0x85BD +/* reuse GL_STORAGE_CACHED_APPLE */ +/* reuse GL_STORAGE_SHARED_APPLE */ +#endif + +#ifndef GL_APPLE_float_pixels +#define GL_HALF_APPLE 0x140B +#define GL_RGBA_FLOAT32_APPLE 0x8814 +#define GL_RGB_FLOAT32_APPLE 0x8815 +#define GL_ALPHA_FLOAT32_APPLE 0x8816 +#define GL_INTENSITY_FLOAT32_APPLE 0x8817 +#define GL_LUMINANCE_FLOAT32_APPLE 0x8818 +#define GL_LUMINANCE_ALPHA_FLOAT32_APPLE 0x8819 +#define GL_RGBA_FLOAT16_APPLE 0x881A +#define GL_RGB_FLOAT16_APPLE 0x881B +#define GL_ALPHA_FLOAT16_APPLE 0x881C +#define GL_INTENSITY_FLOAT16_APPLE 0x881D +#define GL_LUMINANCE_FLOAT16_APPLE 0x881E +#define GL_LUMINANCE_ALPHA_FLOAT16_APPLE 0x881F +#define GL_COLOR_FLOAT_APPLE 0x8A0F +#endif + +#ifndef GL_APPLE_vertex_program_evaluators +#define GL_VERTEX_ATTRIB_MAP1_APPLE 0x8A00 +#define GL_VERTEX_ATTRIB_MAP2_APPLE 0x8A01 +#define GL_VERTEX_ATTRIB_MAP1_SIZE_APPLE 0x8A02 +#define GL_VERTEX_ATTRIB_MAP1_COEFF_APPLE 0x8A03 +#define GL_VERTEX_ATTRIB_MAP1_ORDER_APPLE 0x8A04 +#define GL_VERTEX_ATTRIB_MAP1_DOMAIN_APPLE 0x8A05 +#define GL_VERTEX_ATTRIB_MAP2_SIZE_APPLE 0x8A06 +#define GL_VERTEX_ATTRIB_MAP2_COEFF_APPLE 0x8A07 +#define GL_VERTEX_ATTRIB_MAP2_ORDER_APPLE 0x8A08 +#define GL_VERTEX_ATTRIB_MAP2_DOMAIN_APPLE 0x8A09 +#endif + +#ifndef GL_APPLE_aux_depth_stencil +#define GL_AUX_DEPTH_STENCIL_APPLE 0x8A14 +#endif + +#ifndef GL_APPLE_object_purgeable +#define GL_BUFFER_OBJECT_APPLE 0x85B3 +#define GL_RELEASED_APPLE 0x8A19 +#define GL_VOLATILE_APPLE 0x8A1A +#define GL_RETAINED_APPLE 0x8A1B +#define GL_UNDEFINED_APPLE 0x8A1C +#define GL_PURGEABLE_APPLE 0x8A1D +#endif + +#ifndef GL_APPLE_row_bytes +#define GL_PACK_ROW_BYTES_APPLE 0x8A15 +#define GL_UNPACK_ROW_BYTES_APPLE 0x8A16 +#endif + +#ifndef GL_APPLE_rgb_422 +#define GL_RGB_422_APPLE 0x8A1F +/* reuse GL_UNSIGNED_SHORT_8_8_APPLE */ +/* reuse GL_UNSIGNED_SHORT_8_8_REV_APPLE */ +#endif + +#ifndef GL_NV_video_capture +#define GL_VIDEO_BUFFER_NV 0x9020 +#define GL_VIDEO_BUFFER_BINDING_NV 0x9021 +#define GL_FIELD_UPPER_NV 0x9022 +#define GL_FIELD_LOWER_NV 0x9023 +#define GL_NUM_VIDEO_CAPTURE_STREAMS_NV 0x9024 +#define GL_NEXT_VIDEO_CAPTURE_BUFFER_STATUS_NV 0x9025 +#define GL_VIDEO_CAPTURE_TO_422_SUPPORTED_NV 0x9026 +#define GL_LAST_VIDEO_CAPTURE_STATUS_NV 0x9027 +#define GL_VIDEO_BUFFER_PITCH_NV 0x9028 +#define GL_VIDEO_COLOR_CONVERSION_MATRIX_NV 0x9029 +#define GL_VIDEO_COLOR_CONVERSION_MAX_NV 0x902A +#define GL_VIDEO_COLOR_CONVERSION_MIN_NV 0x902B +#define GL_VIDEO_COLOR_CONVERSION_OFFSET_NV 0x902C +#define GL_VIDEO_BUFFER_INTERNAL_FORMAT_NV 0x902D +#define GL_PARTIAL_SUCCESS_NV 0x902E +#define GL_SUCCESS_NV 0x902F +#define GL_FAILURE_NV 0x9030 +#define GL_YCBYCR8_422_NV 0x9031 +#define GL_YCBAYCR8A_4224_NV 0x9032 +#define GL_Z6Y10Z6CB10Z6Y10Z6CR10_422_NV 0x9033 +#define GL_Z6Y10Z6CB10Z6A10Z6Y10Z6CR10Z6A10_4224_NV 0x9034 +#define GL_Z4Y12Z4CB12Z4Y12Z4CR12_422_NV 0x9035 +#define GL_Z4Y12Z4CB12Z4A12Z4Y12Z4CR12Z4A12_4224_NV 0x9036 +#define GL_Z4Y12Z4CB12Z4CR12_444_NV 0x9037 +#define GL_VIDEO_CAPTURE_FRAME_WIDTH_NV 0x9038 +#define GL_VIDEO_CAPTURE_FRAME_HEIGHT_NV 0x9039 +#define GL_VIDEO_CAPTURE_FIELD_UPPER_HEIGHT_NV 0x903A +#define GL_VIDEO_CAPTURE_FIELD_LOWER_HEIGHT_NV 0x903B +#define GL_VIDEO_CAPTURE_SURFACE_ORIGIN_NV 0x903C +#endif + +#ifndef GL_NV_copy_image +#endif + +#ifndef GL_EXT_separate_shader_objects +#define GL_ACTIVE_PROGRAM_EXT 0x8B8D +#endif + +#ifndef GL_NV_parameter_buffer_object2 +#endif + +#ifndef GL_NV_shader_buffer_load +#define GL_BUFFER_GPU_ADDRESS_NV 0x8F1D +#define GL_GPU_ADDRESS_NV 0x8F34 +#define GL_MAX_SHADER_BUFFER_ADDRESS_NV 0x8F35 +#endif + +#ifndef GL_NV_vertex_buffer_unified_memory +#define GL_VERTEX_ATTRIB_ARRAY_UNIFIED_NV 0x8F1E +#define GL_ELEMENT_ARRAY_UNIFIED_NV 0x8F1F +#define GL_VERTEX_ATTRIB_ARRAY_ADDRESS_NV 0x8F20 +#define GL_VERTEX_ARRAY_ADDRESS_NV 0x8F21 +#define GL_NORMAL_ARRAY_ADDRESS_NV 0x8F22 +#define GL_COLOR_ARRAY_ADDRESS_NV 0x8F23 +#define GL_INDEX_ARRAY_ADDRESS_NV 0x8F24 +#define GL_TEXTURE_COORD_ARRAY_ADDRESS_NV 0x8F25 +#define GL_EDGE_FLAG_ARRAY_ADDRESS_NV 0x8F26 +#define GL_SECONDARY_COLOR_ARRAY_ADDRESS_NV 0x8F27 +#define GL_FOG_COORD_ARRAY_ADDRESS_NV 0x8F28 +#define GL_ELEMENT_ARRAY_ADDRESS_NV 0x8F29 +#define GL_VERTEX_ATTRIB_ARRAY_LENGTH_NV 0x8F2A +#define GL_VERTEX_ARRAY_LENGTH_NV 0x8F2B +#define GL_NORMAL_ARRAY_LENGTH_NV 0x8F2C +#define GL_COLOR_ARRAY_LENGTH_NV 0x8F2D +#define GL_INDEX_ARRAY_LENGTH_NV 0x8F2E +#define GL_TEXTURE_COORD_ARRAY_LENGTH_NV 0x8F2F +#define GL_EDGE_FLAG_ARRAY_LENGTH_NV 0x8F30 +#define GL_SECONDARY_COLOR_ARRAY_LENGTH_NV 0x8F31 +#define GL_FOG_COORD_ARRAY_LENGTH_NV 0x8F32 +#define GL_ELEMENT_ARRAY_LENGTH_NV 0x8F33 +#define GL_DRAW_INDIRECT_UNIFIED_NV 0x8F40 +#define GL_DRAW_INDIRECT_ADDRESS_NV 0x8F41 +#define GL_DRAW_INDIRECT_LENGTH_NV 0x8F42 +#endif + +#ifndef GL_NV_texture_barrier +#endif + +#ifndef GL_AMD_shader_stencil_export +#endif + +#ifndef GL_AMD_seamless_cubemap_per_texture +/* reuse GL_TEXTURE_CUBE_MAP_SEAMLESS_ARB */ +#endif + +#ifndef GL_AMD_conservative_depth +#endif + +#ifndef GL_EXT_shader_image_load_store +#define GL_MAX_IMAGE_UNITS_EXT 0x8F38 +#define GL_MAX_COMBINED_IMAGE_UNITS_AND_FRAGMENT_OUTPUTS_EXT 0x8F39 +#define GL_IMAGE_BINDING_NAME_EXT 0x8F3A +#define GL_IMAGE_BINDING_LEVEL_EXT 0x8F3B +#define GL_IMAGE_BINDING_LAYERED_EXT 0x8F3C +#define GL_IMAGE_BINDING_LAYER_EXT 0x8F3D +#define GL_IMAGE_BINDING_ACCESS_EXT 0x8F3E +#define GL_IMAGE_1D_EXT 0x904C +#define GL_IMAGE_2D_EXT 0x904D +#define GL_IMAGE_3D_EXT 0x904E +#define GL_IMAGE_2D_RECT_EXT 0x904F +#define GL_IMAGE_CUBE_EXT 0x9050 +#define GL_IMAGE_BUFFER_EXT 0x9051 +#define GL_IMAGE_1D_ARRAY_EXT 0x9052 +#define GL_IMAGE_2D_ARRAY_EXT 0x9053 +#define GL_IMAGE_CUBE_MAP_ARRAY_EXT 0x9054 +#define GL_IMAGE_2D_MULTISAMPLE_EXT 0x9055 +#define GL_IMAGE_2D_MULTISAMPLE_ARRAY_EXT 0x9056 +#define GL_INT_IMAGE_1D_EXT 0x9057 +#define GL_INT_IMAGE_2D_EXT 0x9058 +#define GL_INT_IMAGE_3D_EXT 0x9059 +#define GL_INT_IMAGE_2D_RECT_EXT 0x905A +#define GL_INT_IMAGE_CUBE_EXT 0x905B +#define GL_INT_IMAGE_BUFFER_EXT 0x905C +#define GL_INT_IMAGE_1D_ARRAY_EXT 0x905D +#define GL_INT_IMAGE_2D_ARRAY_EXT 0x905E +#define GL_INT_IMAGE_CUBE_MAP_ARRAY_EXT 0x905F +#define GL_INT_IMAGE_2D_MULTISAMPLE_EXT 0x9060 +#define GL_INT_IMAGE_2D_MULTISAMPLE_ARRAY_EXT 0x9061 +#define GL_UNSIGNED_INT_IMAGE_1D_EXT 0x9062 +#define GL_UNSIGNED_INT_IMAGE_2D_EXT 0x9063 +#define GL_UNSIGNED_INT_IMAGE_3D_EXT 0x9064 +#define GL_UNSIGNED_INT_IMAGE_2D_RECT_EXT 0x9065 +#define GL_UNSIGNED_INT_IMAGE_CUBE_EXT 0x9066 +#define GL_UNSIGNED_INT_IMAGE_BUFFER_EXT 0x9067 +#define GL_UNSIGNED_INT_IMAGE_1D_ARRAY_EXT 0x9068 +#define GL_UNSIGNED_INT_IMAGE_2D_ARRAY_EXT 0x9069 +#define GL_UNSIGNED_INT_IMAGE_CUBE_MAP_ARRAY_EXT 0x906A +#define GL_UNSIGNED_INT_IMAGE_2D_MULTISAMPLE_EXT 0x906B +#define GL_UNSIGNED_INT_IMAGE_2D_MULTISAMPLE_ARRAY_EXT 0x906C +#define GL_MAX_IMAGE_SAMPLES_EXT 0x906D +#define GL_IMAGE_BINDING_FORMAT_EXT 0x906E +#define GL_VERTEX_ATTRIB_ARRAY_BARRIER_BIT_EXT 0x00000001 +#define GL_ELEMENT_ARRAY_BARRIER_BIT_EXT 0x00000002 +#define GL_UNIFORM_BARRIER_BIT_EXT 0x00000004 +#define GL_TEXTURE_FETCH_BARRIER_BIT_EXT 0x00000008 +#define GL_SHADER_IMAGE_ACCESS_BARRIER_BIT_EXT 0x00000020 +#define GL_COMMAND_BARRIER_BIT_EXT 0x00000040 +#define GL_PIXEL_BUFFER_BARRIER_BIT_EXT 0x00000080 +#define GL_TEXTURE_UPDATE_BARRIER_BIT_EXT 0x00000100 +#define GL_BUFFER_UPDATE_BARRIER_BIT_EXT 0x00000200 +#define GL_FRAMEBUFFER_BARRIER_BIT_EXT 0x00000400 +#define GL_TRANSFORM_FEEDBACK_BARRIER_BIT_EXT 0x00000800 +#define GL_ATOMIC_COUNTER_BARRIER_BIT_EXT 0x00001000 +#define GL_ALL_BARRIER_BITS_EXT 0xFFFFFFFF +#endif + +#ifndef GL_EXT_vertex_attrib_64bit +/* reuse GL_DOUBLE */ +#define GL_DOUBLE_VEC2_EXT 0x8FFC +#define GL_DOUBLE_VEC3_EXT 0x8FFD +#define GL_DOUBLE_VEC4_EXT 0x8FFE +#define GL_DOUBLE_MAT2_EXT 0x8F46 +#define GL_DOUBLE_MAT3_EXT 0x8F47 +#define GL_DOUBLE_MAT4_EXT 0x8F48 +#define GL_DOUBLE_MAT2x3_EXT 0x8F49 +#define GL_DOUBLE_MAT2x4_EXT 0x8F4A +#define GL_DOUBLE_MAT3x2_EXT 0x8F4B +#define GL_DOUBLE_MAT3x4_EXT 0x8F4C +#define GL_DOUBLE_MAT4x2_EXT 0x8F4D +#define GL_DOUBLE_MAT4x3_EXT 0x8F4E +#endif + +#ifndef GL_NV_gpu_program5 +#define GL_MAX_GEOMETRY_PROGRAM_INVOCATIONS_NV 0x8E5A +#define GL_MIN_FRAGMENT_INTERPOLATION_OFFSET_NV 0x8E5B +#define GL_MAX_FRAGMENT_INTERPOLATION_OFFSET_NV 0x8E5C +#define GL_FRAGMENT_PROGRAM_INTERPOLATION_OFFSET_BITS_NV 0x8E5D +#define GL_MAX_PROGRAM_SUBROUTINE_PARAMETERS_NV 0x8F44 +#define GL_MAX_PROGRAM_SUBROUTINE_NUM_NV 0x8F45 +#endif + +#ifndef GL_NV_gpu_shader5 +#define GL_INT64_NV 0x140E +#define GL_UNSIGNED_INT64_NV 0x140F +#define GL_INT8_NV 0x8FE0 +#define GL_INT8_VEC2_NV 0x8FE1 +#define GL_INT8_VEC3_NV 0x8FE2 +#define GL_INT8_VEC4_NV 0x8FE3 +#define GL_INT16_NV 0x8FE4 +#define GL_INT16_VEC2_NV 0x8FE5 +#define GL_INT16_VEC3_NV 0x8FE6 +#define GL_INT16_VEC4_NV 0x8FE7 +#define GL_INT64_VEC2_NV 0x8FE9 +#define GL_INT64_VEC3_NV 0x8FEA +#define GL_INT64_VEC4_NV 0x8FEB +#define GL_UNSIGNED_INT8_NV 0x8FEC +#define GL_UNSIGNED_INT8_VEC2_NV 0x8FED +#define GL_UNSIGNED_INT8_VEC3_NV 0x8FEE +#define GL_UNSIGNED_INT8_VEC4_NV 0x8FEF +#define GL_UNSIGNED_INT16_NV 0x8FF0 +#define GL_UNSIGNED_INT16_VEC2_NV 0x8FF1 +#define GL_UNSIGNED_INT16_VEC3_NV 0x8FF2 +#define GL_UNSIGNED_INT16_VEC4_NV 0x8FF3 +#define GL_UNSIGNED_INT64_VEC2_NV 0x8FF5 +#define GL_UNSIGNED_INT64_VEC3_NV 0x8FF6 +#define GL_UNSIGNED_INT64_VEC4_NV 0x8FF7 +#define GL_FLOAT16_NV 0x8FF8 +#define GL_FLOAT16_VEC2_NV 0x8FF9 +#define GL_FLOAT16_VEC3_NV 0x8FFA +#define GL_FLOAT16_VEC4_NV 0x8FFB +/* reuse GL_PATCHES */ +#endif + +#ifndef GL_NV_shader_buffer_store +#define GL_SHADER_GLOBAL_ACCESS_BARRIER_BIT_NV 0x00000010 +/* reuse GL_READ_WRITE */ +/* reuse GL_WRITE_ONLY */ +#endif + +#ifndef GL_NV_tessellation_program5 +#define GL_MAX_PROGRAM_PATCH_ATTRIBS_NV 0x86D8 +#define GL_TESS_CONTROL_PROGRAM_NV 0x891E +#define GL_TESS_EVALUATION_PROGRAM_NV 0x891F +#define GL_TESS_CONTROL_PROGRAM_PARAMETER_BUFFER_NV 0x8C74 +#define GL_TESS_EVALUATION_PROGRAM_PARAMETER_BUFFER_NV 0x8C75 +#endif + +#ifndef GL_NV_vertex_attrib_integer_64bit +/* reuse GL_INT64_NV */ +/* reuse GL_UNSIGNED_INT64_NV */ +#endif + +#ifndef GL_NV_multisample_coverage +#define GL_COVERAGE_SAMPLES_NV 0x80A9 +#define GL_COLOR_SAMPLES_NV 0x8E20 +#endif + +#ifndef GL_AMD_name_gen_delete +#define GL_DATA_BUFFER_AMD 0x9151 +#define GL_PERFORMANCE_MONITOR_AMD 0x9152 +#define GL_QUERY_OBJECT_AMD 0x9153 +#define GL_VERTEX_ARRAY_OBJECT_AMD 0x9154 +#define GL_SAMPLER_OBJECT_AMD 0x9155 +#endif + +#ifndef GL_AMD_debug_output +#define GL_MAX_DEBUG_LOGGED_MESSAGES_AMD 0x9144 +#define GL_DEBUG_LOGGED_MESSAGES_AMD 0x9145 +#define GL_DEBUG_SEVERITY_HIGH_AMD 0x9146 +#define GL_DEBUG_SEVERITY_MEDIUM_AMD 0x9147 +#define GL_DEBUG_SEVERITY_LOW_AMD 0x9148 +#define GL_DEBUG_CATEGORY_API_ERROR_AMD 0x9149 +#define GL_DEBUG_CATEGORY_WINDOW_SYSTEM_AMD 0x914A +#define GL_DEBUG_CATEGORY_DEPRECATION_AMD 0x914B +#define GL_DEBUG_CATEGORY_UNDEFINED_BEHAVIOR_AMD 0x914C +#define GL_DEBUG_CATEGORY_PERFORMANCE_AMD 0x914D +#define GL_DEBUG_CATEGORY_SHADER_COMPILER_AMD 0x914E +#define GL_DEBUG_CATEGORY_APPLICATION_AMD 0x914F +#define GL_DEBUG_CATEGORY_OTHER_AMD 0x9150 +#endif + +#ifndef GL_NV_vdpau_interop +#define GL_SURFACE_STATE_NV 0x86EB +#define GL_SURFACE_REGISTERED_NV 0x86FD +#define GL_SURFACE_MAPPED_NV 0x8700 +#define GL_WRITE_DISCARD_NV 0x88BE +#endif + +#ifndef GL_AMD_transform_feedback3_lines_triangles +#endif + + +/*************************************************************/ + +#include +#ifndef GL_VERSION_2_0 +/* GL type for program/shader text */ +typedef char GLchar; +#endif + +#ifndef GL_VERSION_1_5 +/* GL types for handling large vertex buffer objects */ +typedef ptrdiff_t GLintptr; +typedef ptrdiff_t GLsizeiptr; +#endif + +#ifndef GL_ARB_vertex_buffer_object +/* GL types for handling large vertex buffer objects */ +typedef ptrdiff_t GLintptrARB; +typedef ptrdiff_t GLsizeiptrARB; +#endif + +#ifndef GL_ARB_shader_objects +/* GL types for program/shader text and shader object handles */ +typedef char GLcharARB; +typedef unsigned int GLhandleARB; +#endif + +/* GL type for "half" precision (s10e5) float data in host memory */ +#ifndef GL_ARB_half_float_pixel +typedef unsigned short GLhalfARB; +#endif + +#ifndef GL_NV_half_float +typedef unsigned short GLhalfNV; +#endif + +#ifndef GLEXT_64_TYPES_DEFINED +/* This code block is duplicated in glxext.h, so must be protected */ +#define GLEXT_64_TYPES_DEFINED +/* Define int32_t, int64_t, and uint64_t types for UST/MSC */ +/* (as used in the GL_EXT_timer_query extension). */ +#if defined(__STDC_VERSION__) && __STDC_VERSION__ >= 199901L +#include +#elif defined(__sun__) || defined(__digital__) +#include +#if defined(__STDC__) +#if defined(__arch64__) || defined(_LP64) +typedef long int int64_t; +typedef unsigned long int uint64_t; +#else +typedef long long int int64_t; +typedef unsigned long long int uint64_t; +#endif /* __arch64__ */ +#endif /* __STDC__ */ +#elif defined( __VMS ) || defined(__sgi) +#include +#elif defined(__SCO__) || defined(__USLC__) +#include +#elif defined(__UNIXOS2__) || defined(__SOL64__) +typedef long int int32_t; +typedef long long int int64_t; +typedef unsigned long long int uint64_t; +#elif defined(_WIN32) && defined(__GNUC__) +#include +#elif defined(_WIN32) +typedef __int32 int32_t; +typedef __int64 int64_t; +typedef unsigned __int64 uint64_t; +#else +/* Fallback if nothing above works */ +#include +#endif +#endif + +#ifndef GL_EXT_timer_query +typedef int64_t GLint64EXT; +typedef uint64_t GLuint64EXT; +#endif + +#ifndef GL_ARB_sync +typedef int64_t GLint64; +typedef uint64_t GLuint64; +typedef struct __GLsync *GLsync; +#endif + +#ifndef GL_ARB_cl_event +/* These incomplete types let us declare types compatible with OpenCL's cl_context and cl_event */ +struct _cl_context; +struct _cl_event; +#endif + +#ifndef GL_ARB_debug_output +typedef void (APIENTRY *GLDEBUGPROCARB)(GLenum source,GLenum type,GLuint id,GLenum severity,GLsizei length,const GLchar *message,GLvoid *userParam); +#endif + +#ifndef GL_AMD_debug_output +typedef void (APIENTRY *GLDEBUGPROCAMD)(GLuint id,GLenum category,GLenum severity,GLsizei length,const GLchar *message,GLvoid *userParam); +#endif + +#ifndef GL_NV_vdpau_interop +typedef GLintptr GLvdpauSurfaceNV; +#endif + +#ifndef GL_VERSION_1_2 +#define GL_VERSION_1_2 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendColor (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha); +GLAPI void APIENTRY glBlendEquation (GLenum mode); +GLAPI void APIENTRY glDrawRangeElements (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices); +GLAPI void APIENTRY glTexImage3D (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glTexSubImage3D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glCopyTexSubImage3D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBLENDCOLORPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha); +typedef void (APIENTRYP PFNGLBLENDEQUATIONPROC) (GLenum mode); +typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices); +typedef void (APIENTRYP PFNGLTEXIMAGE3DPROC) (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +#endif + +#ifndef GL_VERSION_1_2_DEPRECATED +#define GL_VERSION_1_2_DEPRECATED 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glColorTable (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); +GLAPI void APIENTRY glColorTableParameterfv (GLenum target, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glColorTableParameteriv (GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glCopyColorTable (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); +GLAPI void APIENTRY glGetColorTable (GLenum target, GLenum format, GLenum type, GLvoid *table); +GLAPI void APIENTRY glGetColorTableParameterfv (GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetColorTableParameteriv (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glColorSubTable (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data); +GLAPI void APIENTRY glCopyColorSubTable (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); +GLAPI void APIENTRY glConvolutionFilter1D (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image); +GLAPI void APIENTRY glConvolutionFilter2D (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image); +GLAPI void APIENTRY glConvolutionParameterf (GLenum target, GLenum pname, GLfloat params); +GLAPI void APIENTRY glConvolutionParameterfv (GLenum target, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glConvolutionParameteri (GLenum target, GLenum pname, GLint params); +GLAPI void APIENTRY glConvolutionParameteriv (GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glCopyConvolutionFilter1D (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); +GLAPI void APIENTRY glCopyConvolutionFilter2D (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glGetConvolutionFilter (GLenum target, GLenum format, GLenum type, GLvoid *image); +GLAPI void APIENTRY glGetConvolutionParameterfv (GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetConvolutionParameteriv (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetSeparableFilter (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span); +GLAPI void APIENTRY glSeparableFilter2D (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column); +GLAPI void APIENTRY glGetHistogram (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +GLAPI void APIENTRY glGetHistogramParameterfv (GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetHistogramParameteriv (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetMinmax (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +GLAPI void APIENTRY glGetMinmaxParameterfv (GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetMinmaxParameteriv (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glHistogram (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); +GLAPI void APIENTRY glMinmax (GLenum target, GLenum internalformat, GLboolean sink); +GLAPI void APIENTRY glResetHistogram (GLenum target); +GLAPI void APIENTRY glResetMinmax (GLenum target); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); +typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLCOPYCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLGETCOLORTABLEPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table); +typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image); +typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFPROC) (GLenum target, GLenum pname, GLfloat params); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIPROC) (GLenum target, GLenum pname, GLint params); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image); +typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETSEPARABLEFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span); +typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column); +typedef void (APIENTRYP PFNGLGETHISTOGRAMPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETMINMAXPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLHISTOGRAMPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); +typedef void (APIENTRYP PFNGLMINMAXPROC) (GLenum target, GLenum internalformat, GLboolean sink); +typedef void (APIENTRYP PFNGLRESETHISTOGRAMPROC) (GLenum target); +typedef void (APIENTRYP PFNGLRESETMINMAXPROC) (GLenum target); +#endif + +#ifndef GL_VERSION_1_3 +#define GL_VERSION_1_3 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glActiveTexture (GLenum texture); +GLAPI void APIENTRY glSampleCoverage (GLclampf value, GLboolean invert); +GLAPI void APIENTRY glCompressedTexImage3D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data); +GLAPI void APIENTRY glCompressedTexImage2D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data); +GLAPI void APIENTRY glCompressedTexImage1D (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data); +GLAPI void APIENTRY glCompressedTexSubImage3D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data); +GLAPI void APIENTRY glCompressedTexSubImage2D (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data); +GLAPI void APIENTRY glCompressedTexSubImage1D (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data); +GLAPI void APIENTRY glGetCompressedTexImage (GLenum target, GLint level, GLvoid *img); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLACTIVETEXTUREPROC) (GLenum texture); +typedef void (APIENTRYP PFNGLSAMPLECOVERAGEPROC) (GLclampf value, GLboolean invert); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint level, GLvoid *img); +#endif + +#ifndef GL_VERSION_1_3_DEPRECATED +#define GL_VERSION_1_3_DEPRECATED 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glClientActiveTexture (GLenum texture); +GLAPI void APIENTRY glMultiTexCoord1d (GLenum target, GLdouble s); +GLAPI void APIENTRY glMultiTexCoord1dv (GLenum target, const GLdouble *v); +GLAPI void APIENTRY glMultiTexCoord1f (GLenum target, GLfloat s); +GLAPI void APIENTRY glMultiTexCoord1fv (GLenum target, const GLfloat *v); +GLAPI void APIENTRY glMultiTexCoord1i (GLenum target, GLint s); +GLAPI void APIENTRY glMultiTexCoord1iv (GLenum target, const GLint *v); +GLAPI void APIENTRY glMultiTexCoord1s (GLenum target, GLshort s); +GLAPI void APIENTRY glMultiTexCoord1sv (GLenum target, const GLshort *v); +GLAPI void APIENTRY glMultiTexCoord2d (GLenum target, GLdouble s, GLdouble t); +GLAPI void APIENTRY glMultiTexCoord2dv (GLenum target, const GLdouble *v); +GLAPI void APIENTRY glMultiTexCoord2f (GLenum target, GLfloat s, GLfloat t); +GLAPI void APIENTRY glMultiTexCoord2fv (GLenum target, const GLfloat *v); +GLAPI void APIENTRY glMultiTexCoord2i (GLenum target, GLint s, GLint t); +GLAPI void APIENTRY glMultiTexCoord2iv (GLenum target, const GLint *v); +GLAPI void APIENTRY glMultiTexCoord2s (GLenum target, GLshort s, GLshort t); +GLAPI void APIENTRY glMultiTexCoord2sv (GLenum target, const GLshort *v); +GLAPI void APIENTRY glMultiTexCoord3d (GLenum target, GLdouble s, GLdouble t, GLdouble r); +GLAPI void APIENTRY glMultiTexCoord3dv (GLenum target, const GLdouble *v); +GLAPI void APIENTRY glMultiTexCoord3f (GLenum target, GLfloat s, GLfloat t, GLfloat r); +GLAPI void APIENTRY glMultiTexCoord3fv (GLenum target, const GLfloat *v); +GLAPI void APIENTRY glMultiTexCoord3i (GLenum target, GLint s, GLint t, GLint r); +GLAPI void APIENTRY glMultiTexCoord3iv (GLenum target, const GLint *v); +GLAPI void APIENTRY glMultiTexCoord3s (GLenum target, GLshort s, GLshort t, GLshort r); +GLAPI void APIENTRY glMultiTexCoord3sv (GLenum target, const GLshort *v); +GLAPI void APIENTRY glMultiTexCoord4d (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q); +GLAPI void APIENTRY glMultiTexCoord4dv (GLenum target, const GLdouble *v); +GLAPI void APIENTRY glMultiTexCoord4f (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q); +GLAPI void APIENTRY glMultiTexCoord4fv (GLenum target, const GLfloat *v); +GLAPI void APIENTRY glMultiTexCoord4i (GLenum target, GLint s, GLint t, GLint r, GLint q); +GLAPI void APIENTRY glMultiTexCoord4iv (GLenum target, const GLint *v); +GLAPI void APIENTRY glMultiTexCoord4s (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q); +GLAPI void APIENTRY glMultiTexCoord4sv (GLenum target, const GLshort *v); +GLAPI void APIENTRY glLoadTransposeMatrixf (const GLfloat *m); +GLAPI void APIENTRY glLoadTransposeMatrixd (const GLdouble *m); +GLAPI void APIENTRY glMultTransposeMatrixf (const GLfloat *m); +GLAPI void APIENTRY glMultTransposeMatrixd (const GLdouble *m); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCLIENTACTIVETEXTUREPROC) (GLenum texture); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1DPROC) (GLenum target, GLdouble s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVPROC) (GLenum target, const GLdouble *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1FPROC) (GLenum target, GLfloat s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1FVPROC) (GLenum target, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1IPROC) (GLenum target, GLint s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1IVPROC) (GLenum target, const GLint *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1SPROC) (GLenum target, GLshort s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1SVPROC) (GLenum target, const GLshort *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2DPROC) (GLenum target, GLdouble s, GLdouble t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2DVPROC) (GLenum target, const GLdouble *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2FPROC) (GLenum target, GLfloat s, GLfloat t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2FVPROC) (GLenum target, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2IPROC) (GLenum target, GLint s, GLint t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2IVPROC) (GLenum target, const GLint *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2SPROC) (GLenum target, GLshort s, GLshort t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2SVPROC) (GLenum target, const GLshort *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3DVPROC) (GLenum target, const GLdouble *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3FVPROC) (GLenum target, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3IPROC) (GLenum target, GLint s, GLint t, GLint r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3IVPROC) (GLenum target, const GLint *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3SPROC) (GLenum target, GLshort s, GLshort t, GLshort r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3SVPROC) (GLenum target, const GLshort *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4DVPROC) (GLenum target, const GLdouble *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4FVPROC) (GLenum target, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4IPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4IVPROC) (GLenum target, const GLint *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4SPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4SVPROC) (GLenum target, const GLshort *v); +typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXFPROC) (const GLfloat *m); +typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXDPROC) (const GLdouble *m); +typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXFPROC) (const GLfloat *m); +typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXDPROC) (const GLdouble *m); +#endif + +#ifndef GL_VERSION_1_4 +#define GL_VERSION_1_4 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendFuncSeparate (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); +GLAPI void APIENTRY glMultiDrawArrays (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); +GLAPI void APIENTRY glMultiDrawElements (GLenum mode, const GLsizei *count, GLenum type, const GLvoid* *indices, GLsizei primcount); +GLAPI void APIENTRY glPointParameterf (GLenum pname, GLfloat param); +GLAPI void APIENTRY glPointParameterfv (GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glPointParameteri (GLenum pname, GLint param); +GLAPI void APIENTRY glPointParameteriv (GLenum pname, const GLint *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid* *indices, GLsizei primcount); +typedef void (APIENTRYP PFNGLPOINTPARAMETERFPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLPOINTPARAMETERFVPROC) (GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLPOINTPARAMETERIPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLPOINTPARAMETERIVPROC) (GLenum pname, const GLint *params); +#endif + +#ifndef GL_VERSION_1_4_DEPRECATED +#define GL_VERSION_1_4_DEPRECATED 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFogCoordf (GLfloat coord); +GLAPI void APIENTRY glFogCoordfv (const GLfloat *coord); +GLAPI void APIENTRY glFogCoordd (GLdouble coord); +GLAPI void APIENTRY glFogCoorddv (const GLdouble *coord); +GLAPI void APIENTRY glFogCoordPointer (GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glSecondaryColor3b (GLbyte red, GLbyte green, GLbyte blue); +GLAPI void APIENTRY glSecondaryColor3bv (const GLbyte *v); +GLAPI void APIENTRY glSecondaryColor3d (GLdouble red, GLdouble green, GLdouble blue); +GLAPI void APIENTRY glSecondaryColor3dv (const GLdouble *v); +GLAPI void APIENTRY glSecondaryColor3f (GLfloat red, GLfloat green, GLfloat blue); +GLAPI void APIENTRY glSecondaryColor3fv (const GLfloat *v); +GLAPI void APIENTRY glSecondaryColor3i (GLint red, GLint green, GLint blue); +GLAPI void APIENTRY glSecondaryColor3iv (const GLint *v); +GLAPI void APIENTRY glSecondaryColor3s (GLshort red, GLshort green, GLshort blue); +GLAPI void APIENTRY glSecondaryColor3sv (const GLshort *v); +GLAPI void APIENTRY glSecondaryColor3ub (GLubyte red, GLubyte green, GLubyte blue); +GLAPI void APIENTRY glSecondaryColor3ubv (const GLubyte *v); +GLAPI void APIENTRY glSecondaryColor3ui (GLuint red, GLuint green, GLuint blue); +GLAPI void APIENTRY glSecondaryColor3uiv (const GLuint *v); +GLAPI void APIENTRY glSecondaryColor3us (GLushort red, GLushort green, GLushort blue); +GLAPI void APIENTRY glSecondaryColor3usv (const GLushort *v); +GLAPI void APIENTRY glSecondaryColorPointer (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glWindowPos2d (GLdouble x, GLdouble y); +GLAPI void APIENTRY glWindowPos2dv (const GLdouble *v); +GLAPI void APIENTRY glWindowPos2f (GLfloat x, GLfloat y); +GLAPI void APIENTRY glWindowPos2fv (const GLfloat *v); +GLAPI void APIENTRY glWindowPos2i (GLint x, GLint y); +GLAPI void APIENTRY glWindowPos2iv (const GLint *v); +GLAPI void APIENTRY glWindowPos2s (GLshort x, GLshort y); +GLAPI void APIENTRY glWindowPos2sv (const GLshort *v); +GLAPI void APIENTRY glWindowPos3d (GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glWindowPos3dv (const GLdouble *v); +GLAPI void APIENTRY glWindowPos3f (GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glWindowPos3fv (const GLfloat *v); +GLAPI void APIENTRY glWindowPos3i (GLint x, GLint y, GLint z); +GLAPI void APIENTRY glWindowPos3iv (const GLint *v); +GLAPI void APIENTRY glWindowPos3s (GLshort x, GLshort y, GLshort z); +GLAPI void APIENTRY glWindowPos3sv (const GLshort *v); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLFOGCOORDFPROC) (GLfloat coord); +typedef void (APIENTRYP PFNGLFOGCOORDFVPROC) (const GLfloat *coord); +typedef void (APIENTRYP PFNGLFOGCOORDDPROC) (GLdouble coord); +typedef void (APIENTRYP PFNGLFOGCOORDDVPROC) (const GLdouble *coord); +typedef void (APIENTRYP PFNGLFOGCOORDPOINTERPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BPROC) (GLbyte red, GLbyte green, GLbyte blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BVPROC) (const GLbyte *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DPROC) (GLdouble red, GLdouble green, GLdouble blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DVPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FPROC) (GLfloat red, GLfloat green, GLfloat blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FVPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IPROC) (GLint red, GLint green, GLint blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IVPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SPROC) (GLshort red, GLshort green, GLshort blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SVPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBPROC) (GLubyte red, GLubyte green, GLubyte blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBVPROC) (const GLubyte *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIPROC) (GLuint red, GLuint green, GLuint blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIVPROC) (const GLuint *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USPROC) (GLushort red, GLushort green, GLushort blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USVPROC) (const GLushort *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLWINDOWPOS2DPROC) (GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLWINDOWPOS2DVPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2FPROC) (GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLWINDOWPOS2FVPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2IPROC) (GLint x, GLint y); +typedef void (APIENTRYP PFNGLWINDOWPOS2IVPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2SPROC) (GLshort x, GLshort y); +typedef void (APIENTRYP PFNGLWINDOWPOS2SVPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3DPROC) (GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLWINDOWPOS3DVPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3FPROC) (GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLWINDOWPOS3FVPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3IPROC) (GLint x, GLint y, GLint z); +typedef void (APIENTRYP PFNGLWINDOWPOS3IVPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3SPROC) (GLshort x, GLshort y, GLshort z); +typedef void (APIENTRYP PFNGLWINDOWPOS3SVPROC) (const GLshort *v); +#endif + +#ifndef GL_VERSION_1_5 +#define GL_VERSION_1_5 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGenQueries (GLsizei n, GLuint *ids); +GLAPI void APIENTRY glDeleteQueries (GLsizei n, const GLuint *ids); +GLAPI GLboolean APIENTRY glIsQuery (GLuint id); +GLAPI void APIENTRY glBeginQuery (GLenum target, GLuint id); +GLAPI void APIENTRY glEndQuery (GLenum target); +GLAPI void APIENTRY glGetQueryiv (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetQueryObjectiv (GLuint id, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetQueryObjectuiv (GLuint id, GLenum pname, GLuint *params); +GLAPI void APIENTRY glBindBuffer (GLenum target, GLuint buffer); +GLAPI void APIENTRY glDeleteBuffers (GLsizei n, const GLuint *buffers); +GLAPI void APIENTRY glGenBuffers (GLsizei n, GLuint *buffers); +GLAPI GLboolean APIENTRY glIsBuffer (GLuint buffer); +GLAPI void APIENTRY glBufferData (GLenum target, GLsizeiptr size, const GLvoid *data, GLenum usage); +GLAPI void APIENTRY glBufferSubData (GLenum target, GLintptr offset, GLsizeiptr size, const GLvoid *data); +GLAPI void APIENTRY glGetBufferSubData (GLenum target, GLintptr offset, GLsizeiptr size, GLvoid *data); +GLAPI GLvoid* APIENTRY glMapBuffer (GLenum target, GLenum access); +GLAPI GLboolean APIENTRY glUnmapBuffer (GLenum target); +GLAPI void APIENTRY glGetBufferParameteriv (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetBufferPointerv (GLenum target, GLenum pname, GLvoid* *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGENQUERIESPROC) (GLsizei n, GLuint *ids); +typedef void (APIENTRYP PFNGLDELETEQUERIESPROC) (GLsizei n, const GLuint *ids); +typedef GLboolean (APIENTRYP PFNGLISQUERYPROC) (GLuint id); +typedef void (APIENTRYP PFNGLBEGINQUERYPROC) (GLenum target, GLuint id); +typedef void (APIENTRYP PFNGLENDQUERYPROC) (GLenum target); +typedef void (APIENTRYP PFNGLGETQUERYIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETQUERYOBJECTIVPROC) (GLuint id, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETQUERYOBJECTUIVPROC) (GLuint id, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLBINDBUFFERPROC) (GLenum target, GLuint buffer); +typedef void (APIENTRYP PFNGLDELETEBUFFERSPROC) (GLsizei n, const GLuint *buffers); +typedef void (APIENTRYP PFNGLGENBUFFERSPROC) (GLsizei n, GLuint *buffers); +typedef GLboolean (APIENTRYP PFNGLISBUFFERPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLBUFFERDATAPROC) (GLenum target, GLsizeiptr size, const GLvoid *data, GLenum usage); +typedef void (APIENTRYP PFNGLBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, const GLvoid *data); +typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLvoid *data); +typedef GLvoid* (APIENTRYP PFNGLMAPBUFFERPROC) (GLenum target, GLenum access); +typedef GLboolean (APIENTRYP PFNGLUNMAPBUFFERPROC) (GLenum target); +typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVPROC) (GLenum target, GLenum pname, GLvoid* *params); +#endif + +#ifndef GL_VERSION_2_0 +#define GL_VERSION_2_0 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendEquationSeparate (GLenum modeRGB, GLenum modeAlpha); +GLAPI void APIENTRY glDrawBuffers (GLsizei n, const GLenum *bufs); +GLAPI void APIENTRY glStencilOpSeparate (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass); +GLAPI void APIENTRY glStencilFuncSeparate (GLenum face, GLenum func, GLint ref, GLuint mask); +GLAPI void APIENTRY glStencilMaskSeparate (GLenum face, GLuint mask); +GLAPI void APIENTRY glAttachShader (GLuint program, GLuint shader); +GLAPI void APIENTRY glBindAttribLocation (GLuint program, GLuint index, const GLchar *name); +GLAPI void APIENTRY glCompileShader (GLuint shader); +GLAPI GLuint APIENTRY glCreateProgram (void); +GLAPI GLuint APIENTRY glCreateShader (GLenum type); +GLAPI void APIENTRY glDeleteProgram (GLuint program); +GLAPI void APIENTRY glDeleteShader (GLuint shader); +GLAPI void APIENTRY glDetachShader (GLuint program, GLuint shader); +GLAPI void APIENTRY glDisableVertexAttribArray (GLuint index); +GLAPI void APIENTRY glEnableVertexAttribArray (GLuint index); +GLAPI void APIENTRY glGetActiveAttrib (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name); +GLAPI void APIENTRY glGetActiveUniform (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name); +GLAPI void APIENTRY glGetAttachedShaders (GLuint program, GLsizei maxCount, GLsizei *count, GLuint *obj); +GLAPI GLint APIENTRY glGetAttribLocation (GLuint program, const GLchar *name); +GLAPI void APIENTRY glGetProgramiv (GLuint program, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetProgramInfoLog (GLuint program, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +GLAPI void APIENTRY glGetShaderiv (GLuint shader, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetShaderInfoLog (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +GLAPI void APIENTRY glGetShaderSource (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *source); +GLAPI GLint APIENTRY glGetUniformLocation (GLuint program, const GLchar *name); +GLAPI void APIENTRY glGetUniformfv (GLuint program, GLint location, GLfloat *params); +GLAPI void APIENTRY glGetUniformiv (GLuint program, GLint location, GLint *params); +GLAPI void APIENTRY glGetVertexAttribdv (GLuint index, GLenum pname, GLdouble *params); +GLAPI void APIENTRY glGetVertexAttribfv (GLuint index, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetVertexAttribiv (GLuint index, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetVertexAttribPointerv (GLuint index, GLenum pname, GLvoid* *pointer); +GLAPI GLboolean APIENTRY glIsProgram (GLuint program); +GLAPI GLboolean APIENTRY glIsShader (GLuint shader); +GLAPI void APIENTRY glLinkProgram (GLuint program); +GLAPI void APIENTRY glShaderSource (GLuint shader, GLsizei count, const GLchar* *string, const GLint *length); +GLAPI void APIENTRY glUseProgram (GLuint program); +GLAPI void APIENTRY glUniform1f (GLint location, GLfloat v0); +GLAPI void APIENTRY glUniform2f (GLint location, GLfloat v0, GLfloat v1); +GLAPI void APIENTRY glUniform3f (GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +GLAPI void APIENTRY glUniform4f (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +GLAPI void APIENTRY glUniform1i (GLint location, GLint v0); +GLAPI void APIENTRY glUniform2i (GLint location, GLint v0, GLint v1); +GLAPI void APIENTRY glUniform3i (GLint location, GLint v0, GLint v1, GLint v2); +GLAPI void APIENTRY glUniform4i (GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +GLAPI void APIENTRY glUniform1fv (GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glUniform2fv (GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glUniform3fv (GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glUniform4fv (GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glUniform1iv (GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glUniform2iv (GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glUniform3iv (GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glUniform4iv (GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glUniformMatrix2fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix3fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix4fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glValidateProgram (GLuint program); +GLAPI void APIENTRY glVertexAttrib1d (GLuint index, GLdouble x); +GLAPI void APIENTRY glVertexAttrib1dv (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib1f (GLuint index, GLfloat x); +GLAPI void APIENTRY glVertexAttrib1fv (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib1s (GLuint index, GLshort x); +GLAPI void APIENTRY glVertexAttrib1sv (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib2d (GLuint index, GLdouble x, GLdouble y); +GLAPI void APIENTRY glVertexAttrib2dv (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib2f (GLuint index, GLfloat x, GLfloat y); +GLAPI void APIENTRY glVertexAttrib2fv (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib2s (GLuint index, GLshort x, GLshort y); +GLAPI void APIENTRY glVertexAttrib2sv (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib3d (GLuint index, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glVertexAttrib3dv (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib3f (GLuint index, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glVertexAttrib3fv (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib3s (GLuint index, GLshort x, GLshort y, GLshort z); +GLAPI void APIENTRY glVertexAttrib3sv (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib4Nbv (GLuint index, const GLbyte *v); +GLAPI void APIENTRY glVertexAttrib4Niv (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttrib4Nsv (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib4Nub (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); +GLAPI void APIENTRY glVertexAttrib4Nubv (GLuint index, const GLubyte *v); +GLAPI void APIENTRY glVertexAttrib4Nuiv (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttrib4Nusv (GLuint index, const GLushort *v); +GLAPI void APIENTRY glVertexAttrib4bv (GLuint index, const GLbyte *v); +GLAPI void APIENTRY glVertexAttrib4d (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glVertexAttrib4dv (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib4f (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glVertexAttrib4fv (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib4iv (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttrib4s (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); +GLAPI void APIENTRY glVertexAttrib4sv (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib4ubv (GLuint index, const GLubyte *v); +GLAPI void APIENTRY glVertexAttrib4uiv (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttrib4usv (GLuint index, const GLushort *v); +GLAPI void APIENTRY glVertexAttribPointer (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEPROC) (GLenum modeRGB, GLenum modeAlpha); +typedef void (APIENTRYP PFNGLDRAWBUFFERSPROC) (GLsizei n, const GLenum *bufs); +typedef void (APIENTRYP PFNGLSTENCILOPSEPARATEPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass); +typedef void (APIENTRYP PFNGLSTENCILFUNCSEPARATEPROC) (GLenum face, GLenum func, GLint ref, GLuint mask); +typedef void (APIENTRYP PFNGLSTENCILMASKSEPARATEPROC) (GLenum face, GLuint mask); +typedef void (APIENTRYP PFNGLATTACHSHADERPROC) (GLuint program, GLuint shader); +typedef void (APIENTRYP PFNGLBINDATTRIBLOCATIONPROC) (GLuint program, GLuint index, const GLchar *name); +typedef void (APIENTRYP PFNGLCOMPILESHADERPROC) (GLuint shader); +typedef GLuint (APIENTRYP PFNGLCREATEPROGRAMPROC) (void); +typedef GLuint (APIENTRYP PFNGLCREATESHADERPROC) (GLenum type); +typedef void (APIENTRYP PFNGLDELETEPROGRAMPROC) (GLuint program); +typedef void (APIENTRYP PFNGLDELETESHADERPROC) (GLuint shader); +typedef void (APIENTRYP PFNGLDETACHSHADERPROC) (GLuint program, GLuint shader); +typedef void (APIENTRYP PFNGLDISABLEVERTEXATTRIBARRAYPROC) (GLuint index); +typedef void (APIENTRYP PFNGLENABLEVERTEXATTRIBARRAYPROC) (GLuint index); +typedef void (APIENTRYP PFNGLGETACTIVEATTRIBPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name); +typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name); +typedef void (APIENTRYP PFNGLGETATTACHEDSHADERSPROC) (GLuint program, GLsizei maxCount, GLsizei *count, GLuint *obj); +typedef GLint (APIENTRYP PFNGLGETATTRIBLOCATIONPROC) (GLuint program, const GLchar *name); +typedef void (APIENTRYP PFNGLGETPROGRAMIVPROC) (GLuint program, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETPROGRAMINFOLOGPROC) (GLuint program, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +typedef void (APIENTRYP PFNGLGETSHADERIVPROC) (GLuint shader, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETSHADERINFOLOGPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +typedef void (APIENTRYP PFNGLGETSHADERSOURCEPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *source); +typedef GLint (APIENTRYP PFNGLGETUNIFORMLOCATIONPROC) (GLuint program, const GLchar *name); +typedef void (APIENTRYP PFNGLGETUNIFORMFVPROC) (GLuint program, GLint location, GLfloat *params); +typedef void (APIENTRYP PFNGLGETUNIFORMIVPROC) (GLuint program, GLint location, GLint *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVPROC) (GLuint index, GLenum pname, GLdouble *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVPROC) (GLuint index, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVPROC) (GLuint index, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVPROC) (GLuint index, GLenum pname, GLvoid* *pointer); +typedef GLboolean (APIENTRYP PFNGLISPROGRAMPROC) (GLuint program); +typedef GLboolean (APIENTRYP PFNGLISSHADERPROC) (GLuint shader); +typedef void (APIENTRYP PFNGLLINKPROGRAMPROC) (GLuint program); +typedef void (APIENTRYP PFNGLSHADERSOURCEPROC) (GLuint shader, GLsizei count, const GLchar* *string, const GLint *length); +typedef void (APIENTRYP PFNGLUSEPROGRAMPROC) (GLuint program); +typedef void (APIENTRYP PFNGLUNIFORM1FPROC) (GLint location, GLfloat v0); +typedef void (APIENTRYP PFNGLUNIFORM2FPROC) (GLint location, GLfloat v0, GLfloat v1); +typedef void (APIENTRYP PFNGLUNIFORM3FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +typedef void (APIENTRYP PFNGLUNIFORM4FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +typedef void (APIENTRYP PFNGLUNIFORM1IPROC) (GLint location, GLint v0); +typedef void (APIENTRYP PFNGLUNIFORM2IPROC) (GLint location, GLint v0, GLint v1); +typedef void (APIENTRYP PFNGLUNIFORM3IPROC) (GLint location, GLint v0, GLint v1, GLint v2); +typedef void (APIENTRYP PFNGLUNIFORM4IPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +typedef void (APIENTRYP PFNGLUNIFORM1FVPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM2FVPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM3FVPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM4FVPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM1IVPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORM2IVPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORM3IVPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORM4IVPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLVALIDATEPROGRAMPROC) (GLuint program); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1DPROC) (GLuint index, GLdouble x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1FPROC) (GLuint index, GLfloat x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1SPROC) (GLuint index, GLshort x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2DPROC) (GLuint index, GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2FPROC) (GLuint index, GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2SPROC) (GLuint index, GLshort x, GLshort y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3SPROC) (GLuint index, GLshort x, GLshort y, GLshort z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NBVPROC) (GLuint index, const GLbyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NIVPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NSVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBVPROC) (GLuint index, const GLubyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUIVPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUSVPROC) (GLuint index, const GLushort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4BVPROC) (GLuint index, const GLbyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4IVPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4SPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVPROC) (GLuint index, const GLubyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVPROC) (GLuint index, const GLushort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer); +#endif + +#ifndef GL_VERSION_2_1 +#define GL_VERSION_2_1 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glUniformMatrix2x3fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix3x2fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix2x4fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix4x2fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix3x4fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix4x3fv (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLUNIFORMMATRIX2X3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX3X2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX2X4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX4X2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX3X4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX4X3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +#endif + +#ifndef GL_VERSION_3_0 +#define GL_VERSION_3_0 1 +/* OpenGL 3.0 also reuses entry points from these extensions: */ +/* ARB_framebuffer_object */ +/* ARB_map_buffer_range */ +/* ARB_vertex_array_object */ +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glColorMaski (GLuint index, GLboolean r, GLboolean g, GLboolean b, GLboolean a); +GLAPI void APIENTRY glGetBooleani_v (GLenum target, GLuint index, GLboolean *data); +GLAPI void APIENTRY glGetIntegeri_v (GLenum target, GLuint index, GLint *data); +GLAPI void APIENTRY glEnablei (GLenum target, GLuint index); +GLAPI void APIENTRY glDisablei (GLenum target, GLuint index); +GLAPI GLboolean APIENTRY glIsEnabledi (GLenum target, GLuint index); +GLAPI void APIENTRY glBeginTransformFeedback (GLenum primitiveMode); +GLAPI void APIENTRY glEndTransformFeedback (void); +GLAPI void APIENTRY glBindBufferRange (GLenum target, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); +GLAPI void APIENTRY glBindBufferBase (GLenum target, GLuint index, GLuint buffer); +GLAPI void APIENTRY glTransformFeedbackVaryings (GLuint program, GLsizei count, const GLchar* *varyings, GLenum bufferMode); +GLAPI void APIENTRY glGetTransformFeedbackVarying (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLsizei *size, GLenum *type, GLchar *name); +GLAPI void APIENTRY glClampColor (GLenum target, GLenum clamp); +GLAPI void APIENTRY glBeginConditionalRender (GLuint id, GLenum mode); +GLAPI void APIENTRY glEndConditionalRender (void); +GLAPI void APIENTRY glVertexAttribIPointer (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glGetVertexAttribIiv (GLuint index, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetVertexAttribIuiv (GLuint index, GLenum pname, GLuint *params); +GLAPI void APIENTRY glVertexAttribI1i (GLuint index, GLint x); +GLAPI void APIENTRY glVertexAttribI2i (GLuint index, GLint x, GLint y); +GLAPI void APIENTRY glVertexAttribI3i (GLuint index, GLint x, GLint y, GLint z); +GLAPI void APIENTRY glVertexAttribI4i (GLuint index, GLint x, GLint y, GLint z, GLint w); +GLAPI void APIENTRY glVertexAttribI1ui (GLuint index, GLuint x); +GLAPI void APIENTRY glVertexAttribI2ui (GLuint index, GLuint x, GLuint y); +GLAPI void APIENTRY glVertexAttribI3ui (GLuint index, GLuint x, GLuint y, GLuint z); +GLAPI void APIENTRY glVertexAttribI4ui (GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +GLAPI void APIENTRY glVertexAttribI1iv (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttribI2iv (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttribI3iv (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttribI4iv (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttribI1uiv (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttribI2uiv (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttribI3uiv (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttribI4uiv (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttribI4bv (GLuint index, const GLbyte *v); +GLAPI void APIENTRY glVertexAttribI4sv (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttribI4ubv (GLuint index, const GLubyte *v); +GLAPI void APIENTRY glVertexAttribI4usv (GLuint index, const GLushort *v); +GLAPI void APIENTRY glGetUniformuiv (GLuint program, GLint location, GLuint *params); +GLAPI void APIENTRY glBindFragDataLocation (GLuint program, GLuint color, const GLchar *name); +GLAPI GLint APIENTRY glGetFragDataLocation (GLuint program, const GLchar *name); +GLAPI void APIENTRY glUniform1ui (GLint location, GLuint v0); +GLAPI void APIENTRY glUniform2ui (GLint location, GLuint v0, GLuint v1); +GLAPI void APIENTRY glUniform3ui (GLint location, GLuint v0, GLuint v1, GLuint v2); +GLAPI void APIENTRY glUniform4ui (GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); +GLAPI void APIENTRY glUniform1uiv (GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glUniform2uiv (GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glUniform3uiv (GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glUniform4uiv (GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glTexParameterIiv (GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glTexParameterIuiv (GLenum target, GLenum pname, const GLuint *params); +GLAPI void APIENTRY glGetTexParameterIiv (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetTexParameterIuiv (GLenum target, GLenum pname, GLuint *params); +GLAPI void APIENTRY glClearBufferiv (GLenum buffer, GLint drawbuffer, const GLint *value); +GLAPI void APIENTRY glClearBufferuiv (GLenum buffer, GLint drawbuffer, const GLuint *value); +GLAPI void APIENTRY glClearBufferfv (GLenum buffer, GLint drawbuffer, const GLfloat *value); +GLAPI void APIENTRY glClearBufferfi (GLenum buffer, GLint drawbuffer, GLfloat depth, GLint stencil); +GLAPI const GLubyte * APIENTRY glGetStringi (GLenum name, GLuint index); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCOLORMASKIPROC) (GLuint index, GLboolean r, GLboolean g, GLboolean b, GLboolean a); +typedef void (APIENTRYP PFNGLGETBOOLEANI_VPROC) (GLenum target, GLuint index, GLboolean *data); +typedef void (APIENTRYP PFNGLGETINTEGERI_VPROC) (GLenum target, GLuint index, GLint *data); +typedef void (APIENTRYP PFNGLENABLEIPROC) (GLenum target, GLuint index); +typedef void (APIENTRYP PFNGLDISABLEIPROC) (GLenum target, GLuint index); +typedef GLboolean (APIENTRYP PFNGLISENABLEDIPROC) (GLenum target, GLuint index); +typedef void (APIENTRYP PFNGLBEGINTRANSFORMFEEDBACKPROC) (GLenum primitiveMode); +typedef void (APIENTRYP PFNGLENDTRANSFORMFEEDBACKPROC) (void); +typedef void (APIENTRYP PFNGLBINDBUFFERRANGEPROC) (GLenum target, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLBINDBUFFERBASEPROC) (GLenum target, GLuint index, GLuint buffer); +typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKVARYINGSPROC) (GLuint program, GLsizei count, const GLchar* *varyings, GLenum bufferMode); +typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKVARYINGPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLsizei *size, GLenum *type, GLchar *name); +typedef void (APIENTRYP PFNGLCLAMPCOLORPROC) (GLenum target, GLenum clamp); +typedef void (APIENTRYP PFNGLBEGINCONDITIONALRENDERPROC) (GLuint id, GLenum mode); +typedef void (APIENTRYP PFNGLENDCONDITIONALRENDERPROC) (void); +typedef void (APIENTRYP PFNGLVERTEXATTRIBIPOINTERPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIIVPROC) (GLuint index, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIUIVPROC) (GLuint index, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI1IPROC) (GLuint index, GLint x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI2IPROC) (GLuint index, GLint x, GLint y); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI3IPROC) (GLuint index, GLint x, GLint y, GLint z); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4IPROC) (GLuint index, GLint x, GLint y, GLint z, GLint w); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI1UIPROC) (GLuint index, GLuint x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI2UIPROC) (GLuint index, GLuint x, GLuint y); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI3UIPROC) (GLuint index, GLuint x, GLuint y, GLuint z); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UIPROC) (GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI1IVPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI2IVPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI3IVPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4IVPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI1UIVPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI2UIVPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI3UIVPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UIVPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4BVPROC) (GLuint index, const GLbyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4SVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UBVPROC) (GLuint index, const GLubyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4USVPROC) (GLuint index, const GLushort *v); +typedef void (APIENTRYP PFNGLGETUNIFORMUIVPROC) (GLuint program, GLint location, GLuint *params); +typedef void (APIENTRYP PFNGLBINDFRAGDATALOCATIONPROC) (GLuint program, GLuint color, const GLchar *name); +typedef GLint (APIENTRYP PFNGLGETFRAGDATALOCATIONPROC) (GLuint program, const GLchar *name); +typedef void (APIENTRYP PFNGLUNIFORM1UIPROC) (GLint location, GLuint v0); +typedef void (APIENTRYP PFNGLUNIFORM2UIPROC) (GLint location, GLuint v0, GLuint v1); +typedef void (APIENTRYP PFNGLUNIFORM3UIPROC) (GLint location, GLuint v0, GLuint v1, GLuint v2); +typedef void (APIENTRYP PFNGLUNIFORM4UIPROC) (GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); +typedef void (APIENTRYP PFNGLUNIFORM1UIVPROC) (GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLUNIFORM2UIVPROC) (GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLUNIFORM3UIVPROC) (GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLUNIFORM4UIVPROC) (GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLTEXPARAMETERIIVPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLTEXPARAMETERIUIVPROC) (GLenum target, GLenum pname, const GLuint *params); +typedef void (APIENTRYP PFNGLGETTEXPARAMETERIIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETTEXPARAMETERIUIVPROC) (GLenum target, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLCLEARBUFFERIVPROC) (GLenum buffer, GLint drawbuffer, const GLint *value); +typedef void (APIENTRYP PFNGLCLEARBUFFERUIVPROC) (GLenum buffer, GLint drawbuffer, const GLuint *value); +typedef void (APIENTRYP PFNGLCLEARBUFFERFVPROC) (GLenum buffer, GLint drawbuffer, const GLfloat *value); +typedef void (APIENTRYP PFNGLCLEARBUFFERFIPROC) (GLenum buffer, GLint drawbuffer, GLfloat depth, GLint stencil); +typedef const GLubyte * (APIENTRYP PFNGLGETSTRINGIPROC) (GLenum name, GLuint index); +#endif + +#ifndef GL_VERSION_3_1 +#define GL_VERSION_3_1 1 +/* OpenGL 3.1 also reuses entry points from these extensions: */ +/* ARB_copy_buffer */ +/* ARB_uniform_buffer_object */ +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawArraysInstanced (GLenum mode, GLint first, GLsizei count, GLsizei primcount); +GLAPI void APIENTRY glDrawElementsInstanced (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei primcount); +GLAPI void APIENTRY glTexBuffer (GLenum target, GLenum internalformat, GLuint buffer); +GLAPI void APIENTRY glPrimitiveRestartIndex (GLuint index); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDPROC) (GLenum mode, GLint first, GLsizei count, GLsizei primcount); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDPROC) (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei primcount); +typedef void (APIENTRYP PFNGLTEXBUFFERPROC) (GLenum target, GLenum internalformat, GLuint buffer); +typedef void (APIENTRYP PFNGLPRIMITIVERESTARTINDEXPROC) (GLuint index); +#endif + +#ifndef GL_VERSION_3_2 +#define GL_VERSION_3_2 1 +/* OpenGL 3.2 also reuses entry points from these extensions: */ +/* ARB_draw_elements_base_vertex */ +/* ARB_provoking_vertex */ +/* ARB_sync */ +/* ARB_texture_multisample */ +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetInteger64i_v (GLenum target, GLuint index, GLint64 *data); +GLAPI void APIENTRY glGetBufferParameteri64v (GLenum target, GLenum pname, GLint64 *params); +GLAPI void APIENTRY glFramebufferTexture (GLenum target, GLenum attachment, GLuint texture, GLint level); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGETINTEGER64I_VPROC) (GLenum target, GLuint index, GLint64 *data); +typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERI64VPROC) (GLenum target, GLenum pname, GLint64 *params); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level); +#endif + +#ifndef GL_VERSION_3_3 +#define GL_VERSION_3_3 1 +/* OpenGL 3.3 also reuses entry points from these extensions: */ +/* ARB_blend_func_extended */ +/* ARB_sampler_objects */ +/* ARB_explicit_attrib_location, but it has none */ +/* ARB_occlusion_query2 (no entry points) */ +/* ARB_shader_bit_encoding (no entry points) */ +/* ARB_texture_rgb10_a2ui (no entry points) */ +/* ARB_texture_swizzle (no entry points) */ +/* ARB_timer_query */ +/* ARB_vertex_type_2_10_10_10_rev */ +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexAttribDivisor (GLuint index, GLuint divisor); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLVERTEXATTRIBDIVISORPROC) (GLuint index, GLuint divisor); +#endif + +#ifndef GL_VERSION_4_0 +#define GL_VERSION_4_0 1 +/* OpenGL 4.0 also reuses entry points from these extensions: */ +/* ARB_texture_query_lod (no entry points) */ +/* ARB_draw_indirect */ +/* ARB_gpu_shader5 (no entry points) */ +/* ARB_gpu_shader_fp64 */ +/* ARB_shader_subroutine */ +/* ARB_tessellation_shader */ +/* ARB_texture_buffer_object_rgb32 (no entry points) */ +/* ARB_texture_cube_map_array (no entry points) */ +/* ARB_texture_gather (no entry points) */ +/* ARB_transform_feedback2 */ +/* ARB_transform_feedback3 */ +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMinSampleShading (GLclampf value); +GLAPI void APIENTRY glBlendEquationi (GLuint buf, GLenum mode); +GLAPI void APIENTRY glBlendEquationSeparatei (GLuint buf, GLenum modeRGB, GLenum modeAlpha); +GLAPI void APIENTRY glBlendFunci (GLuint buf, GLenum src, GLenum dst); +GLAPI void APIENTRY glBlendFuncSeparatei (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLMINSAMPLESHADINGPROC) (GLclampf value); +typedef void (APIENTRYP PFNGLBLENDEQUATIONIPROC) (GLuint buf, GLenum mode); +typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEIPROC) (GLuint buf, GLenum modeRGB, GLenum modeAlpha); +typedef void (APIENTRYP PFNGLBLENDFUNCIPROC) (GLuint buf, GLenum src, GLenum dst); +typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEIPROC) (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); +#endif + +#ifndef GL_VERSION_4_1 +#define GL_VERSION_4_1 1 +/* OpenGL 4.1 also reuses entry points from these extensions: */ +/* ARB_ES2_compatibility */ +/* ARB_get_program_binary */ +/* ARB_separate_shader_objects */ +/* ARB_shader_precision (no entry points) */ +/* ARB_vertex_attrib_64bit */ +/* ARB_viewport_array */ +#endif + +#ifndef GL_ARB_multitexture +#define GL_ARB_multitexture 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glActiveTextureARB (GLenum texture); +GLAPI void APIENTRY glClientActiveTextureARB (GLenum texture); +GLAPI void APIENTRY glMultiTexCoord1dARB (GLenum target, GLdouble s); +GLAPI void APIENTRY glMultiTexCoord1dvARB (GLenum target, const GLdouble *v); +GLAPI void APIENTRY glMultiTexCoord1fARB (GLenum target, GLfloat s); +GLAPI void APIENTRY glMultiTexCoord1fvARB (GLenum target, const GLfloat *v); +GLAPI void APIENTRY glMultiTexCoord1iARB (GLenum target, GLint s); +GLAPI void APIENTRY glMultiTexCoord1ivARB (GLenum target, const GLint *v); +GLAPI void APIENTRY glMultiTexCoord1sARB (GLenum target, GLshort s); +GLAPI void APIENTRY glMultiTexCoord1svARB (GLenum target, const GLshort *v); +GLAPI void APIENTRY glMultiTexCoord2dARB (GLenum target, GLdouble s, GLdouble t); +GLAPI void APIENTRY glMultiTexCoord2dvARB (GLenum target, const GLdouble *v); +GLAPI void APIENTRY glMultiTexCoord2fARB (GLenum target, GLfloat s, GLfloat t); +GLAPI void APIENTRY glMultiTexCoord2fvARB (GLenum target, const GLfloat *v); +GLAPI void APIENTRY glMultiTexCoord2iARB (GLenum target, GLint s, GLint t); +GLAPI void APIENTRY glMultiTexCoord2ivARB (GLenum target, const GLint *v); +GLAPI void APIENTRY glMultiTexCoord2sARB (GLenum target, GLshort s, GLshort t); +GLAPI void APIENTRY glMultiTexCoord2svARB (GLenum target, const GLshort *v); +GLAPI void APIENTRY glMultiTexCoord3dARB (GLenum target, GLdouble s, GLdouble t, GLdouble r); +GLAPI void APIENTRY glMultiTexCoord3dvARB (GLenum target, const GLdouble *v); +GLAPI void APIENTRY glMultiTexCoord3fARB (GLenum target, GLfloat s, GLfloat t, GLfloat r); +GLAPI void APIENTRY glMultiTexCoord3fvARB (GLenum target, const GLfloat *v); +GLAPI void APIENTRY glMultiTexCoord3iARB (GLenum target, GLint s, GLint t, GLint r); +GLAPI void APIENTRY glMultiTexCoord3ivARB (GLenum target, const GLint *v); +GLAPI void APIENTRY glMultiTexCoord3sARB (GLenum target, GLshort s, GLshort t, GLshort r); +GLAPI void APIENTRY glMultiTexCoord3svARB (GLenum target, const GLshort *v); +GLAPI void APIENTRY glMultiTexCoord4dARB (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q); +GLAPI void APIENTRY glMultiTexCoord4dvARB (GLenum target, const GLdouble *v); +GLAPI void APIENTRY glMultiTexCoord4fARB (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q); +GLAPI void APIENTRY glMultiTexCoord4fvARB (GLenum target, const GLfloat *v); +GLAPI void APIENTRY glMultiTexCoord4iARB (GLenum target, GLint s, GLint t, GLint r, GLint q); +GLAPI void APIENTRY glMultiTexCoord4ivARB (GLenum target, const GLint *v); +GLAPI void APIENTRY glMultiTexCoord4sARB (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q); +GLAPI void APIENTRY glMultiTexCoord4svARB (GLenum target, const GLshort *v); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLACTIVETEXTUREARBPROC) (GLenum texture); +typedef void (APIENTRYP PFNGLCLIENTACTIVETEXTUREARBPROC) (GLenum texture); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1DARBPROC) (GLenum target, GLdouble s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVARBPROC) (GLenum target, const GLdouble *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1FARBPROC) (GLenum target, GLfloat s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1FVARBPROC) (GLenum target, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1IARBPROC) (GLenum target, GLint s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1IVARBPROC) (GLenum target, const GLint *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1SARBPROC) (GLenum target, GLshort s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1SVARBPROC) (GLenum target, const GLshort *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2DARBPROC) (GLenum target, GLdouble s, GLdouble t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2DVARBPROC) (GLenum target, const GLdouble *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2FARBPROC) (GLenum target, GLfloat s, GLfloat t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2FVARBPROC) (GLenum target, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2IARBPROC) (GLenum target, GLint s, GLint t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2IVARBPROC) (GLenum target, const GLint *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2SARBPROC) (GLenum target, GLshort s, GLshort t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2SVARBPROC) (GLenum target, const GLshort *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3DVARBPROC) (GLenum target, const GLdouble *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3FVARBPROC) (GLenum target, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3IARBPROC) (GLenum target, GLint s, GLint t, GLint r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3IVARBPROC) (GLenum target, const GLint *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3SVARBPROC) (GLenum target, const GLshort *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4DVARBPROC) (GLenum target, const GLdouble *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4FVARBPROC) (GLenum target, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4IARBPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4IVARBPROC) (GLenum target, const GLint *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4SVARBPROC) (GLenum target, const GLshort *v); +#endif + +#ifndef GL_ARB_transpose_matrix +#define GL_ARB_transpose_matrix 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glLoadTransposeMatrixfARB (const GLfloat *m); +GLAPI void APIENTRY glLoadTransposeMatrixdARB (const GLdouble *m); +GLAPI void APIENTRY glMultTransposeMatrixfARB (const GLfloat *m); +GLAPI void APIENTRY glMultTransposeMatrixdARB (const GLdouble *m); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXFARBPROC) (const GLfloat *m); +typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXDARBPROC) (const GLdouble *m); +typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXFARBPROC) (const GLfloat *m); +typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXDARBPROC) (const GLdouble *m); +#endif + +#ifndef GL_ARB_multisample +#define GL_ARB_multisample 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSampleCoverageARB (GLclampf value, GLboolean invert); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLSAMPLECOVERAGEARBPROC) (GLclampf value, GLboolean invert); +#endif + +#ifndef GL_ARB_texture_env_add +#define GL_ARB_texture_env_add 1 +#endif + +#ifndef GL_ARB_texture_cube_map +#define GL_ARB_texture_cube_map 1 +#endif + +#ifndef GL_ARB_texture_compression +#define GL_ARB_texture_compression 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCompressedTexImage3DARB (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data); +GLAPI void APIENTRY glCompressedTexImage2DARB (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data); +GLAPI void APIENTRY glCompressedTexImage1DARB (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data); +GLAPI void APIENTRY glCompressedTexSubImage3DARB (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data); +GLAPI void APIENTRY glCompressedTexSubImage2DARB (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data); +GLAPI void APIENTRY glCompressedTexSubImage1DARB (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data); +GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum target, GLint level, GLvoid *img); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DARBPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint level, GLvoid *img); +#endif + +#ifndef GL_ARB_texture_border_clamp +#define GL_ARB_texture_border_clamp 1 +#endif + +#ifndef GL_ARB_point_parameters +#define GL_ARB_point_parameters 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPointParameterfARB (GLenum pname, GLfloat param); +GLAPI void APIENTRY glPointParameterfvARB (GLenum pname, const GLfloat *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPOINTPARAMETERFARBPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLPOINTPARAMETERFVARBPROC) (GLenum pname, const GLfloat *params); +#endif + +#ifndef GL_ARB_vertex_blend +#define GL_ARB_vertex_blend 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glWeightbvARB (GLint size, const GLbyte *weights); +GLAPI void APIENTRY glWeightsvARB (GLint size, const GLshort *weights); +GLAPI void APIENTRY glWeightivARB (GLint size, const GLint *weights); +GLAPI void APIENTRY glWeightfvARB (GLint size, const GLfloat *weights); +GLAPI void APIENTRY glWeightdvARB (GLint size, const GLdouble *weights); +GLAPI void APIENTRY glWeightubvARB (GLint size, const GLubyte *weights); +GLAPI void APIENTRY glWeightusvARB (GLint size, const GLushort *weights); +GLAPI void APIENTRY glWeightuivARB (GLint size, const GLuint *weights); +GLAPI void APIENTRY glWeightPointerARB (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glVertexBlendARB (GLint count); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLWEIGHTBVARBPROC) (GLint size, const GLbyte *weights); +typedef void (APIENTRYP PFNGLWEIGHTSVARBPROC) (GLint size, const GLshort *weights); +typedef void (APIENTRYP PFNGLWEIGHTIVARBPROC) (GLint size, const GLint *weights); +typedef void (APIENTRYP PFNGLWEIGHTFVARBPROC) (GLint size, const GLfloat *weights); +typedef void (APIENTRYP PFNGLWEIGHTDVARBPROC) (GLint size, const GLdouble *weights); +typedef void (APIENTRYP PFNGLWEIGHTUBVARBPROC) (GLint size, const GLubyte *weights); +typedef void (APIENTRYP PFNGLWEIGHTUSVARBPROC) (GLint size, const GLushort *weights); +typedef void (APIENTRYP PFNGLWEIGHTUIVARBPROC) (GLint size, const GLuint *weights); +typedef void (APIENTRYP PFNGLWEIGHTPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXBLENDARBPROC) (GLint count); +#endif + +#ifndef GL_ARB_matrix_palette +#define GL_ARB_matrix_palette 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCurrentPaletteMatrixARB (GLint index); +GLAPI void APIENTRY glMatrixIndexubvARB (GLint size, const GLubyte *indices); +GLAPI void APIENTRY glMatrixIndexusvARB (GLint size, const GLushort *indices); +GLAPI void APIENTRY glMatrixIndexuivARB (GLint size, const GLuint *indices); +GLAPI void APIENTRY glMatrixIndexPointerARB (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCURRENTPALETTEMATRIXARBPROC) (GLint index); +typedef void (APIENTRYP PFNGLMATRIXINDEXUBVARBPROC) (GLint size, const GLubyte *indices); +typedef void (APIENTRYP PFNGLMATRIXINDEXUSVARBPROC) (GLint size, const GLushort *indices); +typedef void (APIENTRYP PFNGLMATRIXINDEXUIVARBPROC) (GLint size, const GLuint *indices); +typedef void (APIENTRYP PFNGLMATRIXINDEXPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +#endif + +#ifndef GL_ARB_texture_env_combine +#define GL_ARB_texture_env_combine 1 +#endif + +#ifndef GL_ARB_texture_env_crossbar +#define GL_ARB_texture_env_crossbar 1 +#endif + +#ifndef GL_ARB_texture_env_dot3 +#define GL_ARB_texture_env_dot3 1 +#endif + +#ifndef GL_ARB_texture_mirrored_repeat +#define GL_ARB_texture_mirrored_repeat 1 +#endif + +#ifndef GL_ARB_depth_texture +#define GL_ARB_depth_texture 1 +#endif + +#ifndef GL_ARB_shadow +#define GL_ARB_shadow 1 +#endif + +#ifndef GL_ARB_shadow_ambient +#define GL_ARB_shadow_ambient 1 +#endif + +#ifndef GL_ARB_window_pos +#define GL_ARB_window_pos 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glWindowPos2dARB (GLdouble x, GLdouble y); +GLAPI void APIENTRY glWindowPos2dvARB (const GLdouble *v); +GLAPI void APIENTRY glWindowPos2fARB (GLfloat x, GLfloat y); +GLAPI void APIENTRY glWindowPos2fvARB (const GLfloat *v); +GLAPI void APIENTRY glWindowPos2iARB (GLint x, GLint y); +GLAPI void APIENTRY glWindowPos2ivARB (const GLint *v); +GLAPI void APIENTRY glWindowPos2sARB (GLshort x, GLshort y); +GLAPI void APIENTRY glWindowPos2svARB (const GLshort *v); +GLAPI void APIENTRY glWindowPos3dARB (GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glWindowPos3dvARB (const GLdouble *v); +GLAPI void APIENTRY glWindowPos3fARB (GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glWindowPos3fvARB (const GLfloat *v); +GLAPI void APIENTRY glWindowPos3iARB (GLint x, GLint y, GLint z); +GLAPI void APIENTRY glWindowPos3ivARB (const GLint *v); +GLAPI void APIENTRY glWindowPos3sARB (GLshort x, GLshort y, GLshort z); +GLAPI void APIENTRY glWindowPos3svARB (const GLshort *v); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLWINDOWPOS2DARBPROC) (GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLWINDOWPOS2DVARBPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2FARBPROC) (GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLWINDOWPOS2FVARBPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2IARBPROC) (GLint x, GLint y); +typedef void (APIENTRYP PFNGLWINDOWPOS2IVARBPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2SARBPROC) (GLshort x, GLshort y); +typedef void (APIENTRYP PFNGLWINDOWPOS2SVARBPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3DARBPROC) (GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLWINDOWPOS3DVARBPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3FARBPROC) (GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLWINDOWPOS3FVARBPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3IARBPROC) (GLint x, GLint y, GLint z); +typedef void (APIENTRYP PFNGLWINDOWPOS3IVARBPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3SARBPROC) (GLshort x, GLshort y, GLshort z); +typedef void (APIENTRYP PFNGLWINDOWPOS3SVARBPROC) (const GLshort *v); +#endif + +#ifndef GL_ARB_vertex_program +#define GL_ARB_vertex_program 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexAttrib1dARB (GLuint index, GLdouble x); +GLAPI void APIENTRY glVertexAttrib1dvARB (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib1fARB (GLuint index, GLfloat x); +GLAPI void APIENTRY glVertexAttrib1fvARB (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib1sARB (GLuint index, GLshort x); +GLAPI void APIENTRY glVertexAttrib1svARB (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib2dARB (GLuint index, GLdouble x, GLdouble y); +GLAPI void APIENTRY glVertexAttrib2dvARB (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib2fARB (GLuint index, GLfloat x, GLfloat y); +GLAPI void APIENTRY glVertexAttrib2fvARB (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib2sARB (GLuint index, GLshort x, GLshort y); +GLAPI void APIENTRY glVertexAttrib2svARB (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib3dARB (GLuint index, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glVertexAttrib3dvARB (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib3fARB (GLuint index, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glVertexAttrib3fvARB (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib3sARB (GLuint index, GLshort x, GLshort y, GLshort z); +GLAPI void APIENTRY glVertexAttrib3svARB (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib4NbvARB (GLuint index, const GLbyte *v); +GLAPI void APIENTRY glVertexAttrib4NivARB (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttrib4NsvARB (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib4NubARB (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); +GLAPI void APIENTRY glVertexAttrib4NubvARB (GLuint index, const GLubyte *v); +GLAPI void APIENTRY glVertexAttrib4NuivARB (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttrib4NusvARB (GLuint index, const GLushort *v); +GLAPI void APIENTRY glVertexAttrib4bvARB (GLuint index, const GLbyte *v); +GLAPI void APIENTRY glVertexAttrib4dARB (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glVertexAttrib4dvARB (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib4fARB (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glVertexAttrib4fvARB (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib4ivARB (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttrib4sARB (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); +GLAPI void APIENTRY glVertexAttrib4svARB (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib4ubvARB (GLuint index, const GLubyte *v); +GLAPI void APIENTRY glVertexAttrib4uivARB (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttrib4usvARB (GLuint index, const GLushort *v); +GLAPI void APIENTRY glVertexAttribPointerARB (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glEnableVertexAttribArrayARB (GLuint index); +GLAPI void APIENTRY glDisableVertexAttribArrayARB (GLuint index); +GLAPI void APIENTRY glProgramStringARB (GLenum target, GLenum format, GLsizei len, const GLvoid *string); +GLAPI void APIENTRY glBindProgramARB (GLenum target, GLuint program); +GLAPI void APIENTRY glDeleteProgramsARB (GLsizei n, const GLuint *programs); +GLAPI void APIENTRY glGenProgramsARB (GLsizei n, GLuint *programs); +GLAPI void APIENTRY glProgramEnvParameter4dARB (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glProgramEnvParameter4dvARB (GLenum target, GLuint index, const GLdouble *params); +GLAPI void APIENTRY glProgramEnvParameter4fARB (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glProgramEnvParameter4fvARB (GLenum target, GLuint index, const GLfloat *params); +GLAPI void APIENTRY glProgramLocalParameter4dARB (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glProgramLocalParameter4dvARB (GLenum target, GLuint index, const GLdouble *params); +GLAPI void APIENTRY glProgramLocalParameter4fARB (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glProgramLocalParameter4fvARB (GLenum target, GLuint index, const GLfloat *params); +GLAPI void APIENTRY glGetProgramEnvParameterdvARB (GLenum target, GLuint index, GLdouble *params); +GLAPI void APIENTRY glGetProgramEnvParameterfvARB (GLenum target, GLuint index, GLfloat *params); +GLAPI void APIENTRY glGetProgramLocalParameterdvARB (GLenum target, GLuint index, GLdouble *params); +GLAPI void APIENTRY glGetProgramLocalParameterfvARB (GLenum target, GLuint index, GLfloat *params); +GLAPI void APIENTRY glGetProgramivARB (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetProgramStringARB (GLenum target, GLenum pname, GLvoid *string); +GLAPI void APIENTRY glGetVertexAttribdvARB (GLuint index, GLenum pname, GLdouble *params); +GLAPI void APIENTRY glGetVertexAttribfvARB (GLuint index, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetVertexAttribivARB (GLuint index, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetVertexAttribPointervARB (GLuint index, GLenum pname, GLvoid* *pointer); +GLAPI GLboolean APIENTRY glIsProgramARB (GLuint program); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLVERTEXATTRIB1DARBPROC) (GLuint index, GLdouble x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVARBPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1FARBPROC) (GLuint index, GLfloat x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVARBPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1SARBPROC) (GLuint index, GLshort x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVARBPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2DARBPROC) (GLuint index, GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVARBPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2FARBPROC) (GLuint index, GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVARBPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2SARBPROC) (GLuint index, GLshort x, GLshort y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVARBPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVARBPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVARBPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVARBPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NBVARBPROC) (GLuint index, const GLbyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NIVARBPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NSVARBPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBARBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBVARBPROC) (GLuint index, const GLubyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUIVARBPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUSVARBPROC) (GLuint index, const GLushort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4BVARBPROC) (GLuint index, const GLbyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVARBPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVARBPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4IVARBPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVARBPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVARBPROC) (GLuint index, const GLubyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVARBPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVARBPROC) (GLuint index, const GLushort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERARBPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLENABLEVERTEXATTRIBARRAYARBPROC) (GLuint index); +typedef void (APIENTRYP PFNGLDISABLEVERTEXATTRIBARRAYARBPROC) (GLuint index); +typedef void (APIENTRYP PFNGLPROGRAMSTRINGARBPROC) (GLenum target, GLenum format, GLsizei len, const GLvoid *string); +typedef void (APIENTRYP PFNGLBINDPROGRAMARBPROC) (GLenum target, GLuint program); +typedef void (APIENTRYP PFNGLDELETEPROGRAMSARBPROC) (GLsizei n, const GLuint *programs); +typedef void (APIENTRYP PFNGLGENPROGRAMSARBPROC) (GLsizei n, GLuint *programs); +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble *params); +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat *params); +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble *params); +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat *params); +typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble *params); +typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat *params); +typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble *params); +typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat *params); +typedef void (APIENTRYP PFNGLGETPROGRAMIVARBPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETPROGRAMSTRINGARBPROC) (GLenum target, GLenum pname, GLvoid *string); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVARBPROC) (GLuint index, GLenum pname, GLdouble *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVARBPROC) (GLuint index, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVARBPROC) (GLuint index, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVARBPROC) (GLuint index, GLenum pname, GLvoid* *pointer); +typedef GLboolean (APIENTRYP PFNGLISPROGRAMARBPROC) (GLuint program); +#endif + +#ifndef GL_ARB_fragment_program +#define GL_ARB_fragment_program 1 +/* All ARB_fragment_program entry points are shared with ARB_vertex_program. */ +#endif + +#ifndef GL_ARB_vertex_buffer_object +#define GL_ARB_vertex_buffer_object 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBindBufferARB (GLenum target, GLuint buffer); +GLAPI void APIENTRY glDeleteBuffersARB (GLsizei n, const GLuint *buffers); +GLAPI void APIENTRY glGenBuffersARB (GLsizei n, GLuint *buffers); +GLAPI GLboolean APIENTRY glIsBufferARB (GLuint buffer); +GLAPI void APIENTRY glBufferDataARB (GLenum target, GLsizeiptrARB size, const GLvoid *data, GLenum usage); +GLAPI void APIENTRY glBufferSubDataARB (GLenum target, GLintptrARB offset, GLsizeiptrARB size, const GLvoid *data); +GLAPI void APIENTRY glGetBufferSubDataARB (GLenum target, GLintptrARB offset, GLsizeiptrARB size, GLvoid *data); +GLAPI GLvoid* APIENTRY glMapBufferARB (GLenum target, GLenum access); +GLAPI GLboolean APIENTRY glUnmapBufferARB (GLenum target); +GLAPI void APIENTRY glGetBufferParameterivARB (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetBufferPointervARB (GLenum target, GLenum pname, GLvoid* *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBINDBUFFERARBPROC) (GLenum target, GLuint buffer); +typedef void (APIENTRYP PFNGLDELETEBUFFERSARBPROC) (GLsizei n, const GLuint *buffers); +typedef void (APIENTRYP PFNGLGENBUFFERSARBPROC) (GLsizei n, GLuint *buffers); +typedef GLboolean (APIENTRYP PFNGLISBUFFERARBPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLBUFFERDATAARBPROC) (GLenum target, GLsizeiptrARB size, const GLvoid *data, GLenum usage); +typedef void (APIENTRYP PFNGLBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, const GLvoid *data); +typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, GLvoid *data); +typedef GLvoid* (APIENTRYP PFNGLMAPBUFFERARBPROC) (GLenum target, GLenum access); +typedef GLboolean (APIENTRYP PFNGLUNMAPBUFFERARBPROC) (GLenum target); +typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVARBPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVARBPROC) (GLenum target, GLenum pname, GLvoid* *params); +#endif + +#ifndef GL_ARB_occlusion_query +#define GL_ARB_occlusion_query 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGenQueriesARB (GLsizei n, GLuint *ids); +GLAPI void APIENTRY glDeleteQueriesARB (GLsizei n, const GLuint *ids); +GLAPI GLboolean APIENTRY glIsQueryARB (GLuint id); +GLAPI void APIENTRY glBeginQueryARB (GLenum target, GLuint id); +GLAPI void APIENTRY glEndQueryARB (GLenum target); +GLAPI void APIENTRY glGetQueryivARB (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetQueryObjectivARB (GLuint id, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetQueryObjectuivARB (GLuint id, GLenum pname, GLuint *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGENQUERIESARBPROC) (GLsizei n, GLuint *ids); +typedef void (APIENTRYP PFNGLDELETEQUERIESARBPROC) (GLsizei n, const GLuint *ids); +typedef GLboolean (APIENTRYP PFNGLISQUERYARBPROC) (GLuint id); +typedef void (APIENTRYP PFNGLBEGINQUERYARBPROC) (GLenum target, GLuint id); +typedef void (APIENTRYP PFNGLENDQUERYARBPROC) (GLenum target); +typedef void (APIENTRYP PFNGLGETQUERYIVARBPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETQUERYOBJECTIVARBPROC) (GLuint id, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETQUERYOBJECTUIVARBPROC) (GLuint id, GLenum pname, GLuint *params); +#endif + +#ifndef GL_ARB_shader_objects +#define GL_ARB_shader_objects 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDeleteObjectARB (GLhandleARB obj); +GLAPI GLhandleARB APIENTRY glGetHandleARB (GLenum pname); +GLAPI void APIENTRY glDetachObjectARB (GLhandleARB containerObj, GLhandleARB attachedObj); +GLAPI GLhandleARB APIENTRY glCreateShaderObjectARB (GLenum shaderType); +GLAPI void APIENTRY glShaderSourceARB (GLhandleARB shaderObj, GLsizei count, const GLcharARB* *string, const GLint *length); +GLAPI void APIENTRY glCompileShaderARB (GLhandleARB shaderObj); +GLAPI GLhandleARB APIENTRY glCreateProgramObjectARB (void); +GLAPI void APIENTRY glAttachObjectARB (GLhandleARB containerObj, GLhandleARB obj); +GLAPI void APIENTRY glLinkProgramARB (GLhandleARB programObj); +GLAPI void APIENTRY glUseProgramObjectARB (GLhandleARB programObj); +GLAPI void APIENTRY glValidateProgramARB (GLhandleARB programObj); +GLAPI void APIENTRY glUniform1fARB (GLint location, GLfloat v0); +GLAPI void APIENTRY glUniform2fARB (GLint location, GLfloat v0, GLfloat v1); +GLAPI void APIENTRY glUniform3fARB (GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +GLAPI void APIENTRY glUniform4fARB (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +GLAPI void APIENTRY glUniform1iARB (GLint location, GLint v0); +GLAPI void APIENTRY glUniform2iARB (GLint location, GLint v0, GLint v1); +GLAPI void APIENTRY glUniform3iARB (GLint location, GLint v0, GLint v1, GLint v2); +GLAPI void APIENTRY glUniform4iARB (GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +GLAPI void APIENTRY glUniform1fvARB (GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glUniform2fvARB (GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glUniform3fvARB (GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glUniform4fvARB (GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glUniform1ivARB (GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glUniform2ivARB (GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glUniform3ivARB (GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glUniform4ivARB (GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glUniformMatrix2fvARB (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix3fvARB (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glUniformMatrix4fvARB (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glGetObjectParameterfvARB (GLhandleARB obj, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetObjectParameterivARB (GLhandleARB obj, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetInfoLogARB (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *infoLog); +GLAPI void APIENTRY glGetAttachedObjectsARB (GLhandleARB containerObj, GLsizei maxCount, GLsizei *count, GLhandleARB *obj); +GLAPI GLint APIENTRY glGetUniformLocationARB (GLhandleARB programObj, const GLcharARB *name); +GLAPI void APIENTRY glGetActiveUniformARB (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name); +GLAPI void APIENTRY glGetUniformfvARB (GLhandleARB programObj, GLint location, GLfloat *params); +GLAPI void APIENTRY glGetUniformivARB (GLhandleARB programObj, GLint location, GLint *params); +GLAPI void APIENTRY glGetShaderSourceARB (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *source); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDELETEOBJECTARBPROC) (GLhandleARB obj); +typedef GLhandleARB (APIENTRYP PFNGLGETHANDLEARBPROC) (GLenum pname); +typedef void (APIENTRYP PFNGLDETACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB attachedObj); +typedef GLhandleARB (APIENTRYP PFNGLCREATESHADEROBJECTARBPROC) (GLenum shaderType); +typedef void (APIENTRYP PFNGLSHADERSOURCEARBPROC) (GLhandleARB shaderObj, GLsizei count, const GLcharARB* *string, const GLint *length); +typedef void (APIENTRYP PFNGLCOMPILESHADERARBPROC) (GLhandleARB shaderObj); +typedef GLhandleARB (APIENTRYP PFNGLCREATEPROGRAMOBJECTARBPROC) (void); +typedef void (APIENTRYP PFNGLATTACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB obj); +typedef void (APIENTRYP PFNGLLINKPROGRAMARBPROC) (GLhandleARB programObj); +typedef void (APIENTRYP PFNGLUSEPROGRAMOBJECTARBPROC) (GLhandleARB programObj); +typedef void (APIENTRYP PFNGLVALIDATEPROGRAMARBPROC) (GLhandleARB programObj); +typedef void (APIENTRYP PFNGLUNIFORM1FARBPROC) (GLint location, GLfloat v0); +typedef void (APIENTRYP PFNGLUNIFORM2FARBPROC) (GLint location, GLfloat v0, GLfloat v1); +typedef void (APIENTRYP PFNGLUNIFORM3FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +typedef void (APIENTRYP PFNGLUNIFORM4FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +typedef void (APIENTRYP PFNGLUNIFORM1IARBPROC) (GLint location, GLint v0); +typedef void (APIENTRYP PFNGLUNIFORM2IARBPROC) (GLint location, GLint v0, GLint v1); +typedef void (APIENTRYP PFNGLUNIFORM3IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2); +typedef void (APIENTRYP PFNGLUNIFORM4IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +typedef void (APIENTRYP PFNGLUNIFORM1FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM2FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM3FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM4FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM1IVARBPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORM2IVARBPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORM3IVARBPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORM4IVARBPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX2FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX3FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX4FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLGETOBJECTPARAMETERFVARBPROC) (GLhandleARB obj, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETOBJECTPARAMETERIVARBPROC) (GLhandleARB obj, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETINFOLOGARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *infoLog); +typedef void (APIENTRYP PFNGLGETATTACHEDOBJECTSARBPROC) (GLhandleARB containerObj, GLsizei maxCount, GLsizei *count, GLhandleARB *obj); +typedef GLint (APIENTRYP PFNGLGETUNIFORMLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB *name); +typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name); +typedef void (APIENTRYP PFNGLGETUNIFORMFVARBPROC) (GLhandleARB programObj, GLint location, GLfloat *params); +typedef void (APIENTRYP PFNGLGETUNIFORMIVARBPROC) (GLhandleARB programObj, GLint location, GLint *params); +typedef void (APIENTRYP PFNGLGETSHADERSOURCEARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *source); +#endif + +#ifndef GL_ARB_vertex_shader +#define GL_ARB_vertex_shader 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBindAttribLocationARB (GLhandleARB programObj, GLuint index, const GLcharARB *name); +GLAPI void APIENTRY glGetActiveAttribARB (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name); +GLAPI GLint APIENTRY glGetAttribLocationARB (GLhandleARB programObj, const GLcharARB *name); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBINDATTRIBLOCATIONARBPROC) (GLhandleARB programObj, GLuint index, const GLcharARB *name); +typedef void (APIENTRYP PFNGLGETACTIVEATTRIBARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name); +typedef GLint (APIENTRYP PFNGLGETATTRIBLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB *name); +#endif + +#ifndef GL_ARB_fragment_shader +#define GL_ARB_fragment_shader 1 +#endif + +#ifndef GL_ARB_shading_language_100 +#define GL_ARB_shading_language_100 1 +#endif + +#ifndef GL_ARB_texture_non_power_of_two +#define GL_ARB_texture_non_power_of_two 1 +#endif + +#ifndef GL_ARB_point_sprite +#define GL_ARB_point_sprite 1 +#endif + +#ifndef GL_ARB_fragment_program_shadow +#define GL_ARB_fragment_program_shadow 1 +#endif + +#ifndef GL_ARB_draw_buffers +#define GL_ARB_draw_buffers 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawBuffersARB (GLsizei n, const GLenum *bufs); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDRAWBUFFERSARBPROC) (GLsizei n, const GLenum *bufs); +#endif + +#ifndef GL_ARB_texture_rectangle +#define GL_ARB_texture_rectangle 1 +#endif + +#ifndef GL_ARB_color_buffer_float +#define GL_ARB_color_buffer_float 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glClampColorARB (GLenum target, GLenum clamp); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCLAMPCOLORARBPROC) (GLenum target, GLenum clamp); +#endif + +#ifndef GL_ARB_half_float_pixel +#define GL_ARB_half_float_pixel 1 +#endif + +#ifndef GL_ARB_texture_float +#define GL_ARB_texture_float 1 +#endif + +#ifndef GL_ARB_pixel_buffer_object +#define GL_ARB_pixel_buffer_object 1 +#endif + +#ifndef GL_ARB_depth_buffer_float +#define GL_ARB_depth_buffer_float 1 +#endif + +#ifndef GL_ARB_draw_instanced +#define GL_ARB_draw_instanced 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawArraysInstancedARB (GLenum mode, GLint first, GLsizei count, GLsizei primcount); +GLAPI void APIENTRY glDrawElementsInstancedARB (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei primcount); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDARBPROC) (GLenum mode, GLint first, GLsizei count, GLsizei primcount); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDARBPROC) (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei primcount); +#endif + +#ifndef GL_ARB_framebuffer_object +#define GL_ARB_framebuffer_object 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLboolean APIENTRY glIsRenderbuffer (GLuint renderbuffer); +GLAPI void APIENTRY glBindRenderbuffer (GLenum target, GLuint renderbuffer); +GLAPI void APIENTRY glDeleteRenderbuffers (GLsizei n, const GLuint *renderbuffers); +GLAPI void APIENTRY glGenRenderbuffers (GLsizei n, GLuint *renderbuffers); +GLAPI void APIENTRY glRenderbufferStorage (GLenum target, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glGetRenderbufferParameteriv (GLenum target, GLenum pname, GLint *params); +GLAPI GLboolean APIENTRY glIsFramebuffer (GLuint framebuffer); +GLAPI void APIENTRY glBindFramebuffer (GLenum target, GLuint framebuffer); +GLAPI void APIENTRY glDeleteFramebuffers (GLsizei n, const GLuint *framebuffers); +GLAPI void APIENTRY glGenFramebuffers (GLsizei n, GLuint *framebuffers); +GLAPI GLenum APIENTRY glCheckFramebufferStatus (GLenum target); +GLAPI void APIENTRY glFramebufferTexture1D (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +GLAPI void APIENTRY glFramebufferTexture2D (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +GLAPI void APIENTRY glFramebufferTexture3D (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset); +GLAPI void APIENTRY glFramebufferRenderbuffer (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +GLAPI void APIENTRY glGetFramebufferAttachmentParameteriv (GLenum target, GLenum attachment, GLenum pname, GLint *params); +GLAPI void APIENTRY glGenerateMipmap (GLenum target); +GLAPI void APIENTRY glBlitFramebuffer (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +GLAPI void APIENTRY glRenderbufferStorageMultisample (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glFramebufferTextureLayer (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef GLboolean (APIENTRYP PFNGLISRENDERBUFFERPROC) (GLuint renderbuffer); +typedef void (APIENTRYP PFNGLBINDRENDERBUFFERPROC) (GLenum target, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLDELETERENDERBUFFERSPROC) (GLsizei n, const GLuint *renderbuffers); +typedef void (APIENTRYP PFNGLGENRENDERBUFFERSPROC) (GLsizei n, GLuint *renderbuffers); +typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETRENDERBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef GLboolean (APIENTRYP PFNGLISFRAMEBUFFERPROC) (GLuint framebuffer); +typedef void (APIENTRYP PFNGLBINDFRAMEBUFFERPROC) (GLenum target, GLuint framebuffer); +typedef void (APIENTRYP PFNGLDELETEFRAMEBUFFERSPROC) (GLsizei n, const GLuint *framebuffers); +typedef void (APIENTRYP PFNGLGENFRAMEBUFFERSPROC) (GLsizei n, GLuint *framebuffers); +typedef GLenum (APIENTRYP PFNGLCHECKFRAMEBUFFERSTATUSPROC) (GLenum target); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE1DPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE2DPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE3DPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset); +typedef void (APIENTRYP PFNGLFRAMEBUFFERRENDERBUFFERPROC) (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLGETFRAMEBUFFERATTACHMENTPARAMETERIVPROC) (GLenum target, GLenum attachment, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGENERATEMIPMAPPROC) (GLenum target); +typedef void (APIENTRYP PFNGLBLITFRAMEBUFFERPROC) (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURELAYERPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); +#endif + +#ifndef GL_ARB_framebuffer_sRGB +#define GL_ARB_framebuffer_sRGB 1 +#endif + +#ifndef GL_ARB_geometry_shader4 +#define GL_ARB_geometry_shader4 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glProgramParameteriARB (GLuint program, GLenum pname, GLint value); +GLAPI void APIENTRY glFramebufferTextureARB (GLenum target, GLenum attachment, GLuint texture, GLint level); +GLAPI void APIENTRY glFramebufferTextureLayerARB (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); +GLAPI void APIENTRY glFramebufferTextureFaceARB (GLenum target, GLenum attachment, GLuint texture, GLint level, GLenum face); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPROGRAMPARAMETERIARBPROC) (GLuint program, GLenum pname, GLint value); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREARBPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURELAYERARBPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREFACEARBPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLenum face); +#endif + +#ifndef GL_ARB_half_float_vertex +#define GL_ARB_half_float_vertex 1 +#endif + +#ifndef GL_ARB_instanced_arrays +#define GL_ARB_instanced_arrays 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexAttribDivisorARB (GLuint index, GLuint divisor); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLVERTEXATTRIBDIVISORARBPROC) (GLuint index, GLuint divisor); +#endif + +#ifndef GL_ARB_map_buffer_range +#define GL_ARB_map_buffer_range 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLvoid* APIENTRY glMapBufferRange (GLenum target, GLintptr offset, GLsizeiptr length, GLbitfield access); +GLAPI void APIENTRY glFlushMappedBufferRange (GLenum target, GLintptr offset, GLsizeiptr length); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef GLvoid* (APIENTRYP PFNGLMAPBUFFERRANGEPROC) (GLenum target, GLintptr offset, GLsizeiptr length, GLbitfield access); +typedef void (APIENTRYP PFNGLFLUSHMAPPEDBUFFERRANGEPROC) (GLenum target, GLintptr offset, GLsizeiptr length); +#endif + +#ifndef GL_ARB_texture_buffer_object +#define GL_ARB_texture_buffer_object 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexBufferARB (GLenum target, GLenum internalformat, GLuint buffer); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTEXBUFFERARBPROC) (GLenum target, GLenum internalformat, GLuint buffer); +#endif + +#ifndef GL_ARB_texture_compression_rgtc +#define GL_ARB_texture_compression_rgtc 1 +#endif + +#ifndef GL_ARB_texture_rg +#define GL_ARB_texture_rg 1 +#endif + +#ifndef GL_ARB_vertex_array_object +#define GL_ARB_vertex_array_object 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBindVertexArray (GLuint array); +GLAPI void APIENTRY glDeleteVertexArrays (GLsizei n, const GLuint *arrays); +GLAPI void APIENTRY glGenVertexArrays (GLsizei n, GLuint *arrays); +GLAPI GLboolean APIENTRY glIsVertexArray (GLuint array); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBINDVERTEXARRAYPROC) (GLuint array); +typedef void (APIENTRYP PFNGLDELETEVERTEXARRAYSPROC) (GLsizei n, const GLuint *arrays); +typedef void (APIENTRYP PFNGLGENVERTEXARRAYSPROC) (GLsizei n, GLuint *arrays); +typedef GLboolean (APIENTRYP PFNGLISVERTEXARRAYPROC) (GLuint array); +#endif + +#ifndef GL_ARB_uniform_buffer_object +#define GL_ARB_uniform_buffer_object 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetUniformIndices (GLuint program, GLsizei uniformCount, const GLchar* *uniformNames, GLuint *uniformIndices); +GLAPI void APIENTRY glGetActiveUniformsiv (GLuint program, GLsizei uniformCount, const GLuint *uniformIndices, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetActiveUniformName (GLuint program, GLuint uniformIndex, GLsizei bufSize, GLsizei *length, GLchar *uniformName); +GLAPI GLuint APIENTRY glGetUniformBlockIndex (GLuint program, const GLchar *uniformBlockName); +GLAPI void APIENTRY glGetActiveUniformBlockiv (GLuint program, GLuint uniformBlockIndex, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetActiveUniformBlockName (GLuint program, GLuint uniformBlockIndex, GLsizei bufSize, GLsizei *length, GLchar *uniformBlockName); +GLAPI void APIENTRY glUniformBlockBinding (GLuint program, GLuint uniformBlockIndex, GLuint uniformBlockBinding); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGETUNIFORMINDICESPROC) (GLuint program, GLsizei uniformCount, const GLchar* *uniformNames, GLuint *uniformIndices); +typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMSIVPROC) (GLuint program, GLsizei uniformCount, const GLuint *uniformIndices, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMNAMEPROC) (GLuint program, GLuint uniformIndex, GLsizei bufSize, GLsizei *length, GLchar *uniformName); +typedef GLuint (APIENTRYP PFNGLGETUNIFORMBLOCKINDEXPROC) (GLuint program, const GLchar *uniformBlockName); +typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMBLOCKIVPROC) (GLuint program, GLuint uniformBlockIndex, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMBLOCKNAMEPROC) (GLuint program, GLuint uniformBlockIndex, GLsizei bufSize, GLsizei *length, GLchar *uniformBlockName); +typedef void (APIENTRYP PFNGLUNIFORMBLOCKBINDINGPROC) (GLuint program, GLuint uniformBlockIndex, GLuint uniformBlockBinding); +#endif + +#ifndef GL_ARB_compatibility +#define GL_ARB_compatibility 1 +#endif + +#ifndef GL_ARB_copy_buffer +#define GL_ARB_copy_buffer 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCopyBufferSubData (GLenum readTarget, GLenum writeTarget, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCOPYBUFFERSUBDATAPROC) (GLenum readTarget, GLenum writeTarget, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +#endif + +#ifndef GL_ARB_shader_texture_lod +#define GL_ARB_shader_texture_lod 1 +#endif + +#ifndef GL_ARB_depth_clamp +#define GL_ARB_depth_clamp 1 +#endif + +#ifndef GL_ARB_draw_elements_base_vertex +#define GL_ARB_draw_elements_base_vertex 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawElementsBaseVertex (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLint basevertex); +GLAPI void APIENTRY glDrawRangeElementsBaseVertex (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices, GLint basevertex); +GLAPI void APIENTRY glDrawElementsInstancedBaseVertex (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei primcount, GLint basevertex); +GLAPI void APIENTRY glMultiDrawElementsBaseVertex (GLenum mode, const GLsizei *count, GLenum type, const GLvoid* *indices, GLsizei primcount, const GLint *basevertex); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDRAWELEMENTSBASEVERTEXPROC) (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLint basevertex); +typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSBASEVERTEXPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices, GLint basevertex); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXPROC) (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei primcount, GLint basevertex); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSBASEVERTEXPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid* *indices, GLsizei primcount, const GLint *basevertex); +#endif + +#ifndef GL_ARB_fragment_coord_conventions +#define GL_ARB_fragment_coord_conventions 1 +#endif + +#ifndef GL_ARB_provoking_vertex +#define GL_ARB_provoking_vertex 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glProvokingVertex (GLenum mode); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPROVOKINGVERTEXPROC) (GLenum mode); +#endif + +#ifndef GL_ARB_seamless_cube_map +#define GL_ARB_seamless_cube_map 1 +#endif + +#ifndef GL_ARB_sync +#define GL_ARB_sync 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLsync APIENTRY glFenceSync (GLenum condition, GLbitfield flags); +GLAPI GLboolean APIENTRY glIsSync (GLsync sync); +GLAPI void APIENTRY glDeleteSync (GLsync sync); +GLAPI GLenum APIENTRY glClientWaitSync (GLsync sync, GLbitfield flags, GLuint64 timeout); +GLAPI void APIENTRY glWaitSync (GLsync sync, GLbitfield flags, GLuint64 timeout); +GLAPI void APIENTRY glGetInteger64v (GLenum pname, GLint64 *params); +GLAPI void APIENTRY glGetSynciv (GLsync sync, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef GLsync (APIENTRYP PFNGLFENCESYNCPROC) (GLenum condition, GLbitfield flags); +typedef GLboolean (APIENTRYP PFNGLISSYNCPROC) (GLsync sync); +typedef void (APIENTRYP PFNGLDELETESYNCPROC) (GLsync sync); +typedef GLenum (APIENTRYP PFNGLCLIENTWAITSYNCPROC) (GLsync sync, GLbitfield flags, GLuint64 timeout); +typedef void (APIENTRYP PFNGLWAITSYNCPROC) (GLsync sync, GLbitfield flags, GLuint64 timeout); +typedef void (APIENTRYP PFNGLGETINTEGER64VPROC) (GLenum pname, GLint64 *params); +typedef void (APIENTRYP PFNGLGETSYNCIVPROC) (GLsync sync, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values); +#endif + +#ifndef GL_ARB_texture_multisample +#define GL_ARB_texture_multisample 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexImage2DMultisample (GLenum target, GLsizei samples, GLint internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glTexImage3DMultisample (GLenum target, GLsizei samples, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +GLAPI void APIENTRY glGetMultisamplefv (GLenum pname, GLuint index, GLfloat *val); +GLAPI void APIENTRY glSampleMaski (GLuint index, GLbitfield mask); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTEXIMAGE2DMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLint internalformat, GLsizei width, GLsizei height, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLTEXIMAGE3DMULTISAMPLEPROC) (GLenum target, GLsizei samples, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedsamplelocations); +typedef void (APIENTRYP PFNGLGETMULTISAMPLEFVPROC) (GLenum pname, GLuint index, GLfloat *val); +typedef void (APIENTRYP PFNGLSAMPLEMASKIPROC) (GLuint index, GLbitfield mask); +#endif + +#ifndef GL_ARB_vertex_array_bgra +#define GL_ARB_vertex_array_bgra 1 +#endif + +#ifndef GL_ARB_draw_buffers_blend +#define GL_ARB_draw_buffers_blend 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendEquationiARB (GLuint buf, GLenum mode); +GLAPI void APIENTRY glBlendEquationSeparateiARB (GLuint buf, GLenum modeRGB, GLenum modeAlpha); +GLAPI void APIENTRY glBlendFunciARB (GLuint buf, GLenum src, GLenum dst); +GLAPI void APIENTRY glBlendFuncSeparateiARB (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBLENDEQUATIONIARBPROC) (GLuint buf, GLenum mode); +typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEIARBPROC) (GLuint buf, GLenum modeRGB, GLenum modeAlpha); +typedef void (APIENTRYP PFNGLBLENDFUNCIARBPROC) (GLuint buf, GLenum src, GLenum dst); +typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEIARBPROC) (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); +#endif + +#ifndef GL_ARB_sample_shading +#define GL_ARB_sample_shading 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMinSampleShadingARB (GLclampf value); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLMINSAMPLESHADINGARBPROC) (GLclampf value); +#endif + +#ifndef GL_ARB_texture_cube_map_array +#define GL_ARB_texture_cube_map_array 1 +#endif + +#ifndef GL_ARB_texture_gather +#define GL_ARB_texture_gather 1 +#endif + +#ifndef GL_ARB_texture_query_lod +#define GL_ARB_texture_query_lod 1 +#endif + +#ifndef GL_ARB_shading_language_include +#define GL_ARB_shading_language_include 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glNamedStringARB (GLenum type, GLint namelen, const GLchar *name, GLint stringlen, const GLchar *string); +GLAPI void APIENTRY glDeleteNamedStringARB (GLint namelen, const GLchar *name); +GLAPI void APIENTRY glCompileShaderIncludeARB (GLuint shader, GLsizei count, const GLchar* *path, const GLint *length); +GLAPI GLboolean APIENTRY glIsNamedStringARB (GLint namelen, const GLchar *name); +GLAPI void APIENTRY glGetNamedStringARB (GLint namelen, const GLchar *name, GLsizei bufSize, GLint *stringlen, GLchar *string); +GLAPI void APIENTRY glGetNamedStringivARB (GLint namelen, const GLchar *name, GLenum pname, GLint *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLNAMEDSTRINGARBPROC) (GLenum type, GLint namelen, const GLchar *name, GLint stringlen, const GLchar *string); +typedef void (APIENTRYP PFNGLDELETENAMEDSTRINGARBPROC) (GLint namelen, const GLchar *name); +typedef void (APIENTRYP PFNGLCOMPILESHADERINCLUDEARBPROC) (GLuint shader, GLsizei count, const GLchar* *path, const GLint *length); +typedef GLboolean (APIENTRYP PFNGLISNAMEDSTRINGARBPROC) (GLint namelen, const GLchar *name); +typedef void (APIENTRYP PFNGLGETNAMEDSTRINGARBPROC) (GLint namelen, const GLchar *name, GLsizei bufSize, GLint *stringlen, GLchar *string); +typedef void (APIENTRYP PFNGLGETNAMEDSTRINGIVARBPROC) (GLint namelen, const GLchar *name, GLenum pname, GLint *params); +#endif + +#ifndef GL_ARB_texture_compression_bptc +#define GL_ARB_texture_compression_bptc 1 +#endif + +#ifndef GL_ARB_blend_func_extended +#define GL_ARB_blend_func_extended 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBindFragDataLocationIndexed (GLuint program, GLuint colorNumber, GLuint index, const GLchar *name); +GLAPI GLint APIENTRY glGetFragDataIndex (GLuint program, const GLchar *name); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBINDFRAGDATALOCATIONINDEXEDPROC) (GLuint program, GLuint colorNumber, GLuint index, const GLchar *name); +typedef GLint (APIENTRYP PFNGLGETFRAGDATAINDEXPROC) (GLuint program, const GLchar *name); +#endif + +#ifndef GL_ARB_explicit_attrib_location +#define GL_ARB_explicit_attrib_location 1 +#endif + +#ifndef GL_ARB_occlusion_query2 +#define GL_ARB_occlusion_query2 1 +#endif + +#ifndef GL_ARB_sampler_objects +#define GL_ARB_sampler_objects 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGenSamplers (GLsizei count, GLuint *samplers); +GLAPI void APIENTRY glDeleteSamplers (GLsizei count, const GLuint *samplers); +GLAPI GLboolean APIENTRY glIsSampler (GLuint sampler); +GLAPI void APIENTRY glBindSampler (GLuint unit, GLuint sampler); +GLAPI void APIENTRY glSamplerParameteri (GLuint sampler, GLenum pname, GLint param); +GLAPI void APIENTRY glSamplerParameteriv (GLuint sampler, GLenum pname, const GLint *param); +GLAPI void APIENTRY glSamplerParameterf (GLuint sampler, GLenum pname, GLfloat param); +GLAPI void APIENTRY glSamplerParameterfv (GLuint sampler, GLenum pname, const GLfloat *param); +GLAPI void APIENTRY glSamplerParameterIiv (GLuint sampler, GLenum pname, const GLint *param); +GLAPI void APIENTRY glSamplerParameterIuiv (GLuint sampler, GLenum pname, const GLuint *param); +GLAPI void APIENTRY glGetSamplerParameteriv (GLuint sampler, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetSamplerParameterIiv (GLuint sampler, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetSamplerParameterfv (GLuint sampler, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetSamplerParameterIuiv (GLuint sampler, GLenum pname, GLuint *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGENSAMPLERSPROC) (GLsizei count, GLuint *samplers); +typedef void (APIENTRYP PFNGLDELETESAMPLERSPROC) (GLsizei count, const GLuint *samplers); +typedef GLboolean (APIENTRYP PFNGLISSAMPLERPROC) (GLuint sampler); +typedef void (APIENTRYP PFNGLBINDSAMPLERPROC) (GLuint unit, GLuint sampler); +typedef void (APIENTRYP PFNGLSAMPLERPARAMETERIPROC) (GLuint sampler, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLSAMPLERPARAMETERIVPROC) (GLuint sampler, GLenum pname, const GLint *param); +typedef void (APIENTRYP PFNGLSAMPLERPARAMETERFPROC) (GLuint sampler, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLSAMPLERPARAMETERFVPROC) (GLuint sampler, GLenum pname, const GLfloat *param); +typedef void (APIENTRYP PFNGLSAMPLERPARAMETERIIVPROC) (GLuint sampler, GLenum pname, const GLint *param); +typedef void (APIENTRYP PFNGLSAMPLERPARAMETERIUIVPROC) (GLuint sampler, GLenum pname, const GLuint *param); +typedef void (APIENTRYP PFNGLGETSAMPLERPARAMETERIVPROC) (GLuint sampler, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETSAMPLERPARAMETERIIVPROC) (GLuint sampler, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETSAMPLERPARAMETERFVPROC) (GLuint sampler, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETSAMPLERPARAMETERIUIVPROC) (GLuint sampler, GLenum pname, GLuint *params); +#endif + +#ifndef GL_ARB_texture_rgb10_a2ui +#define GL_ARB_texture_rgb10_a2ui 1 +#endif + +#ifndef GL_ARB_texture_swizzle +#define GL_ARB_texture_swizzle 1 +#endif + +#ifndef GL_ARB_timer_query +#define GL_ARB_timer_query 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glQueryCounter (GLuint id, GLenum target); +GLAPI void APIENTRY glGetQueryObjecti64v (GLuint id, GLenum pname, GLint64 *params); +GLAPI void APIENTRY glGetQueryObjectui64v (GLuint id, GLenum pname, GLuint64 *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLQUERYCOUNTERPROC) (GLuint id, GLenum target); +typedef void (APIENTRYP PFNGLGETQUERYOBJECTI64VPROC) (GLuint id, GLenum pname, GLint64 *params); +typedef void (APIENTRYP PFNGLGETQUERYOBJECTUI64VPROC) (GLuint id, GLenum pname, GLuint64 *params); +#endif + +#ifndef GL_ARB_vertex_type_2_10_10_10_rev +#define GL_ARB_vertex_type_2_10_10_10_rev 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexP2ui (GLenum type, GLuint value); +GLAPI void APIENTRY glVertexP2uiv (GLenum type, const GLuint *value); +GLAPI void APIENTRY glVertexP3ui (GLenum type, GLuint value); +GLAPI void APIENTRY glVertexP3uiv (GLenum type, const GLuint *value); +GLAPI void APIENTRY glVertexP4ui (GLenum type, GLuint value); +GLAPI void APIENTRY glVertexP4uiv (GLenum type, const GLuint *value); +GLAPI void APIENTRY glTexCoordP1ui (GLenum type, GLuint coords); +GLAPI void APIENTRY glTexCoordP1uiv (GLenum type, const GLuint *coords); +GLAPI void APIENTRY glTexCoordP2ui (GLenum type, GLuint coords); +GLAPI void APIENTRY glTexCoordP2uiv (GLenum type, const GLuint *coords); +GLAPI void APIENTRY glTexCoordP3ui (GLenum type, GLuint coords); +GLAPI void APIENTRY glTexCoordP3uiv (GLenum type, const GLuint *coords); +GLAPI void APIENTRY glTexCoordP4ui (GLenum type, GLuint coords); +GLAPI void APIENTRY glTexCoordP4uiv (GLenum type, const GLuint *coords); +GLAPI void APIENTRY glMultiTexCoordP1ui (GLenum texture, GLenum type, GLuint coords); +GLAPI void APIENTRY glMultiTexCoordP1uiv (GLenum texture, GLenum type, const GLuint *coords); +GLAPI void APIENTRY glMultiTexCoordP2ui (GLenum texture, GLenum type, GLuint coords); +GLAPI void APIENTRY glMultiTexCoordP2uiv (GLenum texture, GLenum type, const GLuint *coords); +GLAPI void APIENTRY glMultiTexCoordP3ui (GLenum texture, GLenum type, GLuint coords); +GLAPI void APIENTRY glMultiTexCoordP3uiv (GLenum texture, GLenum type, const GLuint *coords); +GLAPI void APIENTRY glMultiTexCoordP4ui (GLenum texture, GLenum type, GLuint coords); +GLAPI void APIENTRY glMultiTexCoordP4uiv (GLenum texture, GLenum type, const GLuint *coords); +GLAPI void APIENTRY glNormalP3ui (GLenum type, GLuint coords); +GLAPI void APIENTRY glNormalP3uiv (GLenum type, const GLuint *coords); +GLAPI void APIENTRY glColorP3ui (GLenum type, GLuint color); +GLAPI void APIENTRY glColorP3uiv (GLenum type, const GLuint *color); +GLAPI void APIENTRY glColorP4ui (GLenum type, GLuint color); +GLAPI void APIENTRY glColorP4uiv (GLenum type, const GLuint *color); +GLAPI void APIENTRY glSecondaryColorP3ui (GLenum type, GLuint color); +GLAPI void APIENTRY glSecondaryColorP3uiv (GLenum type, const GLuint *color); +GLAPI void APIENTRY glVertexAttribP1ui (GLuint index, GLenum type, GLboolean normalized, GLuint value); +GLAPI void APIENTRY glVertexAttribP1uiv (GLuint index, GLenum type, GLboolean normalized, const GLuint *value); +GLAPI void APIENTRY glVertexAttribP2ui (GLuint index, GLenum type, GLboolean normalized, GLuint value); +GLAPI void APIENTRY glVertexAttribP2uiv (GLuint index, GLenum type, GLboolean normalized, const GLuint *value); +GLAPI void APIENTRY glVertexAttribP3ui (GLuint index, GLenum type, GLboolean normalized, GLuint value); +GLAPI void APIENTRY glVertexAttribP3uiv (GLuint index, GLenum type, GLboolean normalized, const GLuint *value); +GLAPI void APIENTRY glVertexAttribP4ui (GLuint index, GLenum type, GLboolean normalized, GLuint value); +GLAPI void APIENTRY glVertexAttribP4uiv (GLuint index, GLenum type, GLboolean normalized, const GLuint *value); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLVERTEXP2UIPROC) (GLenum type, GLuint value); +typedef void (APIENTRYP PFNGLVERTEXP2UIVPROC) (GLenum type, const GLuint *value); +typedef void (APIENTRYP PFNGLVERTEXP3UIPROC) (GLenum type, GLuint value); +typedef void (APIENTRYP PFNGLVERTEXP3UIVPROC) (GLenum type, const GLuint *value); +typedef void (APIENTRYP PFNGLVERTEXP4UIPROC) (GLenum type, GLuint value); +typedef void (APIENTRYP PFNGLVERTEXP4UIVPROC) (GLenum type, const GLuint *value); +typedef void (APIENTRYP PFNGLTEXCOORDP1UIPROC) (GLenum type, GLuint coords); +typedef void (APIENTRYP PFNGLTEXCOORDP1UIVPROC) (GLenum type, const GLuint *coords); +typedef void (APIENTRYP PFNGLTEXCOORDP2UIPROC) (GLenum type, GLuint coords); +typedef void (APIENTRYP PFNGLTEXCOORDP2UIVPROC) (GLenum type, const GLuint *coords); +typedef void (APIENTRYP PFNGLTEXCOORDP3UIPROC) (GLenum type, GLuint coords); +typedef void (APIENTRYP PFNGLTEXCOORDP3UIVPROC) (GLenum type, const GLuint *coords); +typedef void (APIENTRYP PFNGLTEXCOORDP4UIPROC) (GLenum type, GLuint coords); +typedef void (APIENTRYP PFNGLTEXCOORDP4UIVPROC) (GLenum type, const GLuint *coords); +typedef void (APIENTRYP PFNGLMULTITEXCOORDP1UIPROC) (GLenum texture, GLenum type, GLuint coords); +typedef void (APIENTRYP PFNGLMULTITEXCOORDP1UIVPROC) (GLenum texture, GLenum type, const GLuint *coords); +typedef void (APIENTRYP PFNGLMULTITEXCOORDP2UIPROC) (GLenum texture, GLenum type, GLuint coords); +typedef void (APIENTRYP PFNGLMULTITEXCOORDP2UIVPROC) (GLenum texture, GLenum type, const GLuint *coords); +typedef void (APIENTRYP PFNGLMULTITEXCOORDP3UIPROC) (GLenum texture, GLenum type, GLuint coords); +typedef void (APIENTRYP PFNGLMULTITEXCOORDP3UIVPROC) (GLenum texture, GLenum type, const GLuint *coords); +typedef void (APIENTRYP PFNGLMULTITEXCOORDP4UIPROC) (GLenum texture, GLenum type, GLuint coords); +typedef void (APIENTRYP PFNGLMULTITEXCOORDP4UIVPROC) (GLenum texture, GLenum type, const GLuint *coords); +typedef void (APIENTRYP PFNGLNORMALP3UIPROC) (GLenum type, GLuint coords); +typedef void (APIENTRYP PFNGLNORMALP3UIVPROC) (GLenum type, const GLuint *coords); +typedef void (APIENTRYP PFNGLCOLORP3UIPROC) (GLenum type, GLuint color); +typedef void (APIENTRYP PFNGLCOLORP3UIVPROC) (GLenum type, const GLuint *color); +typedef void (APIENTRYP PFNGLCOLORP4UIPROC) (GLenum type, GLuint color); +typedef void (APIENTRYP PFNGLCOLORP4UIVPROC) (GLenum type, const GLuint *color); +typedef void (APIENTRYP PFNGLSECONDARYCOLORP3UIPROC) (GLenum type, GLuint color); +typedef void (APIENTRYP PFNGLSECONDARYCOLORP3UIVPROC) (GLenum type, const GLuint *color); +typedef void (APIENTRYP PFNGLVERTEXATTRIBP1UIPROC) (GLuint index, GLenum type, GLboolean normalized, GLuint value); +typedef void (APIENTRYP PFNGLVERTEXATTRIBP1UIVPROC) (GLuint index, GLenum type, GLboolean normalized, const GLuint *value); +typedef void (APIENTRYP PFNGLVERTEXATTRIBP2UIPROC) (GLuint index, GLenum type, GLboolean normalized, GLuint value); +typedef void (APIENTRYP PFNGLVERTEXATTRIBP2UIVPROC) (GLuint index, GLenum type, GLboolean normalized, const GLuint *value); +typedef void (APIENTRYP PFNGLVERTEXATTRIBP3UIPROC) (GLuint index, GLenum type, GLboolean normalized, GLuint value); +typedef void (APIENTRYP PFNGLVERTEXATTRIBP3UIVPROC) (GLuint index, GLenum type, GLboolean normalized, const GLuint *value); +typedef void (APIENTRYP PFNGLVERTEXATTRIBP4UIPROC) (GLuint index, GLenum type, GLboolean normalized, GLuint value); +typedef void (APIENTRYP PFNGLVERTEXATTRIBP4UIVPROC) (GLuint index, GLenum type, GLboolean normalized, const GLuint *value); +#endif + +#ifndef GL_ARB_draw_indirect +#define GL_ARB_draw_indirect 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawArraysIndirect (GLenum mode, const GLvoid *indirect); +GLAPI void APIENTRY glDrawElementsIndirect (GLenum mode, GLenum type, const GLvoid *indirect); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDRAWARRAYSINDIRECTPROC) (GLenum mode, const GLvoid *indirect); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINDIRECTPROC) (GLenum mode, GLenum type, const GLvoid *indirect); +#endif + +#ifndef GL_ARB_gpu_shader5 +#define GL_ARB_gpu_shader5 1 +#endif + +#ifndef GL_ARB_gpu_shader_fp64 +#define GL_ARB_gpu_shader_fp64 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glUniform1d (GLint location, GLdouble x); +GLAPI void APIENTRY glUniform2d (GLint location, GLdouble x, GLdouble y); +GLAPI void APIENTRY glUniform3d (GLint location, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glUniform4d (GLint location, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glUniform1dv (GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glUniform2dv (GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glUniform3dv (GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glUniform4dv (GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix2dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix3dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix4dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix2x3dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix2x4dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix3x2dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix3x4dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix4x2dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glUniformMatrix4x3dv (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glGetUniformdv (GLuint program, GLint location, GLdouble *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLUNIFORM1DPROC) (GLint location, GLdouble x); +typedef void (APIENTRYP PFNGLUNIFORM2DPROC) (GLint location, GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLUNIFORM3DPROC) (GLint location, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLUNIFORM4DPROC) (GLint location, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLUNIFORM1DVPROC) (GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORM2DVPROC) (GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORM3DVPROC) (GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORM4DVPROC) (GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX2DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX3DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX4DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX2X3DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX2X4DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX3X2DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX3X4DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX4X2DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX4X3DVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLGETUNIFORMDVPROC) (GLuint program, GLint location, GLdouble *params); +#endif + +#ifndef GL_ARB_shader_subroutine +#define GL_ARB_shader_subroutine 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLint APIENTRY glGetSubroutineUniformLocation (GLuint program, GLenum shadertype, const GLchar *name); +GLAPI GLuint APIENTRY glGetSubroutineIndex (GLuint program, GLenum shadertype, const GLchar *name); +GLAPI void APIENTRY glGetActiveSubroutineUniformiv (GLuint program, GLenum shadertype, GLuint index, GLenum pname, GLint *values); +GLAPI void APIENTRY glGetActiveSubroutineUniformName (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei *length, GLchar *name); +GLAPI void APIENTRY glGetActiveSubroutineName (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei *length, GLchar *name); +GLAPI void APIENTRY glUniformSubroutinesuiv (GLenum shadertype, GLsizei count, const GLuint *indices); +GLAPI void APIENTRY glGetUniformSubroutineuiv (GLenum shadertype, GLint location, GLuint *params); +GLAPI void APIENTRY glGetProgramStageiv (GLuint program, GLenum shadertype, GLenum pname, GLint *values); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef GLint (APIENTRYP PFNGLGETSUBROUTINEUNIFORMLOCATIONPROC) (GLuint program, GLenum shadertype, const GLchar *name); +typedef GLuint (APIENTRYP PFNGLGETSUBROUTINEINDEXPROC) (GLuint program, GLenum shadertype, const GLchar *name); +typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINEUNIFORMIVPROC) (GLuint program, GLenum shadertype, GLuint index, GLenum pname, GLint *values); +typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINEUNIFORMNAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei *length, GLchar *name); +typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINENAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei *length, GLchar *name); +typedef void (APIENTRYP PFNGLUNIFORMSUBROUTINESUIVPROC) (GLenum shadertype, GLsizei count, const GLuint *indices); +typedef void (APIENTRYP PFNGLGETUNIFORMSUBROUTINEUIVPROC) (GLenum shadertype, GLint location, GLuint *params); +typedef void (APIENTRYP PFNGLGETPROGRAMSTAGEIVPROC) (GLuint program, GLenum shadertype, GLenum pname, GLint *values); +#endif + +#ifndef GL_ARB_tessellation_shader +#define GL_ARB_tessellation_shader 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPatchParameteri (GLenum pname, GLint value); +GLAPI void APIENTRY glPatchParameterfv (GLenum pname, const GLfloat *values); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPATCHPARAMETERIPROC) (GLenum pname, GLint value); +typedef void (APIENTRYP PFNGLPATCHPARAMETERFVPROC) (GLenum pname, const GLfloat *values); +#endif + +#ifndef GL_ARB_texture_buffer_object_rgb32 +#define GL_ARB_texture_buffer_object_rgb32 1 +#endif + +#ifndef GL_ARB_transform_feedback2 +#define GL_ARB_transform_feedback2 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBindTransformFeedback (GLenum target, GLuint id); +GLAPI void APIENTRY glDeleteTransformFeedbacks (GLsizei n, const GLuint *ids); +GLAPI void APIENTRY glGenTransformFeedbacks (GLsizei n, GLuint *ids); +GLAPI GLboolean APIENTRY glIsTransformFeedback (GLuint id); +GLAPI void APIENTRY glPauseTransformFeedback (void); +GLAPI void APIENTRY glResumeTransformFeedback (void); +GLAPI void APIENTRY glDrawTransformFeedback (GLenum mode, GLuint id); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBINDTRANSFORMFEEDBACKPROC) (GLenum target, GLuint id); +typedef void (APIENTRYP PFNGLDELETETRANSFORMFEEDBACKSPROC) (GLsizei n, const GLuint *ids); +typedef void (APIENTRYP PFNGLGENTRANSFORMFEEDBACKSPROC) (GLsizei n, GLuint *ids); +typedef GLboolean (APIENTRYP PFNGLISTRANSFORMFEEDBACKPROC) (GLuint id); +typedef void (APIENTRYP PFNGLPAUSETRANSFORMFEEDBACKPROC) (void); +typedef void (APIENTRYP PFNGLRESUMETRANSFORMFEEDBACKPROC) (void); +typedef void (APIENTRYP PFNGLDRAWTRANSFORMFEEDBACKPROC) (GLenum mode, GLuint id); +#endif + +#ifndef GL_ARB_transform_feedback3 +#define GL_ARB_transform_feedback3 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawTransformFeedbackStream (GLenum mode, GLuint id, GLuint stream); +GLAPI void APIENTRY glBeginQueryIndexed (GLenum target, GLuint index, GLuint id); +GLAPI void APIENTRY glEndQueryIndexed (GLenum target, GLuint index); +GLAPI void APIENTRY glGetQueryIndexediv (GLenum target, GLuint index, GLenum pname, GLint *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDRAWTRANSFORMFEEDBACKSTREAMPROC) (GLenum mode, GLuint id, GLuint stream); +typedef void (APIENTRYP PFNGLBEGINQUERYINDEXEDPROC) (GLenum target, GLuint index, GLuint id); +typedef void (APIENTRYP PFNGLENDQUERYINDEXEDPROC) (GLenum target, GLuint index); +typedef void (APIENTRYP PFNGLGETQUERYINDEXEDIVPROC) (GLenum target, GLuint index, GLenum pname, GLint *params); +#endif + +#ifndef GL_ARB_ES2_compatibility +#define GL_ARB_ES2_compatibility 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glReleaseShaderCompiler (void); +GLAPI void APIENTRY glShaderBinary (GLsizei count, const GLuint *shaders, GLenum binaryformat, const GLvoid *binary, GLsizei length); +GLAPI void APIENTRY glGetShaderPrecisionFormat (GLenum shadertype, GLenum precisiontype, GLint *range, GLint *precision); +GLAPI void APIENTRY glDepthRangef (GLclampf n, GLclampf f); +GLAPI void APIENTRY glClearDepthf (GLclampf d); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLRELEASESHADERCOMPILERPROC) (void); +typedef void (APIENTRYP PFNGLSHADERBINARYPROC) (GLsizei count, const GLuint *shaders, GLenum binaryformat, const GLvoid *binary, GLsizei length); +typedef void (APIENTRYP PFNGLGETSHADERPRECISIONFORMATPROC) (GLenum shadertype, GLenum precisiontype, GLint *range, GLint *precision); +typedef void (APIENTRYP PFNGLDEPTHRANGEFPROC) (GLclampf n, GLclampf f); +typedef void (APIENTRYP PFNGLCLEARDEPTHFPROC) (GLclampf d); +#endif + +#ifndef GL_ARB_get_program_binary +#define GL_ARB_get_program_binary 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetProgramBinary (GLuint program, GLsizei bufSize, GLsizei *length, GLenum *binaryFormat, GLvoid *binary); +GLAPI void APIENTRY glProgramBinary (GLuint program, GLenum binaryFormat, const GLvoid *binary, GLsizei length); +GLAPI void APIENTRY glProgramParameteri (GLuint program, GLenum pname, GLint value); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGETPROGRAMBINARYPROC) (GLuint program, GLsizei bufSize, GLsizei *length, GLenum *binaryFormat, GLvoid *binary); +typedef void (APIENTRYP PFNGLPROGRAMBINARYPROC) (GLuint program, GLenum binaryFormat, const GLvoid *binary, GLsizei length); +typedef void (APIENTRYP PFNGLPROGRAMPARAMETERIPROC) (GLuint program, GLenum pname, GLint value); +#endif + +#ifndef GL_ARB_separate_shader_objects +#define GL_ARB_separate_shader_objects 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glUseProgramStages (GLuint pipeline, GLbitfield stages, GLuint program); +GLAPI void APIENTRY glActiveShaderProgram (GLuint pipeline, GLuint program); +GLAPI GLuint APIENTRY glCreateShaderProgramv (GLenum type, GLsizei count, const GLchar* *strings); +GLAPI void APIENTRY glBindProgramPipeline (GLuint pipeline); +GLAPI void APIENTRY glDeleteProgramPipelines (GLsizei n, const GLuint *pipelines); +GLAPI void APIENTRY glGenProgramPipelines (GLsizei n, GLuint *pipelines); +GLAPI GLboolean APIENTRY glIsProgramPipeline (GLuint pipeline); +GLAPI void APIENTRY glGetProgramPipelineiv (GLuint pipeline, GLenum pname, GLint *params); +GLAPI void APIENTRY glProgramUniform1i (GLuint program, GLint location, GLint v0); +GLAPI void APIENTRY glProgramUniform1iv (GLuint program, GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glProgramUniform1f (GLuint program, GLint location, GLfloat v0); +GLAPI void APIENTRY glProgramUniform1fv (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform1d (GLuint program, GLint location, GLdouble v0); +GLAPI void APIENTRY glProgramUniform1dv (GLuint program, GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glProgramUniform1ui (GLuint program, GLint location, GLuint v0); +GLAPI void APIENTRY glProgramUniform1uiv (GLuint program, GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glProgramUniform2i (GLuint program, GLint location, GLint v0, GLint v1); +GLAPI void APIENTRY glProgramUniform2iv (GLuint program, GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glProgramUniform2f (GLuint program, GLint location, GLfloat v0, GLfloat v1); +GLAPI void APIENTRY glProgramUniform2fv (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform2d (GLuint program, GLint location, GLdouble v0, GLdouble v1); +GLAPI void APIENTRY glProgramUniform2dv (GLuint program, GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glProgramUniform2ui (GLuint program, GLint location, GLuint v0, GLuint v1); +GLAPI void APIENTRY glProgramUniform2uiv (GLuint program, GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glProgramUniform3i (GLuint program, GLint location, GLint v0, GLint v1, GLint v2); +GLAPI void APIENTRY glProgramUniform3iv (GLuint program, GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glProgramUniform3f (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +GLAPI void APIENTRY glProgramUniform3fv (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform3d (GLuint program, GLint location, GLdouble v0, GLdouble v1, GLdouble v2); +GLAPI void APIENTRY glProgramUniform3dv (GLuint program, GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glProgramUniform3ui (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2); +GLAPI void APIENTRY glProgramUniform3uiv (GLuint program, GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glProgramUniform4i (GLuint program, GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +GLAPI void APIENTRY glProgramUniform4iv (GLuint program, GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glProgramUniform4f (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +GLAPI void APIENTRY glProgramUniform4fv (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform4d (GLuint program, GLint location, GLdouble v0, GLdouble v1, GLdouble v2, GLdouble v3); +GLAPI void APIENTRY glProgramUniform4dv (GLuint program, GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glProgramUniform4ui (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); +GLAPI void APIENTRY glProgramUniform4uiv (GLuint program, GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glProgramUniformMatrix2fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix3fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix4fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix2dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix3dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix4dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix2x3fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix3x2fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix2x4fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix4x2fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix3x4fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix4x3fv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix2x3dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix3x2dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix2x4dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix4x2dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix3x4dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix4x3dv (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glValidateProgramPipeline (GLuint pipeline); +GLAPI void APIENTRY glGetProgramPipelineInfoLog (GLuint pipeline, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLUSEPROGRAMSTAGESPROC) (GLuint pipeline, GLbitfield stages, GLuint program); +typedef void (APIENTRYP PFNGLACTIVESHADERPROGRAMPROC) (GLuint pipeline, GLuint program); +typedef GLuint (APIENTRYP PFNGLCREATESHADERPROGRAMVPROC) (GLenum type, GLsizei count, const GLchar* *strings); +typedef void (APIENTRYP PFNGLBINDPROGRAMPIPELINEPROC) (GLuint pipeline); +typedef void (APIENTRYP PFNGLDELETEPROGRAMPIPELINESPROC) (GLsizei n, const GLuint *pipelines); +typedef void (APIENTRYP PFNGLGENPROGRAMPIPELINESPROC) (GLsizei n, GLuint *pipelines); +typedef GLboolean (APIENTRYP PFNGLISPROGRAMPIPELINEPROC) (GLuint pipeline); +typedef void (APIENTRYP PFNGLGETPROGRAMPIPELINEIVPROC) (GLuint pipeline, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1IPROC) (GLuint program, GLint location, GLint v0); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1IVPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1FPROC) (GLuint program, GLint location, GLfloat v0); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1FVPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1DPROC) (GLuint program, GLint location, GLdouble v0); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1DVPROC) (GLuint program, GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UIPROC) (GLuint program, GLint location, GLuint v0); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UIVPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2IPROC) (GLuint program, GLint location, GLint v0, GLint v1); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2IVPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2FPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2FVPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2DPROC) (GLuint program, GLint location, GLdouble v0, GLdouble v1); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2DVPROC) (GLuint program, GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UIPROC) (GLuint program, GLint location, GLuint v0, GLuint v1); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UIVPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3IPROC) (GLuint program, GLint location, GLint v0, GLint v1, GLint v2); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3IVPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3FPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3FVPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3DPROC) (GLuint program, GLint location, GLdouble v0, GLdouble v1, GLdouble v2); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3DVPROC) (GLuint program, GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UIPROC) (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UIVPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4IPROC) (GLuint program, GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4IVPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4FPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4FVPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4DPROC) (GLuint program, GLint location, GLdouble v0, GLdouble v1, GLdouble v2, GLdouble v3); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4DVPROC) (GLuint program, GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UIPROC) (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UIVPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X3FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X2FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X4FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X2FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X4FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X3FVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X3DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X2DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X4DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X2DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X4DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X3DVPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLVALIDATEPROGRAMPIPELINEPROC) (GLuint pipeline); +typedef void (APIENTRYP PFNGLGETPROGRAMPIPELINEINFOLOGPROC) (GLuint pipeline, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +#endif + +#ifndef GL_ARB_vertex_attrib_64bit +#define GL_ARB_vertex_attrib_64bit 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexAttribL1d (GLuint index, GLdouble x); +GLAPI void APIENTRY glVertexAttribL2d (GLuint index, GLdouble x, GLdouble y); +GLAPI void APIENTRY glVertexAttribL3d (GLuint index, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glVertexAttribL4d (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glVertexAttribL1dv (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribL2dv (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribL3dv (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribL4dv (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribLPointer (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glGetVertexAttribLdv (GLuint index, GLenum pname, GLdouble *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1DPROC) (GLuint index, GLdouble x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL2DPROC) (GLuint index, GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL3DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL4DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL2DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL3DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL4DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBLPOINTERPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBLDVPROC) (GLuint index, GLenum pname, GLdouble *params); +#endif + +#ifndef GL_ARB_viewport_array +#define GL_ARB_viewport_array 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glViewportArrayv (GLuint first, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glViewportIndexedf (GLuint index, GLfloat x, GLfloat y, GLfloat w, GLfloat h); +GLAPI void APIENTRY glViewportIndexedfv (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glScissorArrayv (GLuint first, GLsizei count, const GLint *v); +GLAPI void APIENTRY glScissorIndexed (GLuint index, GLint left, GLint bottom, GLsizei width, GLsizei height); +GLAPI void APIENTRY glScissorIndexedv (GLuint index, const GLint *v); +GLAPI void APIENTRY glDepthRangeArrayv (GLuint first, GLsizei count, const GLclampd *v); +GLAPI void APIENTRY glDepthRangeIndexed (GLuint index, GLclampd n, GLclampd f); +GLAPI void APIENTRY glGetFloati_v (GLenum target, GLuint index, GLfloat *data); +GLAPI void APIENTRY glGetDoublei_v (GLenum target, GLuint index, GLdouble *data); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLVIEWPORTARRAYVPROC) (GLuint first, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLVIEWPORTINDEXEDFPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat w, GLfloat h); +typedef void (APIENTRYP PFNGLVIEWPORTINDEXEDFVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLSCISSORARRAYVPROC) (GLuint first, GLsizei count, const GLint *v); +typedef void (APIENTRYP PFNGLSCISSORINDEXEDPROC) (GLuint index, GLint left, GLint bottom, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLSCISSORINDEXEDVPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLDEPTHRANGEARRAYVPROC) (GLuint first, GLsizei count, const GLclampd *v); +typedef void (APIENTRYP PFNGLDEPTHRANGEINDEXEDPROC) (GLuint index, GLclampd n, GLclampd f); +typedef void (APIENTRYP PFNGLGETFLOATI_VPROC) (GLenum target, GLuint index, GLfloat *data); +typedef void (APIENTRYP PFNGLGETDOUBLEI_VPROC) (GLenum target, GLuint index, GLdouble *data); +#endif + +#ifndef GL_ARB_cl_event +#define GL_ARB_cl_event 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLsync APIENTRY glCreateSyncFromCLeventARB (struct _cl_context * context, struct _cl_event * event, GLbitfield flags); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef GLsync (APIENTRYP PFNGLCREATESYNCFROMCLEVENTARBPROC) (struct _cl_context * context, struct _cl_event * event, GLbitfield flags); +#endif + +#ifndef GL_ARB_debug_output +#define GL_ARB_debug_output 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDebugMessageControlARB (GLenum source, GLenum type, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); +GLAPI void APIENTRY glDebugMessageInsertARB (GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar *buf); +GLAPI void APIENTRY glDebugMessageCallbackARB (GLDEBUGPROCARB callback, const GLvoid *userParam); +GLAPI GLuint APIENTRY glGetDebugMessageLogARB (GLuint count, GLsizei bufsize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDEBUGMESSAGECONTROLARBPROC) (GLenum source, GLenum type, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); +typedef void (APIENTRYP PFNGLDEBUGMESSAGEINSERTARBPROC) (GLenum source, GLenum type, GLuint id, GLenum severity, GLsizei length, const GLchar *buf); +typedef void (APIENTRYP PFNGLDEBUGMESSAGECALLBACKARBPROC) (GLDEBUGPROCARB callback, const GLvoid *userParam); +typedef GLuint (APIENTRYP PFNGLGETDEBUGMESSAGELOGARBPROC) (GLuint count, GLsizei bufsize, GLenum *sources, GLenum *types, GLuint *ids, GLenum *severities, GLsizei *lengths, GLchar *messageLog); +#endif + +#ifndef GL_ARB_robustness +#define GL_ARB_robustness 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLenum APIENTRY glGetGraphicsResetStatusARB (void); +GLAPI void APIENTRY glGetnMapdvARB (GLenum target, GLenum query, GLsizei bufSize, GLdouble *v); +GLAPI void APIENTRY glGetnMapfvARB (GLenum target, GLenum query, GLsizei bufSize, GLfloat *v); +GLAPI void APIENTRY glGetnMapivARB (GLenum target, GLenum query, GLsizei bufSize, GLint *v); +GLAPI void APIENTRY glGetnPixelMapfvARB (GLenum map, GLsizei bufSize, GLfloat *values); +GLAPI void APIENTRY glGetnPixelMapuivARB (GLenum map, GLsizei bufSize, GLuint *values); +GLAPI void APIENTRY glGetnPixelMapusvARB (GLenum map, GLsizei bufSize, GLushort *values); +GLAPI void APIENTRY glGetnPolygonStippleARB (GLsizei bufSize, GLubyte *pattern); +GLAPI void APIENTRY glGetnColorTableARB (GLenum target, GLenum format, GLenum type, GLsizei bufSize, GLvoid *table); +GLAPI void APIENTRY glGetnConvolutionFilterARB (GLenum target, GLenum format, GLenum type, GLsizei bufSize, GLvoid *image); +GLAPI void APIENTRY glGetnSeparableFilterARB (GLenum target, GLenum format, GLenum type, GLsizei rowBufSize, GLvoid *row, GLsizei columnBufSize, GLvoid *column, GLvoid *span); +GLAPI void APIENTRY glGetnHistogramARB (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, GLvoid *values); +GLAPI void APIENTRY glGetnMinmaxARB (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, GLvoid *values); +GLAPI void APIENTRY glGetnTexImageARB (GLenum target, GLint level, GLenum format, GLenum type, GLsizei bufSize, GLvoid *img); +GLAPI void APIENTRY glReadnPixelsARB (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, GLvoid *data); +GLAPI void APIENTRY glGetnCompressedTexImageARB (GLenum target, GLint lod, GLsizei bufSize, GLvoid *img); +GLAPI void APIENTRY glGetnUniformfvARB (GLuint program, GLint location, GLsizei bufSize, GLfloat *params); +GLAPI void APIENTRY glGetnUniformivARB (GLuint program, GLint location, GLsizei bufSize, GLint *params); +GLAPI void APIENTRY glGetnUniformuivARB (GLuint program, GLint location, GLsizei bufSize, GLuint *params); +GLAPI void APIENTRY glGetnUniformdvARB (GLuint program, GLint location, GLsizei bufSize, GLdouble *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef GLenum (APIENTRYP PFNGLGETGRAPHICSRESETSTATUSARBPROC) (void); +typedef void (APIENTRYP PFNGLGETNMAPDVARBPROC) (GLenum target, GLenum query, GLsizei bufSize, GLdouble *v); +typedef void (APIENTRYP PFNGLGETNMAPFVARBPROC) (GLenum target, GLenum query, GLsizei bufSize, GLfloat *v); +typedef void (APIENTRYP PFNGLGETNMAPIVARBPROC) (GLenum target, GLenum query, GLsizei bufSize, GLint *v); +typedef void (APIENTRYP PFNGLGETNPIXELMAPFVARBPROC) (GLenum map, GLsizei bufSize, GLfloat *values); +typedef void (APIENTRYP PFNGLGETNPIXELMAPUIVARBPROC) (GLenum map, GLsizei bufSize, GLuint *values); +typedef void (APIENTRYP PFNGLGETNPIXELMAPUSVARBPROC) (GLenum map, GLsizei bufSize, GLushort *values); +typedef void (APIENTRYP PFNGLGETNPOLYGONSTIPPLEARBPROC) (GLsizei bufSize, GLubyte *pattern); +typedef void (APIENTRYP PFNGLGETNCOLORTABLEARBPROC) (GLenum target, GLenum format, GLenum type, GLsizei bufSize, GLvoid *table); +typedef void (APIENTRYP PFNGLGETNCONVOLUTIONFILTERARBPROC) (GLenum target, GLenum format, GLenum type, GLsizei bufSize, GLvoid *image); +typedef void (APIENTRYP PFNGLGETNSEPARABLEFILTERARBPROC) (GLenum target, GLenum format, GLenum type, GLsizei rowBufSize, GLvoid *row, GLsizei columnBufSize, GLvoid *column, GLvoid *span); +typedef void (APIENTRYP PFNGLGETNHISTOGRAMARBPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, GLvoid *values); +typedef void (APIENTRYP PFNGLGETNMINMAXARBPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLsizei bufSize, GLvoid *values); +typedef void (APIENTRYP PFNGLGETNTEXIMAGEARBPROC) (GLenum target, GLint level, GLenum format, GLenum type, GLsizei bufSize, GLvoid *img); +typedef void (APIENTRYP PFNGLREADNPIXELSARBPROC) (GLint x, GLint y, GLsizei width, GLsizei height, GLenum format, GLenum type, GLsizei bufSize, GLvoid *data); +typedef void (APIENTRYP PFNGLGETNCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint lod, GLsizei bufSize, GLvoid *img); +typedef void (APIENTRYP PFNGLGETNUNIFORMFVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLfloat *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMIVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLint *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMUIVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLuint *params); +typedef void (APIENTRYP PFNGLGETNUNIFORMDVARBPROC) (GLuint program, GLint location, GLsizei bufSize, GLdouble *params); +#endif + +#ifndef GL_ARB_shader_stencil_export +#define GL_ARB_shader_stencil_export 1 +#endif + +#ifndef GL_EXT_abgr +#define GL_EXT_abgr 1 +#endif + +#ifndef GL_EXT_blend_color +#define GL_EXT_blend_color 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendColorEXT (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBLENDCOLOREXTPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha); +#endif + +#ifndef GL_EXT_polygon_offset +#define GL_EXT_polygon_offset 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPolygonOffsetEXT (GLfloat factor, GLfloat bias); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPOLYGONOFFSETEXTPROC) (GLfloat factor, GLfloat bias); +#endif + +#ifndef GL_EXT_texture +#define GL_EXT_texture 1 +#endif + +#ifndef GL_EXT_texture3D +#define GL_EXT_texture3D 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexImage3DEXT (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glTexSubImage3DEXT (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTEXIMAGE3DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +#endif + +#ifndef GL_SGIS_texture_filter4 +#define GL_SGIS_texture_filter4 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetTexFilterFuncSGIS (GLenum target, GLenum filter, GLfloat *weights); +GLAPI void APIENTRY glTexFilterFuncSGIS (GLenum target, GLenum filter, GLsizei n, const GLfloat *weights); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGETTEXFILTERFUNCSGISPROC) (GLenum target, GLenum filter, GLfloat *weights); +typedef void (APIENTRYP PFNGLTEXFILTERFUNCSGISPROC) (GLenum target, GLenum filter, GLsizei n, const GLfloat *weights); +#endif + +#ifndef GL_EXT_subtexture +#define GL_EXT_subtexture 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexSubImage1DEXT (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glTexSubImage2DEXT (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels); +#endif + +#ifndef GL_EXT_copy_texture +#define GL_EXT_copy_texture 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCopyTexImage1DEXT (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); +GLAPI void APIENTRY glCopyTexImage2DEXT (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); +GLAPI void APIENTRY glCopyTexSubImage1DEXT (GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +GLAPI void APIENTRY glCopyTexSubImage2DEXT (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glCopyTexSubImage3DEXT (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCOPYTEXIMAGE1DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); +typedef void (APIENTRYP PFNGLCOPYTEXIMAGE2DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); +typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +#endif + +#ifndef GL_EXT_histogram +#define GL_EXT_histogram 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetHistogramEXT (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +GLAPI void APIENTRY glGetHistogramParameterfvEXT (GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetHistogramParameterivEXT (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetMinmaxEXT (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +GLAPI void APIENTRY glGetMinmaxParameterfvEXT (GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetMinmaxParameterivEXT (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glHistogramEXT (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); +GLAPI void APIENTRY glMinmaxEXT (GLenum target, GLenum internalformat, GLboolean sink); +GLAPI void APIENTRY glResetHistogramEXT (GLenum target); +GLAPI void APIENTRY glResetMinmaxEXT (GLenum target); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGETHISTOGRAMEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETMINMAXEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLHISTOGRAMEXTPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); +typedef void (APIENTRYP PFNGLMINMAXEXTPROC) (GLenum target, GLenum internalformat, GLboolean sink); +typedef void (APIENTRYP PFNGLRESETHISTOGRAMEXTPROC) (GLenum target); +typedef void (APIENTRYP PFNGLRESETMINMAXEXTPROC) (GLenum target); +#endif + +#ifndef GL_EXT_convolution +#define GL_EXT_convolution 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glConvolutionFilter1DEXT (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image); +GLAPI void APIENTRY glConvolutionFilter2DEXT (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image); +GLAPI void APIENTRY glConvolutionParameterfEXT (GLenum target, GLenum pname, GLfloat params); +GLAPI void APIENTRY glConvolutionParameterfvEXT (GLenum target, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glConvolutionParameteriEXT (GLenum target, GLenum pname, GLint params); +GLAPI void APIENTRY glConvolutionParameterivEXT (GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glCopyConvolutionFilter1DEXT (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); +GLAPI void APIENTRY glCopyConvolutionFilter2DEXT (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glGetConvolutionFilterEXT (GLenum target, GLenum format, GLenum type, GLvoid *image); +GLAPI void APIENTRY glGetConvolutionParameterfvEXT (GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetConvolutionParameterivEXT (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetSeparableFilterEXT (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span); +GLAPI void APIENTRY glSeparableFilter2DEXT (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image); +typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat params); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint params); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image); +typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETSEPARABLEFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span); +typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column); +#endif + +#ifndef GL_SGI_color_matrix +#define GL_SGI_color_matrix 1 +#endif + +#ifndef GL_SGI_color_table +#define GL_SGI_color_table 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glColorTableSGI (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); +GLAPI void APIENTRY glColorTableParameterfvSGI (GLenum target, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glColorTableParameterivSGI (GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glCopyColorTableSGI (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); +GLAPI void APIENTRY glGetColorTableSGI (GLenum target, GLenum format, GLenum type, GLvoid *table); +GLAPI void APIENTRY glGetColorTableParameterfvSGI (GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetColorTableParameterivSGI (GLenum target, GLenum pname, GLint *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); +typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLCOPYCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLGETCOLORTABLESGIPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table); +typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, GLint *params); +#endif + +#ifndef GL_SGIX_pixel_texture +#define GL_SGIX_pixel_texture 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPixelTexGenSGIX (GLenum mode); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPIXELTEXGENSGIXPROC) (GLenum mode); +#endif + +#ifndef GL_SGIS_pixel_texture +#define GL_SGIS_pixel_texture 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPixelTexGenParameteriSGIS (GLenum pname, GLint param); +GLAPI void APIENTRY glPixelTexGenParameterivSGIS (GLenum pname, const GLint *params); +GLAPI void APIENTRY glPixelTexGenParameterfSGIS (GLenum pname, GLfloat param); +GLAPI void APIENTRY glPixelTexGenParameterfvSGIS (GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glGetPixelTexGenParameterivSGIS (GLenum pname, GLint *params); +GLAPI void APIENTRY glGetPixelTexGenParameterfvSGIS (GLenum pname, GLfloat *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERISGISPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERIVSGISPROC) (GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERFSGISPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERFVSGISPROC) (GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLGETPIXELTEXGENPARAMETERIVSGISPROC) (GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETPIXELTEXGENPARAMETERFVSGISPROC) (GLenum pname, GLfloat *params); +#endif + +#ifndef GL_SGIS_texture4D +#define GL_SGIS_texture4D 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexImage4DSGIS (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLint border, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glTexSubImage4DSGIS (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint woffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLenum format, GLenum type, const GLvoid *pixels); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTEXIMAGE4DSGISPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLint border, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE4DSGISPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint woffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLenum format, GLenum type, const GLvoid *pixels); +#endif + +#ifndef GL_SGI_texture_color_table +#define GL_SGI_texture_color_table 1 +#endif + +#ifndef GL_EXT_cmyka +#define GL_EXT_cmyka 1 +#endif + +#ifndef GL_EXT_texture_object +#define GL_EXT_texture_object 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLboolean APIENTRY glAreTexturesResidentEXT (GLsizei n, const GLuint *textures, GLboolean *residences); +GLAPI void APIENTRY glBindTextureEXT (GLenum target, GLuint texture); +GLAPI void APIENTRY glDeleteTexturesEXT (GLsizei n, const GLuint *textures); +GLAPI void APIENTRY glGenTexturesEXT (GLsizei n, GLuint *textures); +GLAPI GLboolean APIENTRY glIsTextureEXT (GLuint texture); +GLAPI void APIENTRY glPrioritizeTexturesEXT (GLsizei n, const GLuint *textures, const GLclampf *priorities); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef GLboolean (APIENTRYP PFNGLARETEXTURESRESIDENTEXTPROC) (GLsizei n, const GLuint *textures, GLboolean *residences); +typedef void (APIENTRYP PFNGLBINDTEXTUREEXTPROC) (GLenum target, GLuint texture); +typedef void (APIENTRYP PFNGLDELETETEXTURESEXTPROC) (GLsizei n, const GLuint *textures); +typedef void (APIENTRYP PFNGLGENTEXTURESEXTPROC) (GLsizei n, GLuint *textures); +typedef GLboolean (APIENTRYP PFNGLISTEXTUREEXTPROC) (GLuint texture); +typedef void (APIENTRYP PFNGLPRIORITIZETEXTURESEXTPROC) (GLsizei n, const GLuint *textures, const GLclampf *priorities); +#endif + +#ifndef GL_SGIS_detail_texture +#define GL_SGIS_detail_texture 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDetailTexFuncSGIS (GLenum target, GLsizei n, const GLfloat *points); +GLAPI void APIENTRY glGetDetailTexFuncSGIS (GLenum target, GLfloat *points); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDETAILTEXFUNCSGISPROC) (GLenum target, GLsizei n, const GLfloat *points); +typedef void (APIENTRYP PFNGLGETDETAILTEXFUNCSGISPROC) (GLenum target, GLfloat *points); +#endif + +#ifndef GL_SGIS_sharpen_texture +#define GL_SGIS_sharpen_texture 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSharpenTexFuncSGIS (GLenum target, GLsizei n, const GLfloat *points); +GLAPI void APIENTRY glGetSharpenTexFuncSGIS (GLenum target, GLfloat *points); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLSHARPENTEXFUNCSGISPROC) (GLenum target, GLsizei n, const GLfloat *points); +typedef void (APIENTRYP PFNGLGETSHARPENTEXFUNCSGISPROC) (GLenum target, GLfloat *points); +#endif + +#ifndef GL_EXT_packed_pixels +#define GL_EXT_packed_pixels 1 +#endif + +#ifndef GL_SGIS_texture_lod +#define GL_SGIS_texture_lod 1 +#endif + +#ifndef GL_SGIS_multisample +#define GL_SGIS_multisample 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSampleMaskSGIS (GLclampf value, GLboolean invert); +GLAPI void APIENTRY glSamplePatternSGIS (GLenum pattern); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLSAMPLEMASKSGISPROC) (GLclampf value, GLboolean invert); +typedef void (APIENTRYP PFNGLSAMPLEPATTERNSGISPROC) (GLenum pattern); +#endif + +#ifndef GL_EXT_rescale_normal +#define GL_EXT_rescale_normal 1 +#endif + +#ifndef GL_EXT_vertex_array +#define GL_EXT_vertex_array 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glArrayElementEXT (GLint i); +GLAPI void APIENTRY glColorPointerEXT (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); +GLAPI void APIENTRY glDrawArraysEXT (GLenum mode, GLint first, GLsizei count); +GLAPI void APIENTRY glEdgeFlagPointerEXT (GLsizei stride, GLsizei count, const GLboolean *pointer); +GLAPI void APIENTRY glGetPointervEXT (GLenum pname, GLvoid* *params); +GLAPI void APIENTRY glIndexPointerEXT (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); +GLAPI void APIENTRY glNormalPointerEXT (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); +GLAPI void APIENTRY glTexCoordPointerEXT (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); +GLAPI void APIENTRY glVertexPointerEXT (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLARRAYELEMENTEXTPROC) (GLint i); +typedef void (APIENTRYP PFNGLCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLDRAWARRAYSEXTPROC) (GLenum mode, GLint first, GLsizei count); +typedef void (APIENTRYP PFNGLEDGEFLAGPOINTEREXTPROC) (GLsizei stride, GLsizei count, const GLboolean *pointer); +typedef void (APIENTRYP PFNGLGETPOINTERVEXTPROC) (GLenum pname, GLvoid* *params); +typedef void (APIENTRYP PFNGLINDEXPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLNORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLTEXCOORDPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); +#endif + +#ifndef GL_EXT_misc_attribute +#define GL_EXT_misc_attribute 1 +#endif + +#ifndef GL_SGIS_generate_mipmap +#define GL_SGIS_generate_mipmap 1 +#endif + +#ifndef GL_SGIX_clipmap +#define GL_SGIX_clipmap 1 +#endif + +#ifndef GL_SGIX_shadow +#define GL_SGIX_shadow 1 +#endif + +#ifndef GL_SGIS_texture_edge_clamp +#define GL_SGIS_texture_edge_clamp 1 +#endif + +#ifndef GL_SGIS_texture_border_clamp +#define GL_SGIS_texture_border_clamp 1 +#endif + +#ifndef GL_EXT_blend_minmax +#define GL_EXT_blend_minmax 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendEquationEXT (GLenum mode); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBLENDEQUATIONEXTPROC) (GLenum mode); +#endif + +#ifndef GL_EXT_blend_subtract +#define GL_EXT_blend_subtract 1 +#endif + +#ifndef GL_EXT_blend_logic_op +#define GL_EXT_blend_logic_op 1 +#endif + +#ifndef GL_SGIX_interlace +#define GL_SGIX_interlace 1 +#endif + +#ifndef GL_SGIX_pixel_tiles +#define GL_SGIX_pixel_tiles 1 +#endif + +#ifndef GL_SGIX_texture_select +#define GL_SGIX_texture_select 1 +#endif + +#ifndef GL_SGIX_sprite +#define GL_SGIX_sprite 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSpriteParameterfSGIX (GLenum pname, GLfloat param); +GLAPI void APIENTRY glSpriteParameterfvSGIX (GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glSpriteParameteriSGIX (GLenum pname, GLint param); +GLAPI void APIENTRY glSpriteParameterivSGIX (GLenum pname, const GLint *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLSPRITEPARAMETERFSGIXPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLSPRITEPARAMETERFVSGIXPROC) (GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLSPRITEPARAMETERISGIXPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLSPRITEPARAMETERIVSGIXPROC) (GLenum pname, const GLint *params); +#endif + +#ifndef GL_SGIX_texture_multi_buffer +#define GL_SGIX_texture_multi_buffer 1 +#endif + +#ifndef GL_EXT_point_parameters +#define GL_EXT_point_parameters 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPointParameterfEXT (GLenum pname, GLfloat param); +GLAPI void APIENTRY glPointParameterfvEXT (GLenum pname, const GLfloat *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPOINTPARAMETERFEXTPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLPOINTPARAMETERFVEXTPROC) (GLenum pname, const GLfloat *params); +#endif + +#ifndef GL_SGIS_point_parameters +#define GL_SGIS_point_parameters 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPointParameterfSGIS (GLenum pname, GLfloat param); +GLAPI void APIENTRY glPointParameterfvSGIS (GLenum pname, const GLfloat *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPOINTPARAMETERFSGISPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLPOINTPARAMETERFVSGISPROC) (GLenum pname, const GLfloat *params); +#endif + +#ifndef GL_SGIX_instruments +#define GL_SGIX_instruments 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLint APIENTRY glGetInstrumentsSGIX (void); +GLAPI void APIENTRY glInstrumentsBufferSGIX (GLsizei size, GLint *buffer); +GLAPI GLint APIENTRY glPollInstrumentsSGIX (GLint *marker_p); +GLAPI void APIENTRY glReadInstrumentsSGIX (GLint marker); +GLAPI void APIENTRY glStartInstrumentsSGIX (void); +GLAPI void APIENTRY glStopInstrumentsSGIX (GLint marker); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef GLint (APIENTRYP PFNGLGETINSTRUMENTSSGIXPROC) (void); +typedef void (APIENTRYP PFNGLINSTRUMENTSBUFFERSGIXPROC) (GLsizei size, GLint *buffer); +typedef GLint (APIENTRYP PFNGLPOLLINSTRUMENTSSGIXPROC) (GLint *marker_p); +typedef void (APIENTRYP PFNGLREADINSTRUMENTSSGIXPROC) (GLint marker); +typedef void (APIENTRYP PFNGLSTARTINSTRUMENTSSGIXPROC) (void); +typedef void (APIENTRYP PFNGLSTOPINSTRUMENTSSGIXPROC) (GLint marker); +#endif + +#ifndef GL_SGIX_texture_scale_bias +#define GL_SGIX_texture_scale_bias 1 +#endif + +#ifndef GL_SGIX_framezoom +#define GL_SGIX_framezoom 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFrameZoomSGIX (GLint factor); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLFRAMEZOOMSGIXPROC) (GLint factor); +#endif + +#ifndef GL_SGIX_tag_sample_buffer +#define GL_SGIX_tag_sample_buffer 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTagSampleBufferSGIX (void); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTAGSAMPLEBUFFERSGIXPROC) (void); +#endif + +#ifndef GL_SGIX_polynomial_ffd +#define GL_SGIX_polynomial_ffd 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDeformationMap3dSGIX (GLenum target, GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, GLdouble w1, GLdouble w2, GLint wstride, GLint worder, const GLdouble *points); +GLAPI void APIENTRY glDeformationMap3fSGIX (GLenum target, GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, GLfloat w1, GLfloat w2, GLint wstride, GLint worder, const GLfloat *points); +GLAPI void APIENTRY glDeformSGIX (GLbitfield mask); +GLAPI void APIENTRY glLoadIdentityDeformationMapSGIX (GLbitfield mask); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDEFORMATIONMAP3DSGIXPROC) (GLenum target, GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, GLdouble w1, GLdouble w2, GLint wstride, GLint worder, const GLdouble *points); +typedef void (APIENTRYP PFNGLDEFORMATIONMAP3FSGIXPROC) (GLenum target, GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, GLfloat w1, GLfloat w2, GLint wstride, GLint worder, const GLfloat *points); +typedef void (APIENTRYP PFNGLDEFORMSGIXPROC) (GLbitfield mask); +typedef void (APIENTRYP PFNGLLOADIDENTITYDEFORMATIONMAPSGIXPROC) (GLbitfield mask); +#endif + +#ifndef GL_SGIX_reference_plane +#define GL_SGIX_reference_plane 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glReferencePlaneSGIX (const GLdouble *equation); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLREFERENCEPLANESGIXPROC) (const GLdouble *equation); +#endif + +#ifndef GL_SGIX_flush_raster +#define GL_SGIX_flush_raster 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFlushRasterSGIX (void); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLFLUSHRASTERSGIXPROC) (void); +#endif + +#ifndef GL_SGIX_depth_texture +#define GL_SGIX_depth_texture 1 +#endif + +#ifndef GL_SGIS_fog_function +#define GL_SGIS_fog_function 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFogFuncSGIS (GLsizei n, const GLfloat *points); +GLAPI void APIENTRY glGetFogFuncSGIS (GLfloat *points); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLFOGFUNCSGISPROC) (GLsizei n, const GLfloat *points); +typedef void (APIENTRYP PFNGLGETFOGFUNCSGISPROC) (GLfloat *points); +#endif + +#ifndef GL_SGIX_fog_offset +#define GL_SGIX_fog_offset 1 +#endif + +#ifndef GL_HP_image_transform +#define GL_HP_image_transform 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glImageTransformParameteriHP (GLenum target, GLenum pname, GLint param); +GLAPI void APIENTRY glImageTransformParameterfHP (GLenum target, GLenum pname, GLfloat param); +GLAPI void APIENTRY glImageTransformParameterivHP (GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glImageTransformParameterfvHP (GLenum target, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glGetImageTransformParameterivHP (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetImageTransformParameterfvHP (GLenum target, GLenum pname, GLfloat *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERIHPPROC) (GLenum target, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERFHPPROC) (GLenum target, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERIVHPPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERFVHPPROC) (GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLGETIMAGETRANSFORMPARAMETERIVHPPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETIMAGETRANSFORMPARAMETERFVHPPROC) (GLenum target, GLenum pname, GLfloat *params); +#endif + +#ifndef GL_HP_convolution_border_modes +#define GL_HP_convolution_border_modes 1 +#endif + +#ifndef GL_SGIX_texture_add_env +#define GL_SGIX_texture_add_env 1 +#endif + +#ifndef GL_EXT_color_subtable +#define GL_EXT_color_subtable 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glColorSubTableEXT (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data); +GLAPI void APIENTRY glCopyColorSubTableEXT (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); +#endif + +#ifndef GL_PGI_vertex_hints +#define GL_PGI_vertex_hints 1 +#endif + +#ifndef GL_PGI_misc_hints +#define GL_PGI_misc_hints 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glHintPGI (GLenum target, GLint mode); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLHINTPGIPROC) (GLenum target, GLint mode); +#endif + +#ifndef GL_EXT_paletted_texture +#define GL_EXT_paletted_texture 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glColorTableEXT (GLenum target, GLenum internalFormat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); +GLAPI void APIENTRY glGetColorTableEXT (GLenum target, GLenum format, GLenum type, GLvoid *data); +GLAPI void APIENTRY glGetColorTableParameterivEXT (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetColorTableParameterfvEXT (GLenum target, GLenum pname, GLfloat *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCOLORTABLEEXTPROC) (GLenum target, GLenum internalFormat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); +typedef void (APIENTRYP PFNGLGETCOLORTABLEEXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *data); +typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); +#endif + +#ifndef GL_EXT_clip_volume_hint +#define GL_EXT_clip_volume_hint 1 +#endif + +#ifndef GL_SGIX_list_priority +#define GL_SGIX_list_priority 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetListParameterfvSGIX (GLuint list, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetListParameterivSGIX (GLuint list, GLenum pname, GLint *params); +GLAPI void APIENTRY glListParameterfSGIX (GLuint list, GLenum pname, GLfloat param); +GLAPI void APIENTRY glListParameterfvSGIX (GLuint list, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glListParameteriSGIX (GLuint list, GLenum pname, GLint param); +GLAPI void APIENTRY glListParameterivSGIX (GLuint list, GLenum pname, const GLint *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGETLISTPARAMETERFVSGIXPROC) (GLuint list, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETLISTPARAMETERIVSGIXPROC) (GLuint list, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLLISTPARAMETERFSGIXPROC) (GLuint list, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLLISTPARAMETERFVSGIXPROC) (GLuint list, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLLISTPARAMETERISGIXPROC) (GLuint list, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLLISTPARAMETERIVSGIXPROC) (GLuint list, GLenum pname, const GLint *params); +#endif + +#ifndef GL_SGIX_ir_instrument1 +#define GL_SGIX_ir_instrument1 1 +#endif + +#ifndef GL_SGIX_calligraphic_fragment +#define GL_SGIX_calligraphic_fragment 1 +#endif + +#ifndef GL_SGIX_texture_lod_bias +#define GL_SGIX_texture_lod_bias 1 +#endif + +#ifndef GL_SGIX_shadow_ambient +#define GL_SGIX_shadow_ambient 1 +#endif + +#ifndef GL_EXT_index_texture +#define GL_EXT_index_texture 1 +#endif + +#ifndef GL_EXT_index_material +#define GL_EXT_index_material 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glIndexMaterialEXT (GLenum face, GLenum mode); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLINDEXMATERIALEXTPROC) (GLenum face, GLenum mode); +#endif + +#ifndef GL_EXT_index_func +#define GL_EXT_index_func 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glIndexFuncEXT (GLenum func, GLclampf ref); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLINDEXFUNCEXTPROC) (GLenum func, GLclampf ref); +#endif + +#ifndef GL_EXT_index_array_formats +#define GL_EXT_index_array_formats 1 +#endif + +#ifndef GL_EXT_compiled_vertex_array +#define GL_EXT_compiled_vertex_array 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glLockArraysEXT (GLint first, GLsizei count); +GLAPI void APIENTRY glUnlockArraysEXT (void); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLLOCKARRAYSEXTPROC) (GLint first, GLsizei count); +typedef void (APIENTRYP PFNGLUNLOCKARRAYSEXTPROC) (void); +#endif + +#ifndef GL_EXT_cull_vertex +#define GL_EXT_cull_vertex 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCullParameterdvEXT (GLenum pname, GLdouble *params); +GLAPI void APIENTRY glCullParameterfvEXT (GLenum pname, GLfloat *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCULLPARAMETERDVEXTPROC) (GLenum pname, GLdouble *params); +typedef void (APIENTRYP PFNGLCULLPARAMETERFVEXTPROC) (GLenum pname, GLfloat *params); +#endif + +#ifndef GL_SGIX_ycrcb +#define GL_SGIX_ycrcb 1 +#endif + +#ifndef GL_SGIX_fragment_lighting +#define GL_SGIX_fragment_lighting 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFragmentColorMaterialSGIX (GLenum face, GLenum mode); +GLAPI void APIENTRY glFragmentLightfSGIX (GLenum light, GLenum pname, GLfloat param); +GLAPI void APIENTRY glFragmentLightfvSGIX (GLenum light, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glFragmentLightiSGIX (GLenum light, GLenum pname, GLint param); +GLAPI void APIENTRY glFragmentLightivSGIX (GLenum light, GLenum pname, const GLint *params); +GLAPI void APIENTRY glFragmentLightModelfSGIX (GLenum pname, GLfloat param); +GLAPI void APIENTRY glFragmentLightModelfvSGIX (GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glFragmentLightModeliSGIX (GLenum pname, GLint param); +GLAPI void APIENTRY glFragmentLightModelivSGIX (GLenum pname, const GLint *params); +GLAPI void APIENTRY glFragmentMaterialfSGIX (GLenum face, GLenum pname, GLfloat param); +GLAPI void APIENTRY glFragmentMaterialfvSGIX (GLenum face, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glFragmentMaterialiSGIX (GLenum face, GLenum pname, GLint param); +GLAPI void APIENTRY glFragmentMaterialivSGIX (GLenum face, GLenum pname, const GLint *params); +GLAPI void APIENTRY glGetFragmentLightfvSGIX (GLenum light, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetFragmentLightivSGIX (GLenum light, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetFragmentMaterialfvSGIX (GLenum face, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetFragmentMaterialivSGIX (GLenum face, GLenum pname, GLint *params); +GLAPI void APIENTRY glLightEnviSGIX (GLenum pname, GLint param); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLFRAGMENTCOLORMATERIALSGIXPROC) (GLenum face, GLenum mode); +typedef void (APIENTRYP PFNGLFRAGMENTLIGHTFSGIXPROC) (GLenum light, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLFRAGMENTLIGHTFVSGIXPROC) (GLenum light, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLFRAGMENTLIGHTISGIXPROC) (GLenum light, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLFRAGMENTLIGHTIVSGIXPROC) (GLenum light, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELFSGIXPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELFVSGIXPROC) (GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELISGIXPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELIVSGIXPROC) (GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLFRAGMENTMATERIALFSGIXPROC) (GLenum face, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLFRAGMENTMATERIALFVSGIXPROC) (GLenum face, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLFRAGMENTMATERIALISGIXPROC) (GLenum face, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLGETFRAGMENTLIGHTFVSGIXPROC) (GLenum light, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETFRAGMENTLIGHTIVSGIXPROC) (GLenum light, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETFRAGMENTMATERIALFVSGIXPROC) (GLenum face, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLLIGHTENVISGIXPROC) (GLenum pname, GLint param); +#endif + +#ifndef GL_IBM_rasterpos_clip +#define GL_IBM_rasterpos_clip 1 +#endif + +#ifndef GL_HP_texture_lighting +#define GL_HP_texture_lighting 1 +#endif + +#ifndef GL_EXT_draw_range_elements +#define GL_EXT_draw_range_elements 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawRangeElementsEXT (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSEXTPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices); +#endif + +#ifndef GL_WIN_phong_shading +#define GL_WIN_phong_shading 1 +#endif + +#ifndef GL_WIN_specular_fog +#define GL_WIN_specular_fog 1 +#endif + +#ifndef GL_EXT_light_texture +#define GL_EXT_light_texture 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glApplyTextureEXT (GLenum mode); +GLAPI void APIENTRY glTextureLightEXT (GLenum pname); +GLAPI void APIENTRY glTextureMaterialEXT (GLenum face, GLenum mode); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLAPPLYTEXTUREEXTPROC) (GLenum mode); +typedef void (APIENTRYP PFNGLTEXTURELIGHTEXTPROC) (GLenum pname); +typedef void (APIENTRYP PFNGLTEXTUREMATERIALEXTPROC) (GLenum face, GLenum mode); +#endif + +#ifndef GL_SGIX_blend_alpha_minmax +#define GL_SGIX_blend_alpha_minmax 1 +#endif + +#ifndef GL_EXT_bgra +#define GL_EXT_bgra 1 +#endif + +#ifndef GL_SGIX_async +#define GL_SGIX_async 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glAsyncMarkerSGIX (GLuint marker); +GLAPI GLint APIENTRY glFinishAsyncSGIX (GLuint *markerp); +GLAPI GLint APIENTRY glPollAsyncSGIX (GLuint *markerp); +GLAPI GLuint APIENTRY glGenAsyncMarkersSGIX (GLsizei range); +GLAPI void APIENTRY glDeleteAsyncMarkersSGIX (GLuint marker, GLsizei range); +GLAPI GLboolean APIENTRY glIsAsyncMarkerSGIX (GLuint marker); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLASYNCMARKERSGIXPROC) (GLuint marker); +typedef GLint (APIENTRYP PFNGLFINISHASYNCSGIXPROC) (GLuint *markerp); +typedef GLint (APIENTRYP PFNGLPOLLASYNCSGIXPROC) (GLuint *markerp); +typedef GLuint (APIENTRYP PFNGLGENASYNCMARKERSSGIXPROC) (GLsizei range); +typedef void (APIENTRYP PFNGLDELETEASYNCMARKERSSGIXPROC) (GLuint marker, GLsizei range); +typedef GLboolean (APIENTRYP PFNGLISASYNCMARKERSGIXPROC) (GLuint marker); +#endif + +#ifndef GL_SGIX_async_pixel +#define GL_SGIX_async_pixel 1 +#endif + +#ifndef GL_SGIX_async_histogram +#define GL_SGIX_async_histogram 1 +#endif + +#ifndef GL_INTEL_parallel_arrays +#define GL_INTEL_parallel_arrays 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexPointervINTEL (GLint size, GLenum type, const GLvoid* *pointer); +GLAPI void APIENTRY glNormalPointervINTEL (GLenum type, const GLvoid* *pointer); +GLAPI void APIENTRY glColorPointervINTEL (GLint size, GLenum type, const GLvoid* *pointer); +GLAPI void APIENTRY glTexCoordPointervINTEL (GLint size, GLenum type, const GLvoid* *pointer); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLVERTEXPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer); +typedef void (APIENTRYP PFNGLNORMALPOINTERVINTELPROC) (GLenum type, const GLvoid* *pointer); +typedef void (APIENTRYP PFNGLCOLORPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer); +typedef void (APIENTRYP PFNGLTEXCOORDPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer); +#endif + +#ifndef GL_HP_occlusion_test +#define GL_HP_occlusion_test 1 +#endif + +#ifndef GL_EXT_pixel_transform +#define GL_EXT_pixel_transform 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPixelTransformParameteriEXT (GLenum target, GLenum pname, GLint param); +GLAPI void APIENTRY glPixelTransformParameterfEXT (GLenum target, GLenum pname, GLfloat param); +GLAPI void APIENTRY glPixelTransformParameterivEXT (GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glPixelTransformParameterfvEXT (GLenum target, GLenum pname, const GLfloat *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat *params); +#endif + +#ifndef GL_EXT_pixel_transform_color_table +#define GL_EXT_pixel_transform_color_table 1 +#endif + +#ifndef GL_EXT_shared_texture_palette +#define GL_EXT_shared_texture_palette 1 +#endif + +#ifndef GL_EXT_separate_specular_color +#define GL_EXT_separate_specular_color 1 +#endif + +#ifndef GL_EXT_secondary_color +#define GL_EXT_secondary_color 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSecondaryColor3bEXT (GLbyte red, GLbyte green, GLbyte blue); +GLAPI void APIENTRY glSecondaryColor3bvEXT (const GLbyte *v); +GLAPI void APIENTRY glSecondaryColor3dEXT (GLdouble red, GLdouble green, GLdouble blue); +GLAPI void APIENTRY glSecondaryColor3dvEXT (const GLdouble *v); +GLAPI void APIENTRY glSecondaryColor3fEXT (GLfloat red, GLfloat green, GLfloat blue); +GLAPI void APIENTRY glSecondaryColor3fvEXT (const GLfloat *v); +GLAPI void APIENTRY glSecondaryColor3iEXT (GLint red, GLint green, GLint blue); +GLAPI void APIENTRY glSecondaryColor3ivEXT (const GLint *v); +GLAPI void APIENTRY glSecondaryColor3sEXT (GLshort red, GLshort green, GLshort blue); +GLAPI void APIENTRY glSecondaryColor3svEXT (const GLshort *v); +GLAPI void APIENTRY glSecondaryColor3ubEXT (GLubyte red, GLubyte green, GLubyte blue); +GLAPI void APIENTRY glSecondaryColor3ubvEXT (const GLubyte *v); +GLAPI void APIENTRY glSecondaryColor3uiEXT (GLuint red, GLuint green, GLuint blue); +GLAPI void APIENTRY glSecondaryColor3uivEXT (const GLuint *v); +GLAPI void APIENTRY glSecondaryColor3usEXT (GLushort red, GLushort green, GLushort blue); +GLAPI void APIENTRY glSecondaryColor3usvEXT (const GLushort *v); +GLAPI void APIENTRY glSecondaryColorPointerEXT (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BEXTPROC) (GLbyte red, GLbyte green, GLbyte blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BVEXTPROC) (const GLbyte *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DEXTPROC) (GLdouble red, GLdouble green, GLdouble blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DVEXTPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FEXTPROC) (GLfloat red, GLfloat green, GLfloat blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FVEXTPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IEXTPROC) (GLint red, GLint green, GLint blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IVEXTPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SEXTPROC) (GLshort red, GLshort green, GLshort blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SVEXTPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBEXTPROC) (GLubyte red, GLubyte green, GLubyte blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBVEXTPROC) (const GLubyte *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIEXTPROC) (GLuint red, GLuint green, GLuint blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIVEXTPROC) (const GLuint *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USEXTPROC) (GLushort red, GLushort green, GLushort blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USVEXTPROC) (const GLushort *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +#endif + +#ifndef GL_EXT_texture_perturb_normal +#define GL_EXT_texture_perturb_normal 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTextureNormalEXT (GLenum mode); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTEXTURENORMALEXTPROC) (GLenum mode); +#endif + +#ifndef GL_EXT_multi_draw_arrays +#define GL_EXT_multi_draw_arrays 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMultiDrawArraysEXT (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); +GLAPI void APIENTRY glMultiDrawElementsEXT (GLenum mode, const GLsizei *count, GLenum type, const GLvoid* *indices, GLsizei primcount); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSEXTPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSEXTPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid* *indices, GLsizei primcount); +#endif + +#ifndef GL_EXT_fog_coord +#define GL_EXT_fog_coord 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFogCoordfEXT (GLfloat coord); +GLAPI void APIENTRY glFogCoordfvEXT (const GLfloat *coord); +GLAPI void APIENTRY glFogCoorddEXT (GLdouble coord); +GLAPI void APIENTRY glFogCoorddvEXT (const GLdouble *coord); +GLAPI void APIENTRY glFogCoordPointerEXT (GLenum type, GLsizei stride, const GLvoid *pointer); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLFOGCOORDFEXTPROC) (GLfloat coord); +typedef void (APIENTRYP PFNGLFOGCOORDFVEXTPROC) (const GLfloat *coord); +typedef void (APIENTRYP PFNGLFOGCOORDDEXTPROC) (GLdouble coord); +typedef void (APIENTRYP PFNGLFOGCOORDDVEXTPROC) (const GLdouble *coord); +typedef void (APIENTRYP PFNGLFOGCOORDPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); +#endif + +#ifndef GL_REND_screen_coordinates +#define GL_REND_screen_coordinates 1 +#endif + +#ifndef GL_EXT_coordinate_frame +#define GL_EXT_coordinate_frame 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTangent3bEXT (GLbyte tx, GLbyte ty, GLbyte tz); +GLAPI void APIENTRY glTangent3bvEXT (const GLbyte *v); +GLAPI void APIENTRY glTangent3dEXT (GLdouble tx, GLdouble ty, GLdouble tz); +GLAPI void APIENTRY glTangent3dvEXT (const GLdouble *v); +GLAPI void APIENTRY glTangent3fEXT (GLfloat tx, GLfloat ty, GLfloat tz); +GLAPI void APIENTRY glTangent3fvEXT (const GLfloat *v); +GLAPI void APIENTRY glTangent3iEXT (GLint tx, GLint ty, GLint tz); +GLAPI void APIENTRY glTangent3ivEXT (const GLint *v); +GLAPI void APIENTRY glTangent3sEXT (GLshort tx, GLshort ty, GLshort tz); +GLAPI void APIENTRY glTangent3svEXT (const GLshort *v); +GLAPI void APIENTRY glBinormal3bEXT (GLbyte bx, GLbyte by, GLbyte bz); +GLAPI void APIENTRY glBinormal3bvEXT (const GLbyte *v); +GLAPI void APIENTRY glBinormal3dEXT (GLdouble bx, GLdouble by, GLdouble bz); +GLAPI void APIENTRY glBinormal3dvEXT (const GLdouble *v); +GLAPI void APIENTRY glBinormal3fEXT (GLfloat bx, GLfloat by, GLfloat bz); +GLAPI void APIENTRY glBinormal3fvEXT (const GLfloat *v); +GLAPI void APIENTRY glBinormal3iEXT (GLint bx, GLint by, GLint bz); +GLAPI void APIENTRY glBinormal3ivEXT (const GLint *v); +GLAPI void APIENTRY glBinormal3sEXT (GLshort bx, GLshort by, GLshort bz); +GLAPI void APIENTRY glBinormal3svEXT (const GLshort *v); +GLAPI void APIENTRY glTangentPointerEXT (GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glBinormalPointerEXT (GLenum type, GLsizei stride, const GLvoid *pointer); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTANGENT3BEXTPROC) (GLbyte tx, GLbyte ty, GLbyte tz); +typedef void (APIENTRYP PFNGLTANGENT3BVEXTPROC) (const GLbyte *v); +typedef void (APIENTRYP PFNGLTANGENT3DEXTPROC) (GLdouble tx, GLdouble ty, GLdouble tz); +typedef void (APIENTRYP PFNGLTANGENT3DVEXTPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLTANGENT3FEXTPROC) (GLfloat tx, GLfloat ty, GLfloat tz); +typedef void (APIENTRYP PFNGLTANGENT3FVEXTPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLTANGENT3IEXTPROC) (GLint tx, GLint ty, GLint tz); +typedef void (APIENTRYP PFNGLTANGENT3IVEXTPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLTANGENT3SEXTPROC) (GLshort tx, GLshort ty, GLshort tz); +typedef void (APIENTRYP PFNGLTANGENT3SVEXTPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLBINORMAL3BEXTPROC) (GLbyte bx, GLbyte by, GLbyte bz); +typedef void (APIENTRYP PFNGLBINORMAL3BVEXTPROC) (const GLbyte *v); +typedef void (APIENTRYP PFNGLBINORMAL3DEXTPROC) (GLdouble bx, GLdouble by, GLdouble bz); +typedef void (APIENTRYP PFNGLBINORMAL3DVEXTPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLBINORMAL3FEXTPROC) (GLfloat bx, GLfloat by, GLfloat bz); +typedef void (APIENTRYP PFNGLBINORMAL3FVEXTPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLBINORMAL3IEXTPROC) (GLint bx, GLint by, GLint bz); +typedef void (APIENTRYP PFNGLBINORMAL3IVEXTPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLBINORMAL3SEXTPROC) (GLshort bx, GLshort by, GLshort bz); +typedef void (APIENTRYP PFNGLBINORMAL3SVEXTPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLTANGENTPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLBINORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); +#endif + +#ifndef GL_EXT_texture_env_combine +#define GL_EXT_texture_env_combine 1 +#endif + +#ifndef GL_APPLE_specular_vector +#define GL_APPLE_specular_vector 1 +#endif + +#ifndef GL_APPLE_transform_hint +#define GL_APPLE_transform_hint 1 +#endif + +#ifndef GL_SGIX_fog_scale +#define GL_SGIX_fog_scale 1 +#endif + +#ifndef GL_SUNX_constant_data +#define GL_SUNX_constant_data 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFinishTextureSUNX (void); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLFINISHTEXTURESUNXPROC) (void); +#endif + +#ifndef GL_SUN_global_alpha +#define GL_SUN_global_alpha 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGlobalAlphaFactorbSUN (GLbyte factor); +GLAPI void APIENTRY glGlobalAlphaFactorsSUN (GLshort factor); +GLAPI void APIENTRY glGlobalAlphaFactoriSUN (GLint factor); +GLAPI void APIENTRY glGlobalAlphaFactorfSUN (GLfloat factor); +GLAPI void APIENTRY glGlobalAlphaFactordSUN (GLdouble factor); +GLAPI void APIENTRY glGlobalAlphaFactorubSUN (GLubyte factor); +GLAPI void APIENTRY glGlobalAlphaFactorusSUN (GLushort factor); +GLAPI void APIENTRY glGlobalAlphaFactoruiSUN (GLuint factor); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORBSUNPROC) (GLbyte factor); +typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORSSUNPROC) (GLshort factor); +typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORISUNPROC) (GLint factor); +typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORFSUNPROC) (GLfloat factor); +typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORDSUNPROC) (GLdouble factor); +typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUBSUNPROC) (GLubyte factor); +typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUSSUNPROC) (GLushort factor); +typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUISUNPROC) (GLuint factor); +#endif + +#ifndef GL_SUN_triangle_list +#define GL_SUN_triangle_list 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glReplacementCodeuiSUN (GLuint code); +GLAPI void APIENTRY glReplacementCodeusSUN (GLushort code); +GLAPI void APIENTRY glReplacementCodeubSUN (GLubyte code); +GLAPI void APIENTRY glReplacementCodeuivSUN (const GLuint *code); +GLAPI void APIENTRY glReplacementCodeusvSUN (const GLushort *code); +GLAPI void APIENTRY glReplacementCodeubvSUN (const GLubyte *code); +GLAPI void APIENTRY glReplacementCodePointerSUN (GLenum type, GLsizei stride, const GLvoid* *pointer); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUISUNPROC) (GLuint code); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUSSUNPROC) (GLushort code); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUBSUNPROC) (GLubyte code); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVSUNPROC) (const GLuint *code); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUSVSUNPROC) (const GLushort *code); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUBVSUNPROC) (const GLubyte *code); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEPOINTERSUNPROC) (GLenum type, GLsizei stride, const GLvoid* *pointer); +#endif + +#ifndef GL_SUN_vertex +#define GL_SUN_vertex 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glColor4ubVertex2fSUN (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y); +GLAPI void APIENTRY glColor4ubVertex2fvSUN (const GLubyte *c, const GLfloat *v); +GLAPI void APIENTRY glColor4ubVertex3fSUN (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glColor4ubVertex3fvSUN (const GLubyte *c, const GLfloat *v); +GLAPI void APIENTRY glColor3fVertex3fSUN (GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glColor3fVertex3fvSUN (const GLfloat *c, const GLfloat *v); +GLAPI void APIENTRY glNormal3fVertex3fSUN (GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glNormal3fVertex3fvSUN (const GLfloat *n, const GLfloat *v); +GLAPI void APIENTRY glColor4fNormal3fVertex3fSUN (GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glColor4fNormal3fVertex3fvSUN (const GLfloat *c, const GLfloat *n, const GLfloat *v); +GLAPI void APIENTRY glTexCoord2fVertex3fSUN (GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glTexCoord2fVertex3fvSUN (const GLfloat *tc, const GLfloat *v); +GLAPI void APIENTRY glTexCoord4fVertex4fSUN (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glTexCoord4fVertex4fvSUN (const GLfloat *tc, const GLfloat *v); +GLAPI void APIENTRY glTexCoord2fColor4ubVertex3fSUN (GLfloat s, GLfloat t, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glTexCoord2fColor4ubVertex3fvSUN (const GLfloat *tc, const GLubyte *c, const GLfloat *v); +GLAPI void APIENTRY glTexCoord2fColor3fVertex3fSUN (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glTexCoord2fColor3fVertex3fvSUN (const GLfloat *tc, const GLfloat *c, const GLfloat *v); +GLAPI void APIENTRY glTexCoord2fNormal3fVertex3fSUN (GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glTexCoord2fNormal3fVertex3fvSUN (const GLfloat *tc, const GLfloat *n, const GLfloat *v); +GLAPI void APIENTRY glTexCoord2fColor4fNormal3fVertex3fSUN (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glTexCoord2fColor4fNormal3fVertex3fvSUN (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); +GLAPI void APIENTRY glTexCoord4fColor4fNormal3fVertex4fSUN (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glTexCoord4fColor4fNormal3fVertex4fvSUN (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); +GLAPI void APIENTRY glReplacementCodeuiVertex3fSUN (GLuint rc, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glReplacementCodeuiVertex3fvSUN (const GLuint *rc, const GLfloat *v); +GLAPI void APIENTRY glReplacementCodeuiColor4ubVertex3fSUN (GLuint rc, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glReplacementCodeuiColor4ubVertex3fvSUN (const GLuint *rc, const GLubyte *c, const GLfloat *v); +GLAPI void APIENTRY glReplacementCodeuiColor3fVertex3fSUN (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glReplacementCodeuiColor3fVertex3fvSUN (const GLuint *rc, const GLfloat *c, const GLfloat *v); +GLAPI void APIENTRY glReplacementCodeuiNormal3fVertex3fSUN (GLuint rc, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glReplacementCodeuiNormal3fVertex3fvSUN (const GLuint *rc, const GLfloat *n, const GLfloat *v); +GLAPI void APIENTRY glReplacementCodeuiColor4fNormal3fVertex3fSUN (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glReplacementCodeuiColor4fNormal3fVertex3fvSUN (const GLuint *rc, const GLfloat *c, const GLfloat *n, const GLfloat *v); +GLAPI void APIENTRY glReplacementCodeuiTexCoord2fVertex3fSUN (GLuint rc, GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glReplacementCodeuiTexCoord2fVertex3fvSUN (const GLuint *rc, const GLfloat *tc, const GLfloat *v); +GLAPI void APIENTRY glReplacementCodeuiTexCoord2fNormal3fVertex3fSUN (GLuint rc, GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glReplacementCodeuiTexCoord2fNormal3fVertex3fvSUN (const GLuint *rc, const GLfloat *tc, const GLfloat *n, const GLfloat *v); +GLAPI void APIENTRY glReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fSUN (GLuint rc, GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fvSUN (const GLuint *rc, const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX2FSUNPROC) (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX2FVSUNPROC) (const GLubyte *c, const GLfloat *v); +typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX3FSUNPROC) (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX3FVSUNPROC) (const GLubyte *c, const GLfloat *v); +typedef void (APIENTRYP PFNGLCOLOR3FVERTEX3FSUNPROC) (GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLCOLOR3FVERTEX3FVSUNPROC) (const GLfloat *c, const GLfloat *v); +typedef void (APIENTRYP PFNGLNORMAL3FVERTEX3FSUNPROC) (GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *n, const GLfloat *v); +typedef void (APIENTRYP PFNGLCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *c, const GLfloat *n, const GLfloat *v); +typedef void (APIENTRYP PFNGLTEXCOORD2FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLTEXCOORD2FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *v); +typedef void (APIENTRYP PFNGLTEXCOORD4FVERTEX4FSUNPROC) (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLTEXCOORD4FVERTEX4FVSUNPROC) (const GLfloat *tc, const GLfloat *v); +typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4UBVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4UBVERTEX3FVSUNPROC) (const GLfloat *tc, const GLubyte *c, const GLfloat *v); +typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *v); +typedef void (APIENTRYP PFNGLTEXCOORD2FNORMAL3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLTEXCOORD2FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *n, const GLfloat *v); +typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); +typedef void (APIENTRYP PFNGLTEXCOORD4FCOLOR4FNORMAL3FVERTEX4FSUNPROC) (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLTEXCOORD4FCOLOR4FNORMAL3FVERTEX4FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVERTEX3FSUNPROC) (GLuint rc, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *v); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4UBVERTEX3FSUNPROC) (GLuint rc, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4UBVERTEX3FVSUNPROC) (const GLuint *rc, const GLubyte *c, const GLfloat *v); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR3FVERTEX3FSUNPROC) (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *c, const GLfloat *v); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUINORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUINORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *n, const GLfloat *v); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *c, const GLfloat *n, const GLfloat *v); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *v); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *n, const GLfloat *v); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); +#endif + +#ifndef GL_EXT_blend_func_separate +#define GL_EXT_blend_func_separate 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendFuncSeparateEXT (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEEXTPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); +#endif + +#ifndef GL_INGR_blend_func_separate +#define GL_INGR_blend_func_separate 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendFuncSeparateINGR (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEINGRPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); +#endif + +#ifndef GL_INGR_color_clamp +#define GL_INGR_color_clamp 1 +#endif + +#ifndef GL_INGR_interlace_read +#define GL_INGR_interlace_read 1 +#endif + +#ifndef GL_EXT_stencil_wrap +#define GL_EXT_stencil_wrap 1 +#endif + +#ifndef GL_EXT_422_pixels +#define GL_EXT_422_pixels 1 +#endif + +#ifndef GL_NV_texgen_reflection +#define GL_NV_texgen_reflection 1 +#endif + +#ifndef GL_SUN_convolution_border_modes +#define GL_SUN_convolution_border_modes 1 +#endif + +#ifndef GL_EXT_texture_env_add +#define GL_EXT_texture_env_add 1 +#endif + +#ifndef GL_EXT_texture_lod_bias +#define GL_EXT_texture_lod_bias 1 +#endif + +#ifndef GL_EXT_texture_filter_anisotropic +#define GL_EXT_texture_filter_anisotropic 1 +#endif + +#ifndef GL_EXT_vertex_weighting +#define GL_EXT_vertex_weighting 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexWeightfEXT (GLfloat weight); +GLAPI void APIENTRY glVertexWeightfvEXT (const GLfloat *weight); +GLAPI void APIENTRY glVertexWeightPointerEXT (GLsizei size, GLenum type, GLsizei stride, const GLvoid *pointer); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLVERTEXWEIGHTFEXTPROC) (GLfloat weight); +typedef void (APIENTRYP PFNGLVERTEXWEIGHTFVEXTPROC) (const GLfloat *weight); +typedef void (APIENTRYP PFNGLVERTEXWEIGHTPOINTEREXTPROC) (GLsizei size, GLenum type, GLsizei stride, const GLvoid *pointer); +#endif + +#ifndef GL_NV_light_max_exponent +#define GL_NV_light_max_exponent 1 +#endif + +#ifndef GL_NV_vertex_array_range +#define GL_NV_vertex_array_range 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFlushVertexArrayRangeNV (void); +GLAPI void APIENTRY glVertexArrayRangeNV (GLsizei length, const GLvoid *pointer); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGENVPROC) (void); +typedef void (APIENTRYP PFNGLVERTEXARRAYRANGENVPROC) (GLsizei length, const GLvoid *pointer); +#endif + +#ifndef GL_NV_register_combiners +#define GL_NV_register_combiners 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCombinerParameterfvNV (GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glCombinerParameterfNV (GLenum pname, GLfloat param); +GLAPI void APIENTRY glCombinerParameterivNV (GLenum pname, const GLint *params); +GLAPI void APIENTRY glCombinerParameteriNV (GLenum pname, GLint param); +GLAPI void APIENTRY glCombinerInputNV (GLenum stage, GLenum portion, GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage); +GLAPI void APIENTRY glCombinerOutputNV (GLenum stage, GLenum portion, GLenum abOutput, GLenum cdOutput, GLenum sumOutput, GLenum scale, GLenum bias, GLboolean abDotProduct, GLboolean cdDotProduct, GLboolean muxSum); +GLAPI void APIENTRY glFinalCombinerInputNV (GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage); +GLAPI void APIENTRY glGetCombinerInputParameterfvNV (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetCombinerInputParameterivNV (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetCombinerOutputParameterfvNV (GLenum stage, GLenum portion, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetCombinerOutputParameterivNV (GLenum stage, GLenum portion, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetFinalCombinerInputParameterfvNV (GLenum variable, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetFinalCombinerInputParameterivNV (GLenum variable, GLenum pname, GLint *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCOMBINERPARAMETERFVNVPROC) (GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLCOMBINERPARAMETERFNVPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLCOMBINERPARAMETERIVNVPROC) (GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLCOMBINERPARAMETERINVPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLCOMBINERINPUTNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage); +typedef void (APIENTRYP PFNGLCOMBINEROUTPUTNVPROC) (GLenum stage, GLenum portion, GLenum abOutput, GLenum cdOutput, GLenum sumOutput, GLenum scale, GLenum bias, GLboolean abDotProduct, GLboolean cdDotProduct, GLboolean muxSum); +typedef void (APIENTRYP PFNGLFINALCOMBINERINPUTNVPROC) (GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage); +typedef void (APIENTRYP PFNGLGETCOMBINERINPUTPARAMETERFVNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETCOMBINERINPUTPARAMETERIVNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETCOMBINEROUTPUTPARAMETERFVNVPROC) (GLenum stage, GLenum portion, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETCOMBINEROUTPUTPARAMETERIVNVPROC) (GLenum stage, GLenum portion, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETFINALCOMBINERINPUTPARAMETERFVNVPROC) (GLenum variable, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETFINALCOMBINERINPUTPARAMETERIVNVPROC) (GLenum variable, GLenum pname, GLint *params); +#endif + +#ifndef GL_NV_fog_distance +#define GL_NV_fog_distance 1 +#endif + +#ifndef GL_NV_texgen_emboss +#define GL_NV_texgen_emboss 1 +#endif + +#ifndef GL_NV_blend_square +#define GL_NV_blend_square 1 +#endif + +#ifndef GL_NV_texture_env_combine4 +#define GL_NV_texture_env_combine4 1 +#endif + +#ifndef GL_MESA_resize_buffers +#define GL_MESA_resize_buffers 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glResizeBuffersMESA (void); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLRESIZEBUFFERSMESAPROC) (void); +#endif + +#ifndef GL_MESA_window_pos +#define GL_MESA_window_pos 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glWindowPos2dMESA (GLdouble x, GLdouble y); +GLAPI void APIENTRY glWindowPos2dvMESA (const GLdouble *v); +GLAPI void APIENTRY glWindowPos2fMESA (GLfloat x, GLfloat y); +GLAPI void APIENTRY glWindowPos2fvMESA (const GLfloat *v); +GLAPI void APIENTRY glWindowPos2iMESA (GLint x, GLint y); +GLAPI void APIENTRY glWindowPos2ivMESA (const GLint *v); +GLAPI void APIENTRY glWindowPos2sMESA (GLshort x, GLshort y); +GLAPI void APIENTRY glWindowPos2svMESA (const GLshort *v); +GLAPI void APIENTRY glWindowPos3dMESA (GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glWindowPos3dvMESA (const GLdouble *v); +GLAPI void APIENTRY glWindowPos3fMESA (GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glWindowPos3fvMESA (const GLfloat *v); +GLAPI void APIENTRY glWindowPos3iMESA (GLint x, GLint y, GLint z); +GLAPI void APIENTRY glWindowPos3ivMESA (const GLint *v); +GLAPI void APIENTRY glWindowPos3sMESA (GLshort x, GLshort y, GLshort z); +GLAPI void APIENTRY glWindowPos3svMESA (const GLshort *v); +GLAPI void APIENTRY glWindowPos4dMESA (GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glWindowPos4dvMESA (const GLdouble *v); +GLAPI void APIENTRY glWindowPos4fMESA (GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glWindowPos4fvMESA (const GLfloat *v); +GLAPI void APIENTRY glWindowPos4iMESA (GLint x, GLint y, GLint z, GLint w); +GLAPI void APIENTRY glWindowPos4ivMESA (const GLint *v); +GLAPI void APIENTRY glWindowPos4sMESA (GLshort x, GLshort y, GLshort z, GLshort w); +GLAPI void APIENTRY glWindowPos4svMESA (const GLshort *v); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLWINDOWPOS2DMESAPROC) (GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLWINDOWPOS2DVMESAPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2FMESAPROC) (GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLWINDOWPOS2FVMESAPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2IMESAPROC) (GLint x, GLint y); +typedef void (APIENTRYP PFNGLWINDOWPOS2IVMESAPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2SMESAPROC) (GLshort x, GLshort y); +typedef void (APIENTRYP PFNGLWINDOWPOS2SVMESAPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3DMESAPROC) (GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLWINDOWPOS3DVMESAPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3FMESAPROC) (GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLWINDOWPOS3FVMESAPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3IMESAPROC) (GLint x, GLint y, GLint z); +typedef void (APIENTRYP PFNGLWINDOWPOS3IVMESAPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3SMESAPROC) (GLshort x, GLshort y, GLshort z); +typedef void (APIENTRYP PFNGLWINDOWPOS3SVMESAPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLWINDOWPOS4DMESAPROC) (GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLWINDOWPOS4DVMESAPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLWINDOWPOS4FMESAPROC) (GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLWINDOWPOS4FVMESAPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLWINDOWPOS4IMESAPROC) (GLint x, GLint y, GLint z, GLint w); +typedef void (APIENTRYP PFNGLWINDOWPOS4IVMESAPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLWINDOWPOS4SMESAPROC) (GLshort x, GLshort y, GLshort z, GLshort w); +typedef void (APIENTRYP PFNGLWINDOWPOS4SVMESAPROC) (const GLshort *v); +#endif + +#ifndef GL_IBM_cull_vertex +#define GL_IBM_cull_vertex 1 +#endif + +#ifndef GL_IBM_multimode_draw_arrays +#define GL_IBM_multimode_draw_arrays 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMultiModeDrawArraysIBM (const GLenum *mode, const GLint *first, const GLsizei *count, GLsizei primcount, GLint modestride); +GLAPI void APIENTRY glMultiModeDrawElementsIBM (const GLenum *mode, const GLsizei *count, GLenum type, const GLvoid* const *indices, GLsizei primcount, GLint modestride); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLMULTIMODEDRAWARRAYSIBMPROC) (const GLenum *mode, const GLint *first, const GLsizei *count, GLsizei primcount, GLint modestride); +typedef void (APIENTRYP PFNGLMULTIMODEDRAWELEMENTSIBMPROC) (const GLenum *mode, const GLsizei *count, GLenum type, const GLvoid* const *indices, GLsizei primcount, GLint modestride); +#endif + +#ifndef GL_IBM_vertex_array_lists +#define GL_IBM_vertex_array_lists 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glColorPointerListIBM (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); +GLAPI void APIENTRY glSecondaryColorPointerListIBM (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); +GLAPI void APIENTRY glEdgeFlagPointerListIBM (GLint stride, const GLboolean* *pointer, GLint ptrstride); +GLAPI void APIENTRY glFogCoordPointerListIBM (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); +GLAPI void APIENTRY glIndexPointerListIBM (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); +GLAPI void APIENTRY glNormalPointerListIBM (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); +GLAPI void APIENTRY glTexCoordPointerListIBM (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); +GLAPI void APIENTRY glVertexPointerListIBM (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLEDGEFLAGPOINTERLISTIBMPROC) (GLint stride, const GLboolean* *pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLFOGCOORDPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLINDEXPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLNORMALPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLTEXCOORDPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLVERTEXPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); +#endif + +#ifndef GL_SGIX_subsample +#define GL_SGIX_subsample 1 +#endif + +#ifndef GL_SGIX_ycrcba +#define GL_SGIX_ycrcba 1 +#endif + +#ifndef GL_SGIX_ycrcb_subsample +#define GL_SGIX_ycrcb_subsample 1 +#endif + +#ifndef GL_SGIX_depth_pass_instrument +#define GL_SGIX_depth_pass_instrument 1 +#endif + +#ifndef GL_3DFX_texture_compression_FXT1 +#define GL_3DFX_texture_compression_FXT1 1 +#endif + +#ifndef GL_3DFX_multisample +#define GL_3DFX_multisample 1 +#endif + +#ifndef GL_3DFX_tbuffer +#define GL_3DFX_tbuffer 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTbufferMask3DFX (GLuint mask); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTBUFFERMASK3DFXPROC) (GLuint mask); +#endif + +#ifndef GL_EXT_multisample +#define GL_EXT_multisample 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSampleMaskEXT (GLclampf value, GLboolean invert); +GLAPI void APIENTRY glSamplePatternEXT (GLenum pattern); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLSAMPLEMASKEXTPROC) (GLclampf value, GLboolean invert); +typedef void (APIENTRYP PFNGLSAMPLEPATTERNEXTPROC) (GLenum pattern); +#endif + +#ifndef GL_SGIX_vertex_preclip +#define GL_SGIX_vertex_preclip 1 +#endif + +#ifndef GL_SGIX_convolution_accuracy +#define GL_SGIX_convolution_accuracy 1 +#endif + +#ifndef GL_SGIX_resample +#define GL_SGIX_resample 1 +#endif + +#ifndef GL_SGIS_point_line_texgen +#define GL_SGIS_point_line_texgen 1 +#endif + +#ifndef GL_SGIS_texture_color_mask +#define GL_SGIS_texture_color_mask 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTextureColorMaskSGIS (GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTEXTURECOLORMASKSGISPROC) (GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha); +#endif + +#ifndef GL_SGIX_igloo_interface +#define GL_SGIX_igloo_interface 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glIglooInterfaceSGIX (GLenum pname, const GLvoid *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLIGLOOINTERFACESGIXPROC) (GLenum pname, const GLvoid *params); +#endif + +#ifndef GL_EXT_texture_env_dot3 +#define GL_EXT_texture_env_dot3 1 +#endif + +#ifndef GL_ATI_texture_mirror_once +#define GL_ATI_texture_mirror_once 1 +#endif + +#ifndef GL_NV_fence +#define GL_NV_fence 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDeleteFencesNV (GLsizei n, const GLuint *fences); +GLAPI void APIENTRY glGenFencesNV (GLsizei n, GLuint *fences); +GLAPI GLboolean APIENTRY glIsFenceNV (GLuint fence); +GLAPI GLboolean APIENTRY glTestFenceNV (GLuint fence); +GLAPI void APIENTRY glGetFenceivNV (GLuint fence, GLenum pname, GLint *params); +GLAPI void APIENTRY glFinishFenceNV (GLuint fence); +GLAPI void APIENTRY glSetFenceNV (GLuint fence, GLenum condition); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDELETEFENCESNVPROC) (GLsizei n, const GLuint *fences); +typedef void (APIENTRYP PFNGLGENFENCESNVPROC) (GLsizei n, GLuint *fences); +typedef GLboolean (APIENTRYP PFNGLISFENCENVPROC) (GLuint fence); +typedef GLboolean (APIENTRYP PFNGLTESTFENCENVPROC) (GLuint fence); +typedef void (APIENTRYP PFNGLGETFENCEIVNVPROC) (GLuint fence, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLFINISHFENCENVPROC) (GLuint fence); +typedef void (APIENTRYP PFNGLSETFENCENVPROC) (GLuint fence, GLenum condition); +#endif + +#ifndef GL_NV_evaluators +#define GL_NV_evaluators 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMapControlPointsNV (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLint uorder, GLint vorder, GLboolean packed, const GLvoid *points); +GLAPI void APIENTRY glMapParameterivNV (GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glMapParameterfvNV (GLenum target, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glGetMapControlPointsNV (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLboolean packed, GLvoid *points); +GLAPI void APIENTRY glGetMapParameterivNV (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetMapParameterfvNV (GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetMapAttribParameterivNV (GLenum target, GLuint index, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetMapAttribParameterfvNV (GLenum target, GLuint index, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glEvalMapsNV (GLenum target, GLenum mode); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLint uorder, GLint vorder, GLboolean packed, const GLvoid *points); +typedef void (APIENTRYP PFNGLMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLGETMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLboolean packed, GLvoid *points); +typedef void (APIENTRYP PFNGLGETMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETMAPATTRIBPARAMETERIVNVPROC) (GLenum target, GLuint index, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETMAPATTRIBPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLEVALMAPSNVPROC) (GLenum target, GLenum mode); +#endif + +#ifndef GL_NV_packed_depth_stencil +#define GL_NV_packed_depth_stencil 1 +#endif + +#ifndef GL_NV_register_combiners2 +#define GL_NV_register_combiners2 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCombinerStageParameterfvNV (GLenum stage, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glGetCombinerStageParameterfvNV (GLenum stage, GLenum pname, GLfloat *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLGETCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage, GLenum pname, GLfloat *params); +#endif + +#ifndef GL_NV_texture_compression_vtc +#define GL_NV_texture_compression_vtc 1 +#endif + +#ifndef GL_NV_texture_rectangle +#define GL_NV_texture_rectangle 1 +#endif + +#ifndef GL_NV_texture_shader +#define GL_NV_texture_shader 1 +#endif + +#ifndef GL_NV_texture_shader2 +#define GL_NV_texture_shader2 1 +#endif + +#ifndef GL_NV_vertex_array_range2 +#define GL_NV_vertex_array_range2 1 +#endif + +#ifndef GL_NV_vertex_program +#define GL_NV_vertex_program 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLboolean APIENTRY glAreProgramsResidentNV (GLsizei n, const GLuint *programs, GLboolean *residences); +GLAPI void APIENTRY glBindProgramNV (GLenum target, GLuint id); +GLAPI void APIENTRY glDeleteProgramsNV (GLsizei n, const GLuint *programs); +GLAPI void APIENTRY glExecuteProgramNV (GLenum target, GLuint id, const GLfloat *params); +GLAPI void APIENTRY glGenProgramsNV (GLsizei n, GLuint *programs); +GLAPI void APIENTRY glGetProgramParameterdvNV (GLenum target, GLuint index, GLenum pname, GLdouble *params); +GLAPI void APIENTRY glGetProgramParameterfvNV (GLenum target, GLuint index, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetProgramivNV (GLuint id, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetProgramStringNV (GLuint id, GLenum pname, GLubyte *program); +GLAPI void APIENTRY glGetTrackMatrixivNV (GLenum target, GLuint address, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetVertexAttribdvNV (GLuint index, GLenum pname, GLdouble *params); +GLAPI void APIENTRY glGetVertexAttribfvNV (GLuint index, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetVertexAttribivNV (GLuint index, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetVertexAttribPointervNV (GLuint index, GLenum pname, GLvoid* *pointer); +GLAPI GLboolean APIENTRY glIsProgramNV (GLuint id); +GLAPI void APIENTRY glLoadProgramNV (GLenum target, GLuint id, GLsizei len, const GLubyte *program); +GLAPI void APIENTRY glProgramParameter4dNV (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glProgramParameter4dvNV (GLenum target, GLuint index, const GLdouble *v); +GLAPI void APIENTRY glProgramParameter4fNV (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glProgramParameter4fvNV (GLenum target, GLuint index, const GLfloat *v); +GLAPI void APIENTRY glProgramParameters4dvNV (GLenum target, GLuint index, GLuint count, const GLdouble *v); +GLAPI void APIENTRY glProgramParameters4fvNV (GLenum target, GLuint index, GLuint count, const GLfloat *v); +GLAPI void APIENTRY glRequestResidentProgramsNV (GLsizei n, const GLuint *programs); +GLAPI void APIENTRY glTrackMatrixNV (GLenum target, GLuint address, GLenum matrix, GLenum transform); +GLAPI void APIENTRY glVertexAttribPointerNV (GLuint index, GLint fsize, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glVertexAttrib1dNV (GLuint index, GLdouble x); +GLAPI void APIENTRY glVertexAttrib1dvNV (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib1fNV (GLuint index, GLfloat x); +GLAPI void APIENTRY glVertexAttrib1fvNV (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib1sNV (GLuint index, GLshort x); +GLAPI void APIENTRY glVertexAttrib1svNV (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib2dNV (GLuint index, GLdouble x, GLdouble y); +GLAPI void APIENTRY glVertexAttrib2dvNV (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib2fNV (GLuint index, GLfloat x, GLfloat y); +GLAPI void APIENTRY glVertexAttrib2fvNV (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib2sNV (GLuint index, GLshort x, GLshort y); +GLAPI void APIENTRY glVertexAttrib2svNV (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib3dNV (GLuint index, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glVertexAttrib3dvNV (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib3fNV (GLuint index, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glVertexAttrib3fvNV (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib3sNV (GLuint index, GLshort x, GLshort y, GLshort z); +GLAPI void APIENTRY glVertexAttrib3svNV (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib4dNV (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glVertexAttrib4dvNV (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttrib4fNV (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glVertexAttrib4fvNV (GLuint index, const GLfloat *v); +GLAPI void APIENTRY glVertexAttrib4sNV (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); +GLAPI void APIENTRY glVertexAttrib4svNV (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttrib4ubNV (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); +GLAPI void APIENTRY glVertexAttrib4ubvNV (GLuint index, const GLubyte *v); +GLAPI void APIENTRY glVertexAttribs1dvNV (GLuint index, GLsizei count, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribs1fvNV (GLuint index, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glVertexAttribs1svNV (GLuint index, GLsizei count, const GLshort *v); +GLAPI void APIENTRY glVertexAttribs2dvNV (GLuint index, GLsizei count, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribs2fvNV (GLuint index, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glVertexAttribs2svNV (GLuint index, GLsizei count, const GLshort *v); +GLAPI void APIENTRY glVertexAttribs3dvNV (GLuint index, GLsizei count, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribs3fvNV (GLuint index, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glVertexAttribs3svNV (GLuint index, GLsizei count, const GLshort *v); +GLAPI void APIENTRY glVertexAttribs4dvNV (GLuint index, GLsizei count, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribs4fvNV (GLuint index, GLsizei count, const GLfloat *v); +GLAPI void APIENTRY glVertexAttribs4svNV (GLuint index, GLsizei count, const GLshort *v); +GLAPI void APIENTRY glVertexAttribs4ubvNV (GLuint index, GLsizei count, const GLubyte *v); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef GLboolean (APIENTRYP PFNGLAREPROGRAMSRESIDENTNVPROC) (GLsizei n, const GLuint *programs, GLboolean *residences); +typedef void (APIENTRYP PFNGLBINDPROGRAMNVPROC) (GLenum target, GLuint id); +typedef void (APIENTRYP PFNGLDELETEPROGRAMSNVPROC) (GLsizei n, const GLuint *programs); +typedef void (APIENTRYP PFNGLEXECUTEPROGRAMNVPROC) (GLenum target, GLuint id, const GLfloat *params); +typedef void (APIENTRYP PFNGLGENPROGRAMSNVPROC) (GLsizei n, GLuint *programs); +typedef void (APIENTRYP PFNGLGETPROGRAMPARAMETERDVNVPROC) (GLenum target, GLuint index, GLenum pname, GLdouble *params); +typedef void (APIENTRYP PFNGLGETPROGRAMPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETPROGRAMIVNVPROC) (GLuint id, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETPROGRAMSTRINGNVPROC) (GLuint id, GLenum pname, GLubyte *program); +typedef void (APIENTRYP PFNGLGETTRACKMATRIXIVNVPROC) (GLenum target, GLuint address, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVNVPROC) (GLuint index, GLenum pname, GLdouble *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVNVPROC) (GLuint index, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVNVPROC) (GLuint index, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVNVPROC) (GLuint index, GLenum pname, GLvoid* *pointer); +typedef GLboolean (APIENTRYP PFNGLISPROGRAMNVPROC) (GLuint id); +typedef void (APIENTRYP PFNGLLOADPROGRAMNVPROC) (GLenum target, GLuint id, GLsizei len, const GLubyte *program); +typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4DNVPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4DVNVPROC) (GLenum target, GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4FNVPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4FVNVPROC) (GLenum target, GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4DVNVPROC) (GLenum target, GLuint index, GLuint count, const GLdouble *v); +typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4FVNVPROC) (GLenum target, GLuint index, GLuint count, const GLfloat *v); +typedef void (APIENTRYP PFNGLREQUESTRESIDENTPROGRAMSNVPROC) (GLsizei n, const GLuint *programs); +typedef void (APIENTRYP PFNGLTRACKMATRIXNVPROC) (GLenum target, GLuint address, GLenum matrix, GLenum transform); +typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERNVPROC) (GLuint index, GLint fsize, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1DNVPROC) (GLuint index, GLdouble x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVNVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1FNVPROC) (GLuint index, GLfloat x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVNVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1SNVPROC) (GLuint index, GLshort x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVNVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2DNVPROC) (GLuint index, GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVNVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2FNVPROC) (GLuint index, GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVNVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2SNVPROC) (GLuint index, GLshort x, GLshort y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVNVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3DNVPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVNVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3FNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVNVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3SNVPROC) (GLuint index, GLshort x, GLshort y, GLshort z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVNVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4DNVPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVNVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4FNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVNVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4SNVPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVNVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBNVPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVNVPROC) (GLuint index, const GLubyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS1DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS1FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS1SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS2DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS2FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS2SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS3DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS3FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS3SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS4DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS4FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS4SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS4UBVNVPROC) (GLuint index, GLsizei count, const GLubyte *v); +#endif + +#ifndef GL_SGIX_texture_coordinate_clamp +#define GL_SGIX_texture_coordinate_clamp 1 +#endif + +#ifndef GL_SGIX_scalebias_hint +#define GL_SGIX_scalebias_hint 1 +#endif + +#ifndef GL_OML_interlace +#define GL_OML_interlace 1 +#endif + +#ifndef GL_OML_subsample +#define GL_OML_subsample 1 +#endif + +#ifndef GL_OML_resample +#define GL_OML_resample 1 +#endif + +#ifndef GL_NV_copy_depth_to_color +#define GL_NV_copy_depth_to_color 1 +#endif + +#ifndef GL_ATI_envmap_bumpmap +#define GL_ATI_envmap_bumpmap 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexBumpParameterivATI (GLenum pname, const GLint *param); +GLAPI void APIENTRY glTexBumpParameterfvATI (GLenum pname, const GLfloat *param); +GLAPI void APIENTRY glGetTexBumpParameterivATI (GLenum pname, GLint *param); +GLAPI void APIENTRY glGetTexBumpParameterfvATI (GLenum pname, GLfloat *param); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTEXBUMPPARAMETERIVATIPROC) (GLenum pname, const GLint *param); +typedef void (APIENTRYP PFNGLTEXBUMPPARAMETERFVATIPROC) (GLenum pname, const GLfloat *param); +typedef void (APIENTRYP PFNGLGETTEXBUMPPARAMETERIVATIPROC) (GLenum pname, GLint *param); +typedef void (APIENTRYP PFNGLGETTEXBUMPPARAMETERFVATIPROC) (GLenum pname, GLfloat *param); +#endif + +#ifndef GL_ATI_fragment_shader +#define GL_ATI_fragment_shader 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLuint APIENTRY glGenFragmentShadersATI (GLuint range); +GLAPI void APIENTRY glBindFragmentShaderATI (GLuint id); +GLAPI void APIENTRY glDeleteFragmentShaderATI (GLuint id); +GLAPI void APIENTRY glBeginFragmentShaderATI (void); +GLAPI void APIENTRY glEndFragmentShaderATI (void); +GLAPI void APIENTRY glPassTexCoordATI (GLuint dst, GLuint coord, GLenum swizzle); +GLAPI void APIENTRY glSampleMapATI (GLuint dst, GLuint interp, GLenum swizzle); +GLAPI void APIENTRY glColorFragmentOp1ATI (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod); +GLAPI void APIENTRY glColorFragmentOp2ATI (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod); +GLAPI void APIENTRY glColorFragmentOp3ATI (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod); +GLAPI void APIENTRY glAlphaFragmentOp1ATI (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod); +GLAPI void APIENTRY glAlphaFragmentOp2ATI (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod); +GLAPI void APIENTRY glAlphaFragmentOp3ATI (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod); +GLAPI void APIENTRY glSetFragmentShaderConstantATI (GLuint dst, const GLfloat *value); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef GLuint (APIENTRYP PFNGLGENFRAGMENTSHADERSATIPROC) (GLuint range); +typedef void (APIENTRYP PFNGLBINDFRAGMENTSHADERATIPROC) (GLuint id); +typedef void (APIENTRYP PFNGLDELETEFRAGMENTSHADERATIPROC) (GLuint id); +typedef void (APIENTRYP PFNGLBEGINFRAGMENTSHADERATIPROC) (void); +typedef void (APIENTRYP PFNGLENDFRAGMENTSHADERATIPROC) (void); +typedef void (APIENTRYP PFNGLPASSTEXCOORDATIPROC) (GLuint dst, GLuint coord, GLenum swizzle); +typedef void (APIENTRYP PFNGLSAMPLEMAPATIPROC) (GLuint dst, GLuint interp, GLenum swizzle); +typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod); +typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod); +typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod); +typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod); +typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod); +typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod); +typedef void (APIENTRYP PFNGLSETFRAGMENTSHADERCONSTANTATIPROC) (GLuint dst, const GLfloat *value); +#endif + +#ifndef GL_ATI_pn_triangles +#define GL_ATI_pn_triangles 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPNTrianglesiATI (GLenum pname, GLint param); +GLAPI void APIENTRY glPNTrianglesfATI (GLenum pname, GLfloat param); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPNTRIANGLESIATIPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLPNTRIANGLESFATIPROC) (GLenum pname, GLfloat param); +#endif + +#ifndef GL_ATI_vertex_array_object +#define GL_ATI_vertex_array_object 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLuint APIENTRY glNewObjectBufferATI (GLsizei size, const GLvoid *pointer, GLenum usage); +GLAPI GLboolean APIENTRY glIsObjectBufferATI (GLuint buffer); +GLAPI void APIENTRY glUpdateObjectBufferATI (GLuint buffer, GLuint offset, GLsizei size, const GLvoid *pointer, GLenum preserve); +GLAPI void APIENTRY glGetObjectBufferfvATI (GLuint buffer, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetObjectBufferivATI (GLuint buffer, GLenum pname, GLint *params); +GLAPI void APIENTRY glFreeObjectBufferATI (GLuint buffer); +GLAPI void APIENTRY glArrayObjectATI (GLenum array, GLint size, GLenum type, GLsizei stride, GLuint buffer, GLuint offset); +GLAPI void APIENTRY glGetArrayObjectfvATI (GLenum array, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetArrayObjectivATI (GLenum array, GLenum pname, GLint *params); +GLAPI void APIENTRY glVariantArrayObjectATI (GLuint id, GLenum type, GLsizei stride, GLuint buffer, GLuint offset); +GLAPI void APIENTRY glGetVariantArrayObjectfvATI (GLuint id, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetVariantArrayObjectivATI (GLuint id, GLenum pname, GLint *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef GLuint (APIENTRYP PFNGLNEWOBJECTBUFFERATIPROC) (GLsizei size, const GLvoid *pointer, GLenum usage); +typedef GLboolean (APIENTRYP PFNGLISOBJECTBUFFERATIPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLUPDATEOBJECTBUFFERATIPROC) (GLuint buffer, GLuint offset, GLsizei size, const GLvoid *pointer, GLenum preserve); +typedef void (APIENTRYP PFNGLGETOBJECTBUFFERFVATIPROC) (GLuint buffer, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETOBJECTBUFFERIVATIPROC) (GLuint buffer, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLFREEOBJECTBUFFERATIPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLARRAYOBJECTATIPROC) (GLenum array, GLint size, GLenum type, GLsizei stride, GLuint buffer, GLuint offset); +typedef void (APIENTRYP PFNGLGETARRAYOBJECTFVATIPROC) (GLenum array, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETARRAYOBJECTIVATIPROC) (GLenum array, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLVARIANTARRAYOBJECTATIPROC) (GLuint id, GLenum type, GLsizei stride, GLuint buffer, GLuint offset); +typedef void (APIENTRYP PFNGLGETVARIANTARRAYOBJECTFVATIPROC) (GLuint id, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETVARIANTARRAYOBJECTIVATIPROC) (GLuint id, GLenum pname, GLint *params); +#endif + +#ifndef GL_EXT_vertex_shader +#define GL_EXT_vertex_shader 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBeginVertexShaderEXT (void); +GLAPI void APIENTRY glEndVertexShaderEXT (void); +GLAPI void APIENTRY glBindVertexShaderEXT (GLuint id); +GLAPI GLuint APIENTRY glGenVertexShadersEXT (GLuint range); +GLAPI void APIENTRY glDeleteVertexShaderEXT (GLuint id); +GLAPI void APIENTRY glShaderOp1EXT (GLenum op, GLuint res, GLuint arg1); +GLAPI void APIENTRY glShaderOp2EXT (GLenum op, GLuint res, GLuint arg1, GLuint arg2); +GLAPI void APIENTRY glShaderOp3EXT (GLenum op, GLuint res, GLuint arg1, GLuint arg2, GLuint arg3); +GLAPI void APIENTRY glSwizzleEXT (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW); +GLAPI void APIENTRY glWriteMaskEXT (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW); +GLAPI void APIENTRY glInsertComponentEXT (GLuint res, GLuint src, GLuint num); +GLAPI void APIENTRY glExtractComponentEXT (GLuint res, GLuint src, GLuint num); +GLAPI GLuint APIENTRY glGenSymbolsEXT (GLenum datatype, GLenum storagetype, GLenum range, GLuint components); +GLAPI void APIENTRY glSetInvariantEXT (GLuint id, GLenum type, const GLvoid *addr); +GLAPI void APIENTRY glSetLocalConstantEXT (GLuint id, GLenum type, const GLvoid *addr); +GLAPI void APIENTRY glVariantbvEXT (GLuint id, const GLbyte *addr); +GLAPI void APIENTRY glVariantsvEXT (GLuint id, const GLshort *addr); +GLAPI void APIENTRY glVariantivEXT (GLuint id, const GLint *addr); +GLAPI void APIENTRY glVariantfvEXT (GLuint id, const GLfloat *addr); +GLAPI void APIENTRY glVariantdvEXT (GLuint id, const GLdouble *addr); +GLAPI void APIENTRY glVariantubvEXT (GLuint id, const GLubyte *addr); +GLAPI void APIENTRY glVariantusvEXT (GLuint id, const GLushort *addr); +GLAPI void APIENTRY glVariantuivEXT (GLuint id, const GLuint *addr); +GLAPI void APIENTRY glVariantPointerEXT (GLuint id, GLenum type, GLuint stride, const GLvoid *addr); +GLAPI void APIENTRY glEnableVariantClientStateEXT (GLuint id); +GLAPI void APIENTRY glDisableVariantClientStateEXT (GLuint id); +GLAPI GLuint APIENTRY glBindLightParameterEXT (GLenum light, GLenum value); +GLAPI GLuint APIENTRY glBindMaterialParameterEXT (GLenum face, GLenum value); +GLAPI GLuint APIENTRY glBindTexGenParameterEXT (GLenum unit, GLenum coord, GLenum value); +GLAPI GLuint APIENTRY glBindTextureUnitParameterEXT (GLenum unit, GLenum value); +GLAPI GLuint APIENTRY glBindParameterEXT (GLenum value); +GLAPI GLboolean APIENTRY glIsVariantEnabledEXT (GLuint id, GLenum cap); +GLAPI void APIENTRY glGetVariantBooleanvEXT (GLuint id, GLenum value, GLboolean *data); +GLAPI void APIENTRY glGetVariantIntegervEXT (GLuint id, GLenum value, GLint *data); +GLAPI void APIENTRY glGetVariantFloatvEXT (GLuint id, GLenum value, GLfloat *data); +GLAPI void APIENTRY glGetVariantPointervEXT (GLuint id, GLenum value, GLvoid* *data); +GLAPI void APIENTRY glGetInvariantBooleanvEXT (GLuint id, GLenum value, GLboolean *data); +GLAPI void APIENTRY glGetInvariantIntegervEXT (GLuint id, GLenum value, GLint *data); +GLAPI void APIENTRY glGetInvariantFloatvEXT (GLuint id, GLenum value, GLfloat *data); +GLAPI void APIENTRY glGetLocalConstantBooleanvEXT (GLuint id, GLenum value, GLboolean *data); +GLAPI void APIENTRY glGetLocalConstantIntegervEXT (GLuint id, GLenum value, GLint *data); +GLAPI void APIENTRY glGetLocalConstantFloatvEXT (GLuint id, GLenum value, GLfloat *data); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBEGINVERTEXSHADEREXTPROC) (void); +typedef void (APIENTRYP PFNGLENDVERTEXSHADEREXTPROC) (void); +typedef void (APIENTRYP PFNGLBINDVERTEXSHADEREXTPROC) (GLuint id); +typedef GLuint (APIENTRYP PFNGLGENVERTEXSHADERSEXTPROC) (GLuint range); +typedef void (APIENTRYP PFNGLDELETEVERTEXSHADEREXTPROC) (GLuint id); +typedef void (APIENTRYP PFNGLSHADEROP1EXTPROC) (GLenum op, GLuint res, GLuint arg1); +typedef void (APIENTRYP PFNGLSHADEROP2EXTPROC) (GLenum op, GLuint res, GLuint arg1, GLuint arg2); +typedef void (APIENTRYP PFNGLSHADEROP3EXTPROC) (GLenum op, GLuint res, GLuint arg1, GLuint arg2, GLuint arg3); +typedef void (APIENTRYP PFNGLSWIZZLEEXTPROC) (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW); +typedef void (APIENTRYP PFNGLWRITEMASKEXTPROC) (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW); +typedef void (APIENTRYP PFNGLINSERTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num); +typedef void (APIENTRYP PFNGLEXTRACTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num); +typedef GLuint (APIENTRYP PFNGLGENSYMBOLSEXTPROC) (GLenum datatype, GLenum storagetype, GLenum range, GLuint components); +typedef void (APIENTRYP PFNGLSETINVARIANTEXTPROC) (GLuint id, GLenum type, const GLvoid *addr); +typedef void (APIENTRYP PFNGLSETLOCALCONSTANTEXTPROC) (GLuint id, GLenum type, const GLvoid *addr); +typedef void (APIENTRYP PFNGLVARIANTBVEXTPROC) (GLuint id, const GLbyte *addr); +typedef void (APIENTRYP PFNGLVARIANTSVEXTPROC) (GLuint id, const GLshort *addr); +typedef void (APIENTRYP PFNGLVARIANTIVEXTPROC) (GLuint id, const GLint *addr); +typedef void (APIENTRYP PFNGLVARIANTFVEXTPROC) (GLuint id, const GLfloat *addr); +typedef void (APIENTRYP PFNGLVARIANTDVEXTPROC) (GLuint id, const GLdouble *addr); +typedef void (APIENTRYP PFNGLVARIANTUBVEXTPROC) (GLuint id, const GLubyte *addr); +typedef void (APIENTRYP PFNGLVARIANTUSVEXTPROC) (GLuint id, const GLushort *addr); +typedef void (APIENTRYP PFNGLVARIANTUIVEXTPROC) (GLuint id, const GLuint *addr); +typedef void (APIENTRYP PFNGLVARIANTPOINTEREXTPROC) (GLuint id, GLenum type, GLuint stride, const GLvoid *addr); +typedef void (APIENTRYP PFNGLENABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id); +typedef void (APIENTRYP PFNGLDISABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id); +typedef GLuint (APIENTRYP PFNGLBINDLIGHTPARAMETEREXTPROC) (GLenum light, GLenum value); +typedef GLuint (APIENTRYP PFNGLBINDMATERIALPARAMETEREXTPROC) (GLenum face, GLenum value); +typedef GLuint (APIENTRYP PFNGLBINDTEXGENPARAMETEREXTPROC) (GLenum unit, GLenum coord, GLenum value); +typedef GLuint (APIENTRYP PFNGLBINDTEXTUREUNITPARAMETEREXTPROC) (GLenum unit, GLenum value); +typedef GLuint (APIENTRYP PFNGLBINDPARAMETEREXTPROC) (GLenum value); +typedef GLboolean (APIENTRYP PFNGLISVARIANTENABLEDEXTPROC) (GLuint id, GLenum cap); +typedef void (APIENTRYP PFNGLGETVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); +typedef void (APIENTRYP PFNGLGETVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); +typedef void (APIENTRYP PFNGLGETVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); +typedef void (APIENTRYP PFNGLGETVARIANTPOINTERVEXTPROC) (GLuint id, GLenum value, GLvoid* *data); +typedef void (APIENTRYP PFNGLGETINVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); +typedef void (APIENTRYP PFNGLGETINVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); +typedef void (APIENTRYP PFNGLGETINVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); +typedef void (APIENTRYP PFNGLGETLOCALCONSTANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); +typedef void (APIENTRYP PFNGLGETLOCALCONSTANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); +typedef void (APIENTRYP PFNGLGETLOCALCONSTANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); +#endif + +#ifndef GL_ATI_vertex_streams +#define GL_ATI_vertex_streams 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexStream1sATI (GLenum stream, GLshort x); +GLAPI void APIENTRY glVertexStream1svATI (GLenum stream, const GLshort *coords); +GLAPI void APIENTRY glVertexStream1iATI (GLenum stream, GLint x); +GLAPI void APIENTRY glVertexStream1ivATI (GLenum stream, const GLint *coords); +GLAPI void APIENTRY glVertexStream1fATI (GLenum stream, GLfloat x); +GLAPI void APIENTRY glVertexStream1fvATI (GLenum stream, const GLfloat *coords); +GLAPI void APIENTRY glVertexStream1dATI (GLenum stream, GLdouble x); +GLAPI void APIENTRY glVertexStream1dvATI (GLenum stream, const GLdouble *coords); +GLAPI void APIENTRY glVertexStream2sATI (GLenum stream, GLshort x, GLshort y); +GLAPI void APIENTRY glVertexStream2svATI (GLenum stream, const GLshort *coords); +GLAPI void APIENTRY glVertexStream2iATI (GLenum stream, GLint x, GLint y); +GLAPI void APIENTRY glVertexStream2ivATI (GLenum stream, const GLint *coords); +GLAPI void APIENTRY glVertexStream2fATI (GLenum stream, GLfloat x, GLfloat y); +GLAPI void APIENTRY glVertexStream2fvATI (GLenum stream, const GLfloat *coords); +GLAPI void APIENTRY glVertexStream2dATI (GLenum stream, GLdouble x, GLdouble y); +GLAPI void APIENTRY glVertexStream2dvATI (GLenum stream, const GLdouble *coords); +GLAPI void APIENTRY glVertexStream3sATI (GLenum stream, GLshort x, GLshort y, GLshort z); +GLAPI void APIENTRY glVertexStream3svATI (GLenum stream, const GLshort *coords); +GLAPI void APIENTRY glVertexStream3iATI (GLenum stream, GLint x, GLint y, GLint z); +GLAPI void APIENTRY glVertexStream3ivATI (GLenum stream, const GLint *coords); +GLAPI void APIENTRY glVertexStream3fATI (GLenum stream, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glVertexStream3fvATI (GLenum stream, const GLfloat *coords); +GLAPI void APIENTRY glVertexStream3dATI (GLenum stream, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glVertexStream3dvATI (GLenum stream, const GLdouble *coords); +GLAPI void APIENTRY glVertexStream4sATI (GLenum stream, GLshort x, GLshort y, GLshort z, GLshort w); +GLAPI void APIENTRY glVertexStream4svATI (GLenum stream, const GLshort *coords); +GLAPI void APIENTRY glVertexStream4iATI (GLenum stream, GLint x, GLint y, GLint z, GLint w); +GLAPI void APIENTRY glVertexStream4ivATI (GLenum stream, const GLint *coords); +GLAPI void APIENTRY glVertexStream4fATI (GLenum stream, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glVertexStream4fvATI (GLenum stream, const GLfloat *coords); +GLAPI void APIENTRY glVertexStream4dATI (GLenum stream, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glVertexStream4dvATI (GLenum stream, const GLdouble *coords); +GLAPI void APIENTRY glNormalStream3bATI (GLenum stream, GLbyte nx, GLbyte ny, GLbyte nz); +GLAPI void APIENTRY glNormalStream3bvATI (GLenum stream, const GLbyte *coords); +GLAPI void APIENTRY glNormalStream3sATI (GLenum stream, GLshort nx, GLshort ny, GLshort nz); +GLAPI void APIENTRY glNormalStream3svATI (GLenum stream, const GLshort *coords); +GLAPI void APIENTRY glNormalStream3iATI (GLenum stream, GLint nx, GLint ny, GLint nz); +GLAPI void APIENTRY glNormalStream3ivATI (GLenum stream, const GLint *coords); +GLAPI void APIENTRY glNormalStream3fATI (GLenum stream, GLfloat nx, GLfloat ny, GLfloat nz); +GLAPI void APIENTRY glNormalStream3fvATI (GLenum stream, const GLfloat *coords); +GLAPI void APIENTRY glNormalStream3dATI (GLenum stream, GLdouble nx, GLdouble ny, GLdouble nz); +GLAPI void APIENTRY glNormalStream3dvATI (GLenum stream, const GLdouble *coords); +GLAPI void APIENTRY glClientActiveVertexStreamATI (GLenum stream); +GLAPI void APIENTRY glVertexBlendEnviATI (GLenum pname, GLint param); +GLAPI void APIENTRY glVertexBlendEnvfATI (GLenum pname, GLfloat param); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLVERTEXSTREAM1SATIPROC) (GLenum stream, GLshort x); +typedef void (APIENTRYP PFNGLVERTEXSTREAM1SVATIPROC) (GLenum stream, const GLshort *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM1IATIPROC) (GLenum stream, GLint x); +typedef void (APIENTRYP PFNGLVERTEXSTREAM1IVATIPROC) (GLenum stream, const GLint *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM1FATIPROC) (GLenum stream, GLfloat x); +typedef void (APIENTRYP PFNGLVERTEXSTREAM1FVATIPROC) (GLenum stream, const GLfloat *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM1DATIPROC) (GLenum stream, GLdouble x); +typedef void (APIENTRYP PFNGLVERTEXSTREAM1DVATIPROC) (GLenum stream, const GLdouble *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM2SATIPROC) (GLenum stream, GLshort x, GLshort y); +typedef void (APIENTRYP PFNGLVERTEXSTREAM2SVATIPROC) (GLenum stream, const GLshort *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM2IATIPROC) (GLenum stream, GLint x, GLint y); +typedef void (APIENTRYP PFNGLVERTEXSTREAM2IVATIPROC) (GLenum stream, const GLint *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM2FATIPROC) (GLenum stream, GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLVERTEXSTREAM2FVATIPROC) (GLenum stream, const GLfloat *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM2DATIPROC) (GLenum stream, GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLVERTEXSTREAM2DVATIPROC) (GLenum stream, const GLdouble *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM3SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z); +typedef void (APIENTRYP PFNGLVERTEXSTREAM3SVATIPROC) (GLenum stream, const GLshort *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM3IATIPROC) (GLenum stream, GLint x, GLint y, GLint z); +typedef void (APIENTRYP PFNGLVERTEXSTREAM3IVATIPROC) (GLenum stream, const GLint *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM3FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLVERTEXSTREAM3FVATIPROC) (GLenum stream, const GLfloat *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM3DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLVERTEXSTREAM3DVATIPROC) (GLenum stream, const GLdouble *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM4SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z, GLshort w); +typedef void (APIENTRYP PFNGLVERTEXSTREAM4SVATIPROC) (GLenum stream, const GLshort *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM4IATIPROC) (GLenum stream, GLint x, GLint y, GLint z, GLint w); +typedef void (APIENTRYP PFNGLVERTEXSTREAM4IVATIPROC) (GLenum stream, const GLint *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM4FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLVERTEXSTREAM4FVATIPROC) (GLenum stream, const GLfloat *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM4DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLVERTEXSTREAM4DVATIPROC) (GLenum stream, const GLdouble *coords); +typedef void (APIENTRYP PFNGLNORMALSTREAM3BATIPROC) (GLenum stream, GLbyte nx, GLbyte ny, GLbyte nz); +typedef void (APIENTRYP PFNGLNORMALSTREAM3BVATIPROC) (GLenum stream, const GLbyte *coords); +typedef void (APIENTRYP PFNGLNORMALSTREAM3SATIPROC) (GLenum stream, GLshort nx, GLshort ny, GLshort nz); +typedef void (APIENTRYP PFNGLNORMALSTREAM3SVATIPROC) (GLenum stream, const GLshort *coords); +typedef void (APIENTRYP PFNGLNORMALSTREAM3IATIPROC) (GLenum stream, GLint nx, GLint ny, GLint nz); +typedef void (APIENTRYP PFNGLNORMALSTREAM3IVATIPROC) (GLenum stream, const GLint *coords); +typedef void (APIENTRYP PFNGLNORMALSTREAM3FATIPROC) (GLenum stream, GLfloat nx, GLfloat ny, GLfloat nz); +typedef void (APIENTRYP PFNGLNORMALSTREAM3FVATIPROC) (GLenum stream, const GLfloat *coords); +typedef void (APIENTRYP PFNGLNORMALSTREAM3DATIPROC) (GLenum stream, GLdouble nx, GLdouble ny, GLdouble nz); +typedef void (APIENTRYP PFNGLNORMALSTREAM3DVATIPROC) (GLenum stream, const GLdouble *coords); +typedef void (APIENTRYP PFNGLCLIENTACTIVEVERTEXSTREAMATIPROC) (GLenum stream); +typedef void (APIENTRYP PFNGLVERTEXBLENDENVIATIPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLVERTEXBLENDENVFATIPROC) (GLenum pname, GLfloat param); +#endif + +#ifndef GL_ATI_element_array +#define GL_ATI_element_array 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glElementPointerATI (GLenum type, const GLvoid *pointer); +GLAPI void APIENTRY glDrawElementArrayATI (GLenum mode, GLsizei count); +GLAPI void APIENTRY glDrawRangeElementArrayATI (GLenum mode, GLuint start, GLuint end, GLsizei count); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLELEMENTPOINTERATIPROC) (GLenum type, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLDRAWELEMENTARRAYATIPROC) (GLenum mode, GLsizei count); +typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTARRAYATIPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count); +#endif + +#ifndef GL_SUN_mesh_array +#define GL_SUN_mesh_array 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawMeshArraysSUN (GLenum mode, GLint first, GLsizei count, GLsizei width); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDRAWMESHARRAYSSUNPROC) (GLenum mode, GLint first, GLsizei count, GLsizei width); +#endif + +#ifndef GL_SUN_slice_accum +#define GL_SUN_slice_accum 1 +#endif + +#ifndef GL_NV_multisample_filter_hint +#define GL_NV_multisample_filter_hint 1 +#endif + +#ifndef GL_NV_depth_clamp +#define GL_NV_depth_clamp 1 +#endif + +#ifndef GL_NV_occlusion_query +#define GL_NV_occlusion_query 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGenOcclusionQueriesNV (GLsizei n, GLuint *ids); +GLAPI void APIENTRY glDeleteOcclusionQueriesNV (GLsizei n, const GLuint *ids); +GLAPI GLboolean APIENTRY glIsOcclusionQueryNV (GLuint id); +GLAPI void APIENTRY glBeginOcclusionQueryNV (GLuint id); +GLAPI void APIENTRY glEndOcclusionQueryNV (void); +GLAPI void APIENTRY glGetOcclusionQueryivNV (GLuint id, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetOcclusionQueryuivNV (GLuint id, GLenum pname, GLuint *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGENOCCLUSIONQUERIESNVPROC) (GLsizei n, GLuint *ids); +typedef void (APIENTRYP PFNGLDELETEOCCLUSIONQUERIESNVPROC) (GLsizei n, const GLuint *ids); +typedef GLboolean (APIENTRYP PFNGLISOCCLUSIONQUERYNVPROC) (GLuint id); +typedef void (APIENTRYP PFNGLBEGINOCCLUSIONQUERYNVPROC) (GLuint id); +typedef void (APIENTRYP PFNGLENDOCCLUSIONQUERYNVPROC) (void); +typedef void (APIENTRYP PFNGLGETOCCLUSIONQUERYIVNVPROC) (GLuint id, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETOCCLUSIONQUERYUIVNVPROC) (GLuint id, GLenum pname, GLuint *params); +#endif + +#ifndef GL_NV_point_sprite +#define GL_NV_point_sprite 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPointParameteriNV (GLenum pname, GLint param); +GLAPI void APIENTRY glPointParameterivNV (GLenum pname, const GLint *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPOINTPARAMETERINVPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLPOINTPARAMETERIVNVPROC) (GLenum pname, const GLint *params); +#endif + +#ifndef GL_NV_texture_shader3 +#define GL_NV_texture_shader3 1 +#endif + +#ifndef GL_NV_vertex_program1_1 +#define GL_NV_vertex_program1_1 1 +#endif + +#ifndef GL_EXT_shadow_funcs +#define GL_EXT_shadow_funcs 1 +#endif + +#ifndef GL_EXT_stencil_two_side +#define GL_EXT_stencil_two_side 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glActiveStencilFaceEXT (GLenum face); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLACTIVESTENCILFACEEXTPROC) (GLenum face); +#endif + +#ifndef GL_ATI_text_fragment_shader +#define GL_ATI_text_fragment_shader 1 +#endif + +#ifndef GL_APPLE_client_storage +#define GL_APPLE_client_storage 1 +#endif + +#ifndef GL_APPLE_element_array +#define GL_APPLE_element_array 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glElementPointerAPPLE (GLenum type, const GLvoid *pointer); +GLAPI void APIENTRY glDrawElementArrayAPPLE (GLenum mode, GLint first, GLsizei count); +GLAPI void APIENTRY glDrawRangeElementArrayAPPLE (GLenum mode, GLuint start, GLuint end, GLint first, GLsizei count); +GLAPI void APIENTRY glMultiDrawElementArrayAPPLE (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); +GLAPI void APIENTRY glMultiDrawRangeElementArrayAPPLE (GLenum mode, GLuint start, GLuint end, const GLint *first, const GLsizei *count, GLsizei primcount); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLELEMENTPOINTERAPPLEPROC) (GLenum type, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, GLint first, GLsizei count); +typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, GLint first, GLsizei count); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); +typedef void (APIENTRYP PFNGLMULTIDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, const GLint *first, const GLsizei *count, GLsizei primcount); +#endif + +#ifndef GL_APPLE_fence +#define GL_APPLE_fence 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGenFencesAPPLE (GLsizei n, GLuint *fences); +GLAPI void APIENTRY glDeleteFencesAPPLE (GLsizei n, const GLuint *fences); +GLAPI void APIENTRY glSetFenceAPPLE (GLuint fence); +GLAPI GLboolean APIENTRY glIsFenceAPPLE (GLuint fence); +GLAPI GLboolean APIENTRY glTestFenceAPPLE (GLuint fence); +GLAPI void APIENTRY glFinishFenceAPPLE (GLuint fence); +GLAPI GLboolean APIENTRY glTestObjectAPPLE (GLenum object, GLuint name); +GLAPI void APIENTRY glFinishObjectAPPLE (GLenum object, GLint name); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGENFENCESAPPLEPROC) (GLsizei n, GLuint *fences); +typedef void (APIENTRYP PFNGLDELETEFENCESAPPLEPROC) (GLsizei n, const GLuint *fences); +typedef void (APIENTRYP PFNGLSETFENCEAPPLEPROC) (GLuint fence); +typedef GLboolean (APIENTRYP PFNGLISFENCEAPPLEPROC) (GLuint fence); +typedef GLboolean (APIENTRYP PFNGLTESTFENCEAPPLEPROC) (GLuint fence); +typedef void (APIENTRYP PFNGLFINISHFENCEAPPLEPROC) (GLuint fence); +typedef GLboolean (APIENTRYP PFNGLTESTOBJECTAPPLEPROC) (GLenum object, GLuint name); +typedef void (APIENTRYP PFNGLFINISHOBJECTAPPLEPROC) (GLenum object, GLint name); +#endif + +#ifndef GL_APPLE_vertex_array_object +#define GL_APPLE_vertex_array_object 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBindVertexArrayAPPLE (GLuint array); +GLAPI void APIENTRY glDeleteVertexArraysAPPLE (GLsizei n, const GLuint *arrays); +GLAPI void APIENTRY glGenVertexArraysAPPLE (GLsizei n, GLuint *arrays); +GLAPI GLboolean APIENTRY glIsVertexArrayAPPLE (GLuint array); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBINDVERTEXARRAYAPPLEPROC) (GLuint array); +typedef void (APIENTRYP PFNGLDELETEVERTEXARRAYSAPPLEPROC) (GLsizei n, const GLuint *arrays); +typedef void (APIENTRYP PFNGLGENVERTEXARRAYSAPPLEPROC) (GLsizei n, GLuint *arrays); +typedef GLboolean (APIENTRYP PFNGLISVERTEXARRAYAPPLEPROC) (GLuint array); +#endif + +#ifndef GL_APPLE_vertex_array_range +#define GL_APPLE_vertex_array_range 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexArrayRangeAPPLE (GLsizei length, GLvoid *pointer); +GLAPI void APIENTRY glFlushVertexArrayRangeAPPLE (GLsizei length, GLvoid *pointer); +GLAPI void APIENTRY glVertexArrayParameteriAPPLE (GLenum pname, GLint param); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, GLvoid *pointer); +typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXARRAYPARAMETERIAPPLEPROC) (GLenum pname, GLint param); +#endif + +#ifndef GL_APPLE_ycbcr_422 +#define GL_APPLE_ycbcr_422 1 +#endif + +#ifndef GL_S3_s3tc +#define GL_S3_s3tc 1 +#endif + +#ifndef GL_ATI_draw_buffers +#define GL_ATI_draw_buffers 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawBuffersATI (GLsizei n, const GLenum *bufs); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDRAWBUFFERSATIPROC) (GLsizei n, const GLenum *bufs); +#endif + +#ifndef GL_ATI_pixel_format_float +#define GL_ATI_pixel_format_float 1 +/* This is really a WGL extension, but defines some associated GL enums. + * ATI does not export "GL_ATI_pixel_format_float" in the GL_EXTENSIONS string. + */ +#endif + +#ifndef GL_ATI_texture_env_combine3 +#define GL_ATI_texture_env_combine3 1 +#endif + +#ifndef GL_ATI_texture_float +#define GL_ATI_texture_float 1 +#endif + +#ifndef GL_NV_float_buffer +#define GL_NV_float_buffer 1 +#endif + +#ifndef GL_NV_fragment_program +#define GL_NV_fragment_program 1 +/* Some NV_fragment_program entry points are shared with ARB_vertex_program. */ +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glProgramNamedParameter4fNV (GLuint id, GLsizei len, const GLubyte *name, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glProgramNamedParameter4dNV (GLuint id, GLsizei len, const GLubyte *name, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glProgramNamedParameter4fvNV (GLuint id, GLsizei len, const GLubyte *name, const GLfloat *v); +GLAPI void APIENTRY glProgramNamedParameter4dvNV (GLuint id, GLsizei len, const GLubyte *name, const GLdouble *v); +GLAPI void APIENTRY glGetProgramNamedParameterfvNV (GLuint id, GLsizei len, const GLubyte *name, GLfloat *params); +GLAPI void APIENTRY glGetProgramNamedParameterdvNV (GLuint id, GLsizei len, const GLubyte *name, GLdouble *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4FNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4DNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4FVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, const GLfloat *v); +typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4DVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, const GLdouble *v); +typedef void (APIENTRYP PFNGLGETPROGRAMNAMEDPARAMETERFVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLfloat *params); +typedef void (APIENTRYP PFNGLGETPROGRAMNAMEDPARAMETERDVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLdouble *params); +#endif + +#ifndef GL_NV_half_float +#define GL_NV_half_float 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertex2hNV (GLhalfNV x, GLhalfNV y); +GLAPI void APIENTRY glVertex2hvNV (const GLhalfNV *v); +GLAPI void APIENTRY glVertex3hNV (GLhalfNV x, GLhalfNV y, GLhalfNV z); +GLAPI void APIENTRY glVertex3hvNV (const GLhalfNV *v); +GLAPI void APIENTRY glVertex4hNV (GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w); +GLAPI void APIENTRY glVertex4hvNV (const GLhalfNV *v); +GLAPI void APIENTRY glNormal3hNV (GLhalfNV nx, GLhalfNV ny, GLhalfNV nz); +GLAPI void APIENTRY glNormal3hvNV (const GLhalfNV *v); +GLAPI void APIENTRY glColor3hNV (GLhalfNV red, GLhalfNV green, GLhalfNV blue); +GLAPI void APIENTRY glColor3hvNV (const GLhalfNV *v); +GLAPI void APIENTRY glColor4hNV (GLhalfNV red, GLhalfNV green, GLhalfNV blue, GLhalfNV alpha); +GLAPI void APIENTRY glColor4hvNV (const GLhalfNV *v); +GLAPI void APIENTRY glTexCoord1hNV (GLhalfNV s); +GLAPI void APIENTRY glTexCoord1hvNV (const GLhalfNV *v); +GLAPI void APIENTRY glTexCoord2hNV (GLhalfNV s, GLhalfNV t); +GLAPI void APIENTRY glTexCoord2hvNV (const GLhalfNV *v); +GLAPI void APIENTRY glTexCoord3hNV (GLhalfNV s, GLhalfNV t, GLhalfNV r); +GLAPI void APIENTRY glTexCoord3hvNV (const GLhalfNV *v); +GLAPI void APIENTRY glTexCoord4hNV (GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q); +GLAPI void APIENTRY glTexCoord4hvNV (const GLhalfNV *v); +GLAPI void APIENTRY glMultiTexCoord1hNV (GLenum target, GLhalfNV s); +GLAPI void APIENTRY glMultiTexCoord1hvNV (GLenum target, const GLhalfNV *v); +GLAPI void APIENTRY glMultiTexCoord2hNV (GLenum target, GLhalfNV s, GLhalfNV t); +GLAPI void APIENTRY glMultiTexCoord2hvNV (GLenum target, const GLhalfNV *v); +GLAPI void APIENTRY glMultiTexCoord3hNV (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r); +GLAPI void APIENTRY glMultiTexCoord3hvNV (GLenum target, const GLhalfNV *v); +GLAPI void APIENTRY glMultiTexCoord4hNV (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q); +GLAPI void APIENTRY glMultiTexCoord4hvNV (GLenum target, const GLhalfNV *v); +GLAPI void APIENTRY glFogCoordhNV (GLhalfNV fog); +GLAPI void APIENTRY glFogCoordhvNV (const GLhalfNV *fog); +GLAPI void APIENTRY glSecondaryColor3hNV (GLhalfNV red, GLhalfNV green, GLhalfNV blue); +GLAPI void APIENTRY glSecondaryColor3hvNV (const GLhalfNV *v); +GLAPI void APIENTRY glVertexWeighthNV (GLhalfNV weight); +GLAPI void APIENTRY glVertexWeighthvNV (const GLhalfNV *weight); +GLAPI void APIENTRY glVertexAttrib1hNV (GLuint index, GLhalfNV x); +GLAPI void APIENTRY glVertexAttrib1hvNV (GLuint index, const GLhalfNV *v); +GLAPI void APIENTRY glVertexAttrib2hNV (GLuint index, GLhalfNV x, GLhalfNV y); +GLAPI void APIENTRY glVertexAttrib2hvNV (GLuint index, const GLhalfNV *v); +GLAPI void APIENTRY glVertexAttrib3hNV (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z); +GLAPI void APIENTRY glVertexAttrib3hvNV (GLuint index, const GLhalfNV *v); +GLAPI void APIENTRY glVertexAttrib4hNV (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w); +GLAPI void APIENTRY glVertexAttrib4hvNV (GLuint index, const GLhalfNV *v); +GLAPI void APIENTRY glVertexAttribs1hvNV (GLuint index, GLsizei n, const GLhalfNV *v); +GLAPI void APIENTRY glVertexAttribs2hvNV (GLuint index, GLsizei n, const GLhalfNV *v); +GLAPI void APIENTRY glVertexAttribs3hvNV (GLuint index, GLsizei n, const GLhalfNV *v); +GLAPI void APIENTRY glVertexAttribs4hvNV (GLuint index, GLsizei n, const GLhalfNV *v); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLVERTEX2HNVPROC) (GLhalfNV x, GLhalfNV y); +typedef void (APIENTRYP PFNGLVERTEX2HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEX3HNVPROC) (GLhalfNV x, GLhalfNV y, GLhalfNV z); +typedef void (APIENTRYP PFNGLVERTEX3HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEX4HNVPROC) (GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w); +typedef void (APIENTRYP PFNGLVERTEX4HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLNORMAL3HNVPROC) (GLhalfNV nx, GLhalfNV ny, GLhalfNV nz); +typedef void (APIENTRYP PFNGLNORMAL3HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLCOLOR3HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue); +typedef void (APIENTRYP PFNGLCOLOR3HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLCOLOR4HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue, GLhalfNV alpha); +typedef void (APIENTRYP PFNGLCOLOR4HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLTEXCOORD1HNVPROC) (GLhalfNV s); +typedef void (APIENTRYP PFNGLTEXCOORD1HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLTEXCOORD2HNVPROC) (GLhalfNV s, GLhalfNV t); +typedef void (APIENTRYP PFNGLTEXCOORD2HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLTEXCOORD3HNVPROC) (GLhalfNV s, GLhalfNV t, GLhalfNV r); +typedef void (APIENTRYP PFNGLTEXCOORD3HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLTEXCOORD4HNVPROC) (GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q); +typedef void (APIENTRYP PFNGLTEXCOORD4HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1HNVPROC) (GLenum target, GLhalfNV s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1HVNVPROC) (GLenum target, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2HVNVPROC) (GLenum target, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3HVNVPROC) (GLenum target, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4HVNVPROC) (GLenum target, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLFOGCOORDHNVPROC) (GLhalfNV fog); +typedef void (APIENTRYP PFNGLFOGCOORDHVNVPROC) (const GLhalfNV *fog); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEXWEIGHTHNVPROC) (GLhalfNV weight); +typedef void (APIENTRYP PFNGLVERTEXWEIGHTHVNVPROC) (const GLhalfNV *weight); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1HNVPROC) (GLuint index, GLhalfNV x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1HVNVPROC) (GLuint index, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2HVNVPROC) (GLuint index, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3HVNVPROC) (GLuint index, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4HVNVPROC) (GLuint index, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS1HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS2HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS3HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS4HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); +#endif + +#ifndef GL_NV_pixel_data_range +#define GL_NV_pixel_data_range 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPixelDataRangeNV (GLenum target, GLsizei length, GLvoid *pointer); +GLAPI void APIENTRY glFlushPixelDataRangeNV (GLenum target); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPIXELDATARANGENVPROC) (GLenum target, GLsizei length, GLvoid *pointer); +typedef void (APIENTRYP PFNGLFLUSHPIXELDATARANGENVPROC) (GLenum target); +#endif + +#ifndef GL_NV_primitive_restart +#define GL_NV_primitive_restart 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPrimitiveRestartNV (void); +GLAPI void APIENTRY glPrimitiveRestartIndexNV (GLuint index); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPRIMITIVERESTARTNVPROC) (void); +typedef void (APIENTRYP PFNGLPRIMITIVERESTARTINDEXNVPROC) (GLuint index); +#endif + +#ifndef GL_NV_texture_expand_normal +#define GL_NV_texture_expand_normal 1 +#endif + +#ifndef GL_NV_vertex_program2 +#define GL_NV_vertex_program2 1 +#endif + +#ifndef GL_ATI_map_object_buffer +#define GL_ATI_map_object_buffer 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLvoid* APIENTRY glMapObjectBufferATI (GLuint buffer); +GLAPI void APIENTRY glUnmapObjectBufferATI (GLuint buffer); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef GLvoid* (APIENTRYP PFNGLMAPOBJECTBUFFERATIPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLUNMAPOBJECTBUFFERATIPROC) (GLuint buffer); +#endif + +#ifndef GL_ATI_separate_stencil +#define GL_ATI_separate_stencil 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glStencilOpSeparateATI (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass); +GLAPI void APIENTRY glStencilFuncSeparateATI (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLSTENCILOPSEPARATEATIPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass); +typedef void (APIENTRYP PFNGLSTENCILFUNCSEPARATEATIPROC) (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask); +#endif + +#ifndef GL_ATI_vertex_attrib_array_object +#define GL_ATI_vertex_attrib_array_object 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexAttribArrayObjectATI (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, GLuint buffer, GLuint offset); +GLAPI void APIENTRY glGetVertexAttribArrayObjectfvATI (GLuint index, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetVertexAttribArrayObjectivATI (GLuint index, GLenum pname, GLint *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLVERTEXATTRIBARRAYOBJECTATIPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, GLuint buffer, GLuint offset); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBARRAYOBJECTFVATIPROC) (GLuint index, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBARRAYOBJECTIVATIPROC) (GLuint index, GLenum pname, GLint *params); +#endif + +#ifndef GL_OES_read_format +#define GL_OES_read_format 1 +#endif + +#ifndef GL_EXT_depth_bounds_test +#define GL_EXT_depth_bounds_test 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDepthBoundsEXT (GLclampd zmin, GLclampd zmax); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDEPTHBOUNDSEXTPROC) (GLclampd zmin, GLclampd zmax); +#endif + +#ifndef GL_EXT_texture_mirror_clamp +#define GL_EXT_texture_mirror_clamp 1 +#endif + +#ifndef GL_EXT_blend_equation_separate +#define GL_EXT_blend_equation_separate 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendEquationSeparateEXT (GLenum modeRGB, GLenum modeAlpha); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEEXTPROC) (GLenum modeRGB, GLenum modeAlpha); +#endif + +#ifndef GL_MESA_pack_invert +#define GL_MESA_pack_invert 1 +#endif + +#ifndef GL_MESA_ycbcr_texture +#define GL_MESA_ycbcr_texture 1 +#endif + +#ifndef GL_EXT_pixel_buffer_object +#define GL_EXT_pixel_buffer_object 1 +#endif + +#ifndef GL_NV_fragment_program_option +#define GL_NV_fragment_program_option 1 +#endif + +#ifndef GL_NV_fragment_program2 +#define GL_NV_fragment_program2 1 +#endif + +#ifndef GL_NV_vertex_program2_option +#define GL_NV_vertex_program2_option 1 +#endif + +#ifndef GL_NV_vertex_program3 +#define GL_NV_vertex_program3 1 +#endif + +#ifndef GL_EXT_framebuffer_object +#define GL_EXT_framebuffer_object 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLboolean APIENTRY glIsRenderbufferEXT (GLuint renderbuffer); +GLAPI void APIENTRY glBindRenderbufferEXT (GLenum target, GLuint renderbuffer); +GLAPI void APIENTRY glDeleteRenderbuffersEXT (GLsizei n, const GLuint *renderbuffers); +GLAPI void APIENTRY glGenRenderbuffersEXT (GLsizei n, GLuint *renderbuffers); +GLAPI void APIENTRY glRenderbufferStorageEXT (GLenum target, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glGetRenderbufferParameterivEXT (GLenum target, GLenum pname, GLint *params); +GLAPI GLboolean APIENTRY glIsFramebufferEXT (GLuint framebuffer); +GLAPI void APIENTRY glBindFramebufferEXT (GLenum target, GLuint framebuffer); +GLAPI void APIENTRY glDeleteFramebuffersEXT (GLsizei n, const GLuint *framebuffers); +GLAPI void APIENTRY glGenFramebuffersEXT (GLsizei n, GLuint *framebuffers); +GLAPI GLenum APIENTRY glCheckFramebufferStatusEXT (GLenum target); +GLAPI void APIENTRY glFramebufferTexture1DEXT (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +GLAPI void APIENTRY glFramebufferTexture2DEXT (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +GLAPI void APIENTRY glFramebufferTexture3DEXT (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset); +GLAPI void APIENTRY glFramebufferRenderbufferEXT (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +GLAPI void APIENTRY glGetFramebufferAttachmentParameterivEXT (GLenum target, GLenum attachment, GLenum pname, GLint *params); +GLAPI void APIENTRY glGenerateMipmapEXT (GLenum target); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef GLboolean (APIENTRYP PFNGLISRENDERBUFFEREXTPROC) (GLuint renderbuffer); +typedef void (APIENTRYP PFNGLBINDRENDERBUFFEREXTPROC) (GLenum target, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLDELETERENDERBUFFERSEXTPROC) (GLsizei n, const GLuint *renderbuffers); +typedef void (APIENTRYP PFNGLGENRENDERBUFFERSEXTPROC) (GLsizei n, GLuint *renderbuffers); +typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETRENDERBUFFERPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); +typedef GLboolean (APIENTRYP PFNGLISFRAMEBUFFEREXTPROC) (GLuint framebuffer); +typedef void (APIENTRYP PFNGLBINDFRAMEBUFFEREXTPROC) (GLenum target, GLuint framebuffer); +typedef void (APIENTRYP PFNGLDELETEFRAMEBUFFERSEXTPROC) (GLsizei n, const GLuint *framebuffers); +typedef void (APIENTRYP PFNGLGENFRAMEBUFFERSEXTPROC) (GLsizei n, GLuint *framebuffers); +typedef GLenum (APIENTRYP PFNGLCHECKFRAMEBUFFERSTATUSEXTPROC) (GLenum target); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE1DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE2DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE3DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset); +typedef void (APIENTRYP PFNGLFRAMEBUFFERRENDERBUFFEREXTPROC) (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLGETFRAMEBUFFERATTACHMENTPARAMETERIVEXTPROC) (GLenum target, GLenum attachment, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGENERATEMIPMAPEXTPROC) (GLenum target); +#endif + +#ifndef GL_GREMEDY_string_marker +#define GL_GREMEDY_string_marker 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glStringMarkerGREMEDY (GLsizei len, const GLvoid *string); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLSTRINGMARKERGREMEDYPROC) (GLsizei len, const GLvoid *string); +#endif + +#ifndef GL_EXT_packed_depth_stencil +#define GL_EXT_packed_depth_stencil 1 +#endif + +#ifndef GL_EXT_stencil_clear_tag +#define GL_EXT_stencil_clear_tag 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glStencilClearTagEXT (GLsizei stencilTagBits, GLuint stencilClearTag); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLSTENCILCLEARTAGEXTPROC) (GLsizei stencilTagBits, GLuint stencilClearTag); +#endif + +#ifndef GL_EXT_texture_sRGB +#define GL_EXT_texture_sRGB 1 +#endif + +#ifndef GL_EXT_framebuffer_blit +#define GL_EXT_framebuffer_blit 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlitFramebufferEXT (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBLITFRAMEBUFFEREXTPROC) (GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +#endif + +#ifndef GL_EXT_framebuffer_multisample +#define GL_EXT_framebuffer_multisample 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glRenderbufferStorageMultisampleEXT (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLEEXTPROC) (GLenum target, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +#endif + +#ifndef GL_MESAX_texture_stack +#define GL_MESAX_texture_stack 1 +#endif + +#ifndef GL_EXT_timer_query +#define GL_EXT_timer_query 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetQueryObjecti64vEXT (GLuint id, GLenum pname, GLint64EXT *params); +GLAPI void APIENTRY glGetQueryObjectui64vEXT (GLuint id, GLenum pname, GLuint64EXT *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGETQUERYOBJECTI64VEXTPROC) (GLuint id, GLenum pname, GLint64EXT *params); +typedef void (APIENTRYP PFNGLGETQUERYOBJECTUI64VEXTPROC) (GLuint id, GLenum pname, GLuint64EXT *params); +#endif + +#ifndef GL_EXT_gpu_program_parameters +#define GL_EXT_gpu_program_parameters 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glProgramEnvParameters4fvEXT (GLenum target, GLuint index, GLsizei count, const GLfloat *params); +GLAPI void APIENTRY glProgramLocalParameters4fvEXT (GLenum target, GLuint index, GLsizei count, const GLfloat *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERS4FVEXTPROC) (GLenum target, GLuint index, GLsizei count, const GLfloat *params); +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERS4FVEXTPROC) (GLenum target, GLuint index, GLsizei count, const GLfloat *params); +#endif + +#ifndef GL_APPLE_flush_buffer_range +#define GL_APPLE_flush_buffer_range 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBufferParameteriAPPLE (GLenum target, GLenum pname, GLint param); +GLAPI void APIENTRY glFlushMappedBufferRangeAPPLE (GLenum target, GLintptr offset, GLsizeiptr size); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBUFFERPARAMETERIAPPLEPROC) (GLenum target, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLFLUSHMAPPEDBUFFERRANGEAPPLEPROC) (GLenum target, GLintptr offset, GLsizeiptr size); +#endif + +#ifndef GL_NV_gpu_program4 +#define GL_NV_gpu_program4 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glProgramLocalParameterI4iNV (GLenum target, GLuint index, GLint x, GLint y, GLint z, GLint w); +GLAPI void APIENTRY glProgramLocalParameterI4ivNV (GLenum target, GLuint index, const GLint *params); +GLAPI void APIENTRY glProgramLocalParametersI4ivNV (GLenum target, GLuint index, GLsizei count, const GLint *params); +GLAPI void APIENTRY glProgramLocalParameterI4uiNV (GLenum target, GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +GLAPI void APIENTRY glProgramLocalParameterI4uivNV (GLenum target, GLuint index, const GLuint *params); +GLAPI void APIENTRY glProgramLocalParametersI4uivNV (GLenum target, GLuint index, GLsizei count, const GLuint *params); +GLAPI void APIENTRY glProgramEnvParameterI4iNV (GLenum target, GLuint index, GLint x, GLint y, GLint z, GLint w); +GLAPI void APIENTRY glProgramEnvParameterI4ivNV (GLenum target, GLuint index, const GLint *params); +GLAPI void APIENTRY glProgramEnvParametersI4ivNV (GLenum target, GLuint index, GLsizei count, const GLint *params); +GLAPI void APIENTRY glProgramEnvParameterI4uiNV (GLenum target, GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +GLAPI void APIENTRY glProgramEnvParameterI4uivNV (GLenum target, GLuint index, const GLuint *params); +GLAPI void APIENTRY glProgramEnvParametersI4uivNV (GLenum target, GLuint index, GLsizei count, const GLuint *params); +GLAPI void APIENTRY glGetProgramLocalParameterIivNV (GLenum target, GLuint index, GLint *params); +GLAPI void APIENTRY glGetProgramLocalParameterIuivNV (GLenum target, GLuint index, GLuint *params); +GLAPI void APIENTRY glGetProgramEnvParameterIivNV (GLenum target, GLuint index, GLint *params); +GLAPI void APIENTRY glGetProgramEnvParameterIuivNV (GLenum target, GLuint index, GLuint *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERI4INVPROC) (GLenum target, GLuint index, GLint x, GLint y, GLint z, GLint w); +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERI4IVNVPROC) (GLenum target, GLuint index, const GLint *params); +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERSI4IVNVPROC) (GLenum target, GLuint index, GLsizei count, const GLint *params); +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERI4UINVPROC) (GLenum target, GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERI4UIVNVPROC) (GLenum target, GLuint index, const GLuint *params); +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETERSI4UIVNVPROC) (GLenum target, GLuint index, GLsizei count, const GLuint *params); +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERI4INVPROC) (GLenum target, GLuint index, GLint x, GLint y, GLint z, GLint w); +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERI4IVNVPROC) (GLenum target, GLuint index, const GLint *params); +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERSI4IVNVPROC) (GLenum target, GLuint index, GLsizei count, const GLint *params); +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERI4UINVPROC) (GLenum target, GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERI4UIVNVPROC) (GLenum target, GLuint index, const GLuint *params); +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETERSI4UIVNVPROC) (GLenum target, GLuint index, GLsizei count, const GLuint *params); +typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERIIVNVPROC) (GLenum target, GLuint index, GLint *params); +typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERIUIVNVPROC) (GLenum target, GLuint index, GLuint *params); +typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERIIVNVPROC) (GLenum target, GLuint index, GLint *params); +typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERIUIVNVPROC) (GLenum target, GLuint index, GLuint *params); +#endif + +#ifndef GL_NV_geometry_program4 +#define GL_NV_geometry_program4 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glProgramVertexLimitNV (GLenum target, GLint limit); +GLAPI void APIENTRY glFramebufferTextureEXT (GLenum target, GLenum attachment, GLuint texture, GLint level); +GLAPI void APIENTRY glFramebufferTextureLayerEXT (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); +GLAPI void APIENTRY glFramebufferTextureFaceEXT (GLenum target, GLenum attachment, GLuint texture, GLint level, GLenum face); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPROGRAMVERTEXLIMITNVPROC) (GLenum target, GLint limit); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREEXTPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURELAYEREXTPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLint layer); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREFACEEXTPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level, GLenum face); +#endif + +#ifndef GL_EXT_geometry_shader4 +#define GL_EXT_geometry_shader4 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glProgramParameteriEXT (GLuint program, GLenum pname, GLint value); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPROGRAMPARAMETERIEXTPROC) (GLuint program, GLenum pname, GLint value); +#endif + +#ifndef GL_NV_vertex_program4 +#define GL_NV_vertex_program4 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexAttribI1iEXT (GLuint index, GLint x); +GLAPI void APIENTRY glVertexAttribI2iEXT (GLuint index, GLint x, GLint y); +GLAPI void APIENTRY glVertexAttribI3iEXT (GLuint index, GLint x, GLint y, GLint z); +GLAPI void APIENTRY glVertexAttribI4iEXT (GLuint index, GLint x, GLint y, GLint z, GLint w); +GLAPI void APIENTRY glVertexAttribI1uiEXT (GLuint index, GLuint x); +GLAPI void APIENTRY glVertexAttribI2uiEXT (GLuint index, GLuint x, GLuint y); +GLAPI void APIENTRY glVertexAttribI3uiEXT (GLuint index, GLuint x, GLuint y, GLuint z); +GLAPI void APIENTRY glVertexAttribI4uiEXT (GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +GLAPI void APIENTRY glVertexAttribI1ivEXT (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttribI2ivEXT (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttribI3ivEXT (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttribI4ivEXT (GLuint index, const GLint *v); +GLAPI void APIENTRY glVertexAttribI1uivEXT (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttribI2uivEXT (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttribI3uivEXT (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttribI4uivEXT (GLuint index, const GLuint *v); +GLAPI void APIENTRY glVertexAttribI4bvEXT (GLuint index, const GLbyte *v); +GLAPI void APIENTRY glVertexAttribI4svEXT (GLuint index, const GLshort *v); +GLAPI void APIENTRY glVertexAttribI4ubvEXT (GLuint index, const GLubyte *v); +GLAPI void APIENTRY glVertexAttribI4usvEXT (GLuint index, const GLushort *v); +GLAPI void APIENTRY glVertexAttribIPointerEXT (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glGetVertexAttribIivEXT (GLuint index, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetVertexAttribIuivEXT (GLuint index, GLenum pname, GLuint *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLVERTEXATTRIBI1IEXTPROC) (GLuint index, GLint x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI2IEXTPROC) (GLuint index, GLint x, GLint y); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI3IEXTPROC) (GLuint index, GLint x, GLint y, GLint z); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4IEXTPROC) (GLuint index, GLint x, GLint y, GLint z, GLint w); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI1UIEXTPROC) (GLuint index, GLuint x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI2UIEXTPROC) (GLuint index, GLuint x, GLuint y); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI3UIEXTPROC) (GLuint index, GLuint x, GLuint y, GLuint z); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UIEXTPROC) (GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI1IVEXTPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI2IVEXTPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI3IVEXTPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4IVEXTPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI1UIVEXTPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI2UIVEXTPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI3UIVEXTPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UIVEXTPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4BVEXTPROC) (GLuint index, const GLbyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4SVEXTPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4UBVEXTPROC) (GLuint index, const GLubyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBI4USVEXTPROC) (GLuint index, const GLushort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBIPOINTEREXTPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIIVEXTPROC) (GLuint index, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIUIVEXTPROC) (GLuint index, GLenum pname, GLuint *params); +#endif + +#ifndef GL_EXT_gpu_shader4 +#define GL_EXT_gpu_shader4 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetUniformuivEXT (GLuint program, GLint location, GLuint *params); +GLAPI void APIENTRY glBindFragDataLocationEXT (GLuint program, GLuint color, const GLchar *name); +GLAPI GLint APIENTRY glGetFragDataLocationEXT (GLuint program, const GLchar *name); +GLAPI void APIENTRY glUniform1uiEXT (GLint location, GLuint v0); +GLAPI void APIENTRY glUniform2uiEXT (GLint location, GLuint v0, GLuint v1); +GLAPI void APIENTRY glUniform3uiEXT (GLint location, GLuint v0, GLuint v1, GLuint v2); +GLAPI void APIENTRY glUniform4uiEXT (GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); +GLAPI void APIENTRY glUniform1uivEXT (GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glUniform2uivEXT (GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glUniform3uivEXT (GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glUniform4uivEXT (GLint location, GLsizei count, const GLuint *value); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGETUNIFORMUIVEXTPROC) (GLuint program, GLint location, GLuint *params); +typedef void (APIENTRYP PFNGLBINDFRAGDATALOCATIONEXTPROC) (GLuint program, GLuint color, const GLchar *name); +typedef GLint (APIENTRYP PFNGLGETFRAGDATALOCATIONEXTPROC) (GLuint program, const GLchar *name); +typedef void (APIENTRYP PFNGLUNIFORM1UIEXTPROC) (GLint location, GLuint v0); +typedef void (APIENTRYP PFNGLUNIFORM2UIEXTPROC) (GLint location, GLuint v0, GLuint v1); +typedef void (APIENTRYP PFNGLUNIFORM3UIEXTPROC) (GLint location, GLuint v0, GLuint v1, GLuint v2); +typedef void (APIENTRYP PFNGLUNIFORM4UIEXTPROC) (GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); +typedef void (APIENTRYP PFNGLUNIFORM1UIVEXTPROC) (GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLUNIFORM2UIVEXTPROC) (GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLUNIFORM3UIVEXTPROC) (GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLUNIFORM4UIVEXTPROC) (GLint location, GLsizei count, const GLuint *value); +#endif + +#ifndef GL_EXT_draw_instanced +#define GL_EXT_draw_instanced 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawArraysInstancedEXT (GLenum mode, GLint start, GLsizei count, GLsizei primcount); +GLAPI void APIENTRY glDrawElementsInstancedEXT (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei primcount); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDEXTPROC) (GLenum mode, GLint start, GLsizei count, GLsizei primcount); +typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDEXTPROC) (GLenum mode, GLsizei count, GLenum type, const GLvoid *indices, GLsizei primcount); +#endif + +#ifndef GL_EXT_packed_float +#define GL_EXT_packed_float 1 +#endif + +#ifndef GL_EXT_texture_array +#define GL_EXT_texture_array 1 +#endif + +#ifndef GL_EXT_texture_buffer_object +#define GL_EXT_texture_buffer_object 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexBufferEXT (GLenum target, GLenum internalformat, GLuint buffer); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTEXBUFFEREXTPROC) (GLenum target, GLenum internalformat, GLuint buffer); +#endif + +#ifndef GL_EXT_texture_compression_latc +#define GL_EXT_texture_compression_latc 1 +#endif + +#ifndef GL_EXT_texture_compression_rgtc +#define GL_EXT_texture_compression_rgtc 1 +#endif + +#ifndef GL_EXT_texture_shared_exponent +#define GL_EXT_texture_shared_exponent 1 +#endif + +#ifndef GL_NV_depth_buffer_float +#define GL_NV_depth_buffer_float 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDepthRangedNV (GLdouble zNear, GLdouble zFar); +GLAPI void APIENTRY glClearDepthdNV (GLdouble depth); +GLAPI void APIENTRY glDepthBoundsdNV (GLdouble zmin, GLdouble zmax); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDEPTHRANGEDNVPROC) (GLdouble zNear, GLdouble zFar); +typedef void (APIENTRYP PFNGLCLEARDEPTHDNVPROC) (GLdouble depth); +typedef void (APIENTRYP PFNGLDEPTHBOUNDSDNVPROC) (GLdouble zmin, GLdouble zmax); +#endif + +#ifndef GL_NV_fragment_program4 +#define GL_NV_fragment_program4 1 +#endif + +#ifndef GL_NV_framebuffer_multisample_coverage +#define GL_NV_framebuffer_multisample_coverage 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glRenderbufferStorageMultisampleCoverageNV (GLenum target, GLsizei coverageSamples, GLsizei colorSamples, GLenum internalformat, GLsizei width, GLsizei height); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLECOVERAGENVPROC) (GLenum target, GLsizei coverageSamples, GLsizei colorSamples, GLenum internalformat, GLsizei width, GLsizei height); +#endif + +#ifndef GL_EXT_framebuffer_sRGB +#define GL_EXT_framebuffer_sRGB 1 +#endif + +#ifndef GL_NV_geometry_shader4 +#define GL_NV_geometry_shader4 1 +#endif + +#ifndef GL_NV_parameter_buffer_object +#define GL_NV_parameter_buffer_object 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glProgramBufferParametersfvNV (GLenum target, GLuint buffer, GLuint index, GLsizei count, const GLfloat *params); +GLAPI void APIENTRY glProgramBufferParametersIivNV (GLenum target, GLuint buffer, GLuint index, GLsizei count, const GLint *params); +GLAPI void APIENTRY glProgramBufferParametersIuivNV (GLenum target, GLuint buffer, GLuint index, GLsizei count, const GLuint *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPROGRAMBUFFERPARAMETERSFVNVPROC) (GLenum target, GLuint buffer, GLuint index, GLsizei count, const GLfloat *params); +typedef void (APIENTRYP PFNGLPROGRAMBUFFERPARAMETERSIIVNVPROC) (GLenum target, GLuint buffer, GLuint index, GLsizei count, const GLint *params); +typedef void (APIENTRYP PFNGLPROGRAMBUFFERPARAMETERSIUIVNVPROC) (GLenum target, GLuint buffer, GLuint index, GLsizei count, const GLuint *params); +#endif + +#ifndef GL_EXT_draw_buffers2 +#define GL_EXT_draw_buffers2 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glColorMaskIndexedEXT (GLuint index, GLboolean r, GLboolean g, GLboolean b, GLboolean a); +GLAPI void APIENTRY glGetBooleanIndexedvEXT (GLenum target, GLuint index, GLboolean *data); +GLAPI void APIENTRY glGetIntegerIndexedvEXT (GLenum target, GLuint index, GLint *data); +GLAPI void APIENTRY glEnableIndexedEXT (GLenum target, GLuint index); +GLAPI void APIENTRY glDisableIndexedEXT (GLenum target, GLuint index); +GLAPI GLboolean APIENTRY glIsEnabledIndexedEXT (GLenum target, GLuint index); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCOLORMASKINDEXEDEXTPROC) (GLuint index, GLboolean r, GLboolean g, GLboolean b, GLboolean a); +typedef void (APIENTRYP PFNGLGETBOOLEANINDEXEDVEXTPROC) (GLenum target, GLuint index, GLboolean *data); +typedef void (APIENTRYP PFNGLGETINTEGERINDEXEDVEXTPROC) (GLenum target, GLuint index, GLint *data); +typedef void (APIENTRYP PFNGLENABLEINDEXEDEXTPROC) (GLenum target, GLuint index); +typedef void (APIENTRYP PFNGLDISABLEINDEXEDEXTPROC) (GLenum target, GLuint index); +typedef GLboolean (APIENTRYP PFNGLISENABLEDINDEXEDEXTPROC) (GLenum target, GLuint index); +#endif + +#ifndef GL_NV_transform_feedback +#define GL_NV_transform_feedback 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBeginTransformFeedbackNV (GLenum primitiveMode); +GLAPI void APIENTRY glEndTransformFeedbackNV (void); +GLAPI void APIENTRY glTransformFeedbackAttribsNV (GLuint count, const GLint *attribs, GLenum bufferMode); +GLAPI void APIENTRY glBindBufferRangeNV (GLenum target, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); +GLAPI void APIENTRY glBindBufferOffsetNV (GLenum target, GLuint index, GLuint buffer, GLintptr offset); +GLAPI void APIENTRY glBindBufferBaseNV (GLenum target, GLuint index, GLuint buffer); +GLAPI void APIENTRY glTransformFeedbackVaryingsNV (GLuint program, GLsizei count, const GLint *locations, GLenum bufferMode); +GLAPI void APIENTRY glActiveVaryingNV (GLuint program, const GLchar *name); +GLAPI GLint APIENTRY glGetVaryingLocationNV (GLuint program, const GLchar *name); +GLAPI void APIENTRY glGetActiveVaryingNV (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLsizei *size, GLenum *type, GLchar *name); +GLAPI void APIENTRY glGetTransformFeedbackVaryingNV (GLuint program, GLuint index, GLint *location); +GLAPI void APIENTRY glTransformFeedbackStreamAttribsNV (GLsizei count, const GLint *attribs, GLsizei nbuffers, const GLint *bufstreams, GLenum bufferMode); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBEGINTRANSFORMFEEDBACKNVPROC) (GLenum primitiveMode); +typedef void (APIENTRYP PFNGLENDTRANSFORMFEEDBACKNVPROC) (void); +typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKATTRIBSNVPROC) (GLuint count, const GLint *attribs, GLenum bufferMode); +typedef void (APIENTRYP PFNGLBINDBUFFERRANGENVPROC) (GLenum target, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLBINDBUFFEROFFSETNVPROC) (GLenum target, GLuint index, GLuint buffer, GLintptr offset); +typedef void (APIENTRYP PFNGLBINDBUFFERBASENVPROC) (GLenum target, GLuint index, GLuint buffer); +typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKVARYINGSNVPROC) (GLuint program, GLsizei count, const GLint *locations, GLenum bufferMode); +typedef void (APIENTRYP PFNGLACTIVEVARYINGNVPROC) (GLuint program, const GLchar *name); +typedef GLint (APIENTRYP PFNGLGETVARYINGLOCATIONNVPROC) (GLuint program, const GLchar *name); +typedef void (APIENTRYP PFNGLGETACTIVEVARYINGNVPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLsizei *size, GLenum *type, GLchar *name); +typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKVARYINGNVPROC) (GLuint program, GLuint index, GLint *location); +typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKSTREAMATTRIBSNVPROC) (GLsizei count, const GLint *attribs, GLsizei nbuffers, const GLint *bufstreams, GLenum bufferMode); +#endif + +#ifndef GL_EXT_bindable_uniform +#define GL_EXT_bindable_uniform 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glUniformBufferEXT (GLuint program, GLint location, GLuint buffer); +GLAPI GLint APIENTRY glGetUniformBufferSizeEXT (GLuint program, GLint location); +GLAPI GLintptr APIENTRY glGetUniformOffsetEXT (GLuint program, GLint location); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLUNIFORMBUFFEREXTPROC) (GLuint program, GLint location, GLuint buffer); +typedef GLint (APIENTRYP PFNGLGETUNIFORMBUFFERSIZEEXTPROC) (GLuint program, GLint location); +typedef GLintptr (APIENTRYP PFNGLGETUNIFORMOFFSETEXTPROC) (GLuint program, GLint location); +#endif + +#ifndef GL_EXT_texture_integer +#define GL_EXT_texture_integer 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexParameterIivEXT (GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glTexParameterIuivEXT (GLenum target, GLenum pname, const GLuint *params); +GLAPI void APIENTRY glGetTexParameterIivEXT (GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetTexParameterIuivEXT (GLenum target, GLenum pname, GLuint *params); +GLAPI void APIENTRY glClearColorIiEXT (GLint red, GLint green, GLint blue, GLint alpha); +GLAPI void APIENTRY glClearColorIuiEXT (GLuint red, GLuint green, GLuint blue, GLuint alpha); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTEXPARAMETERIIVEXTPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLTEXPARAMETERIUIVEXTPROC) (GLenum target, GLenum pname, const GLuint *params); +typedef void (APIENTRYP PFNGLGETTEXPARAMETERIIVEXTPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETTEXPARAMETERIUIVEXTPROC) (GLenum target, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLCLEARCOLORIIEXTPROC) (GLint red, GLint green, GLint blue, GLint alpha); +typedef void (APIENTRYP PFNGLCLEARCOLORIUIEXTPROC) (GLuint red, GLuint green, GLuint blue, GLuint alpha); +#endif + +#ifndef GL_GREMEDY_frame_terminator +#define GL_GREMEDY_frame_terminator 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFrameTerminatorGREMEDY (void); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLFRAMETERMINATORGREMEDYPROC) (void); +#endif + +#ifndef GL_NV_conditional_render +#define GL_NV_conditional_render 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBeginConditionalRenderNV (GLuint id, GLenum mode); +GLAPI void APIENTRY glEndConditionalRenderNV (void); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBEGINCONDITIONALRENDERNVPROC) (GLuint id, GLenum mode); +typedef void (APIENTRYP PFNGLENDCONDITIONALRENDERNVPROC) (void); +#endif + +#ifndef GL_NV_present_video +#define GL_NV_present_video 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPresentFrameKeyedNV (GLuint video_slot, GLuint64EXT minPresentTime, GLuint beginPresentTimeId, GLuint presentDurationId, GLenum type, GLenum target0, GLuint fill0, GLuint key0, GLenum target1, GLuint fill1, GLuint key1); +GLAPI void APIENTRY glPresentFrameDualFillNV (GLuint video_slot, GLuint64EXT minPresentTime, GLuint beginPresentTimeId, GLuint presentDurationId, GLenum type, GLenum target0, GLuint fill0, GLenum target1, GLuint fill1, GLenum target2, GLuint fill2, GLenum target3, GLuint fill3); +GLAPI void APIENTRY glGetVideoivNV (GLuint video_slot, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetVideouivNV (GLuint video_slot, GLenum pname, GLuint *params); +GLAPI void APIENTRY glGetVideoi64vNV (GLuint video_slot, GLenum pname, GLint64EXT *params); +GLAPI void APIENTRY glGetVideoui64vNV (GLuint video_slot, GLenum pname, GLuint64EXT *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPRESENTFRAMEKEYEDNVPROC) (GLuint video_slot, GLuint64EXT minPresentTime, GLuint beginPresentTimeId, GLuint presentDurationId, GLenum type, GLenum target0, GLuint fill0, GLuint key0, GLenum target1, GLuint fill1, GLuint key1); +typedef void (APIENTRYP PFNGLPRESENTFRAMEDUALFILLNVPROC) (GLuint video_slot, GLuint64EXT minPresentTime, GLuint beginPresentTimeId, GLuint presentDurationId, GLenum type, GLenum target0, GLuint fill0, GLenum target1, GLuint fill1, GLenum target2, GLuint fill2, GLenum target3, GLuint fill3); +typedef void (APIENTRYP PFNGLGETVIDEOIVNVPROC) (GLuint video_slot, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVIDEOUIVNVPROC) (GLuint video_slot, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLGETVIDEOI64VNVPROC) (GLuint video_slot, GLenum pname, GLint64EXT *params); +typedef void (APIENTRYP PFNGLGETVIDEOUI64VNVPROC) (GLuint video_slot, GLenum pname, GLuint64EXT *params); +#endif + +#ifndef GL_EXT_transform_feedback +#define GL_EXT_transform_feedback 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBeginTransformFeedbackEXT (GLenum primitiveMode); +GLAPI void APIENTRY glEndTransformFeedbackEXT (void); +GLAPI void APIENTRY glBindBufferRangeEXT (GLenum target, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); +GLAPI void APIENTRY glBindBufferOffsetEXT (GLenum target, GLuint index, GLuint buffer, GLintptr offset); +GLAPI void APIENTRY glBindBufferBaseEXT (GLenum target, GLuint index, GLuint buffer); +GLAPI void APIENTRY glTransformFeedbackVaryingsEXT (GLuint program, GLsizei count, const GLchar* *varyings, GLenum bufferMode); +GLAPI void APIENTRY glGetTransformFeedbackVaryingEXT (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLsizei *size, GLenum *type, GLchar *name); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBEGINTRANSFORMFEEDBACKEXTPROC) (GLenum primitiveMode); +typedef void (APIENTRYP PFNGLENDTRANSFORMFEEDBACKEXTPROC) (void); +typedef void (APIENTRYP PFNGLBINDBUFFERRANGEEXTPROC) (GLenum target, GLuint index, GLuint buffer, GLintptr offset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLBINDBUFFEROFFSETEXTPROC) (GLenum target, GLuint index, GLuint buffer, GLintptr offset); +typedef void (APIENTRYP PFNGLBINDBUFFERBASEEXTPROC) (GLenum target, GLuint index, GLuint buffer); +typedef void (APIENTRYP PFNGLTRANSFORMFEEDBACKVARYINGSEXTPROC) (GLuint program, GLsizei count, const GLchar* *varyings, GLenum bufferMode); +typedef void (APIENTRYP PFNGLGETTRANSFORMFEEDBACKVARYINGEXTPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLsizei *size, GLenum *type, GLchar *name); +#endif + +#ifndef GL_EXT_direct_state_access +#define GL_EXT_direct_state_access 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glClientAttribDefaultEXT (GLbitfield mask); +GLAPI void APIENTRY glPushClientAttribDefaultEXT (GLbitfield mask); +GLAPI void APIENTRY glMatrixLoadfEXT (GLenum mode, const GLfloat *m); +GLAPI void APIENTRY glMatrixLoaddEXT (GLenum mode, const GLdouble *m); +GLAPI void APIENTRY glMatrixMultfEXT (GLenum mode, const GLfloat *m); +GLAPI void APIENTRY glMatrixMultdEXT (GLenum mode, const GLdouble *m); +GLAPI void APIENTRY glMatrixLoadIdentityEXT (GLenum mode); +GLAPI void APIENTRY glMatrixRotatefEXT (GLenum mode, GLfloat angle, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glMatrixRotatedEXT (GLenum mode, GLdouble angle, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glMatrixScalefEXT (GLenum mode, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glMatrixScaledEXT (GLenum mode, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glMatrixTranslatefEXT (GLenum mode, GLfloat x, GLfloat y, GLfloat z); +GLAPI void APIENTRY glMatrixTranslatedEXT (GLenum mode, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glMatrixFrustumEXT (GLenum mode, GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); +GLAPI void APIENTRY glMatrixOrthoEXT (GLenum mode, GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); +GLAPI void APIENTRY glMatrixPopEXT (GLenum mode); +GLAPI void APIENTRY glMatrixPushEXT (GLenum mode); +GLAPI void APIENTRY glMatrixLoadTransposefEXT (GLenum mode, const GLfloat *m); +GLAPI void APIENTRY glMatrixLoadTransposedEXT (GLenum mode, const GLdouble *m); +GLAPI void APIENTRY glMatrixMultTransposefEXT (GLenum mode, const GLfloat *m); +GLAPI void APIENTRY glMatrixMultTransposedEXT (GLenum mode, const GLdouble *m); +GLAPI void APIENTRY glTextureParameterfEXT (GLuint texture, GLenum target, GLenum pname, GLfloat param); +GLAPI void APIENTRY glTextureParameterfvEXT (GLuint texture, GLenum target, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glTextureParameteriEXT (GLuint texture, GLenum target, GLenum pname, GLint param); +GLAPI void APIENTRY glTextureParameterivEXT (GLuint texture, GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glTextureImage1DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glTextureImage2DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glTextureSubImage1DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glTextureSubImage2DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glCopyTextureImage1DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); +GLAPI void APIENTRY glCopyTextureImage2DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); +GLAPI void APIENTRY glCopyTextureSubImage1DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +GLAPI void APIENTRY glCopyTextureSubImage2DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glGetTextureImageEXT (GLuint texture, GLenum target, GLint level, GLenum format, GLenum type, GLvoid *pixels); +GLAPI void APIENTRY glGetTextureParameterfvEXT (GLuint texture, GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetTextureParameterivEXT (GLuint texture, GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetTextureLevelParameterfvEXT (GLuint texture, GLenum target, GLint level, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetTextureLevelParameterivEXT (GLuint texture, GLenum target, GLint level, GLenum pname, GLint *params); +GLAPI void APIENTRY glTextureImage3DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glTextureSubImage3DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glCopyTextureSubImage3DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glMultiTexParameterfEXT (GLenum texunit, GLenum target, GLenum pname, GLfloat param); +GLAPI void APIENTRY glMultiTexParameterfvEXT (GLenum texunit, GLenum target, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glMultiTexParameteriEXT (GLenum texunit, GLenum target, GLenum pname, GLint param); +GLAPI void APIENTRY glMultiTexParameterivEXT (GLenum texunit, GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glMultiTexImage1DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glMultiTexImage2DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glMultiTexSubImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glMultiTexSubImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glCopyMultiTexImage1DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); +GLAPI void APIENTRY glCopyMultiTexImage2DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); +GLAPI void APIENTRY glCopyMultiTexSubImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +GLAPI void APIENTRY glCopyMultiTexSubImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glGetMultiTexImageEXT (GLenum texunit, GLenum target, GLint level, GLenum format, GLenum type, GLvoid *pixels); +GLAPI void APIENTRY glGetMultiTexParameterfvEXT (GLenum texunit, GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetMultiTexParameterivEXT (GLenum texunit, GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetMultiTexLevelParameterfvEXT (GLenum texunit, GLenum target, GLint level, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetMultiTexLevelParameterivEXT (GLenum texunit, GLenum target, GLint level, GLenum pname, GLint *params); +GLAPI void APIENTRY glMultiTexImage3DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glMultiTexSubImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +GLAPI void APIENTRY glCopyMultiTexSubImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glBindMultiTextureEXT (GLenum texunit, GLenum target, GLuint texture); +GLAPI void APIENTRY glEnableClientStateIndexedEXT (GLenum array, GLuint index); +GLAPI void APIENTRY glDisableClientStateIndexedEXT (GLenum array, GLuint index); +GLAPI void APIENTRY glMultiTexCoordPointerEXT (GLenum texunit, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glMultiTexEnvfEXT (GLenum texunit, GLenum target, GLenum pname, GLfloat param); +GLAPI void APIENTRY glMultiTexEnvfvEXT (GLenum texunit, GLenum target, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glMultiTexEnviEXT (GLenum texunit, GLenum target, GLenum pname, GLint param); +GLAPI void APIENTRY glMultiTexEnvivEXT (GLenum texunit, GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glMultiTexGendEXT (GLenum texunit, GLenum coord, GLenum pname, GLdouble param); +GLAPI void APIENTRY glMultiTexGendvEXT (GLenum texunit, GLenum coord, GLenum pname, const GLdouble *params); +GLAPI void APIENTRY glMultiTexGenfEXT (GLenum texunit, GLenum coord, GLenum pname, GLfloat param); +GLAPI void APIENTRY glMultiTexGenfvEXT (GLenum texunit, GLenum coord, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glMultiTexGeniEXT (GLenum texunit, GLenum coord, GLenum pname, GLint param); +GLAPI void APIENTRY glMultiTexGenivEXT (GLenum texunit, GLenum coord, GLenum pname, const GLint *params); +GLAPI void APIENTRY glGetMultiTexEnvfvEXT (GLenum texunit, GLenum target, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetMultiTexEnvivEXT (GLenum texunit, GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetMultiTexGendvEXT (GLenum texunit, GLenum coord, GLenum pname, GLdouble *params); +GLAPI void APIENTRY glGetMultiTexGenfvEXT (GLenum texunit, GLenum coord, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetMultiTexGenivEXT (GLenum texunit, GLenum coord, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetFloatIndexedvEXT (GLenum target, GLuint index, GLfloat *data); +GLAPI void APIENTRY glGetDoubleIndexedvEXT (GLenum target, GLuint index, GLdouble *data); +GLAPI void APIENTRY glGetPointerIndexedvEXT (GLenum target, GLuint index, GLvoid* *data); +GLAPI void APIENTRY glCompressedTextureImage3DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *bits); +GLAPI void APIENTRY glCompressedTextureImage2DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *bits); +GLAPI void APIENTRY glCompressedTextureImage1DEXT (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *bits); +GLAPI void APIENTRY glCompressedTextureSubImage3DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *bits); +GLAPI void APIENTRY glCompressedTextureSubImage2DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *bits); +GLAPI void APIENTRY glCompressedTextureSubImage1DEXT (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *bits); +GLAPI void APIENTRY glGetCompressedTextureImageEXT (GLuint texture, GLenum target, GLint lod, GLvoid *img); +GLAPI void APIENTRY glCompressedMultiTexImage3DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *bits); +GLAPI void APIENTRY glCompressedMultiTexImage2DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *bits); +GLAPI void APIENTRY glCompressedMultiTexImage1DEXT (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *bits); +GLAPI void APIENTRY glCompressedMultiTexSubImage3DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *bits); +GLAPI void APIENTRY glCompressedMultiTexSubImage2DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *bits); +GLAPI void APIENTRY glCompressedMultiTexSubImage1DEXT (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *bits); +GLAPI void APIENTRY glGetCompressedMultiTexImageEXT (GLenum texunit, GLenum target, GLint lod, GLvoid *img); +GLAPI void APIENTRY glNamedProgramStringEXT (GLuint program, GLenum target, GLenum format, GLsizei len, const GLvoid *string); +GLAPI void APIENTRY glNamedProgramLocalParameter4dEXT (GLuint program, GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glNamedProgramLocalParameter4dvEXT (GLuint program, GLenum target, GLuint index, const GLdouble *params); +GLAPI void APIENTRY glNamedProgramLocalParameter4fEXT (GLuint program, GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +GLAPI void APIENTRY glNamedProgramLocalParameter4fvEXT (GLuint program, GLenum target, GLuint index, const GLfloat *params); +GLAPI void APIENTRY glGetNamedProgramLocalParameterdvEXT (GLuint program, GLenum target, GLuint index, GLdouble *params); +GLAPI void APIENTRY glGetNamedProgramLocalParameterfvEXT (GLuint program, GLenum target, GLuint index, GLfloat *params); +GLAPI void APIENTRY glGetNamedProgramivEXT (GLuint program, GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetNamedProgramStringEXT (GLuint program, GLenum target, GLenum pname, GLvoid *string); +GLAPI void APIENTRY glNamedProgramLocalParameters4fvEXT (GLuint program, GLenum target, GLuint index, GLsizei count, const GLfloat *params); +GLAPI void APIENTRY glNamedProgramLocalParameterI4iEXT (GLuint program, GLenum target, GLuint index, GLint x, GLint y, GLint z, GLint w); +GLAPI void APIENTRY glNamedProgramLocalParameterI4ivEXT (GLuint program, GLenum target, GLuint index, const GLint *params); +GLAPI void APIENTRY glNamedProgramLocalParametersI4ivEXT (GLuint program, GLenum target, GLuint index, GLsizei count, const GLint *params); +GLAPI void APIENTRY glNamedProgramLocalParameterI4uiEXT (GLuint program, GLenum target, GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +GLAPI void APIENTRY glNamedProgramLocalParameterI4uivEXT (GLuint program, GLenum target, GLuint index, const GLuint *params); +GLAPI void APIENTRY glNamedProgramLocalParametersI4uivEXT (GLuint program, GLenum target, GLuint index, GLsizei count, const GLuint *params); +GLAPI void APIENTRY glGetNamedProgramLocalParameterIivEXT (GLuint program, GLenum target, GLuint index, GLint *params); +GLAPI void APIENTRY glGetNamedProgramLocalParameterIuivEXT (GLuint program, GLenum target, GLuint index, GLuint *params); +GLAPI void APIENTRY glTextureParameterIivEXT (GLuint texture, GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glTextureParameterIuivEXT (GLuint texture, GLenum target, GLenum pname, const GLuint *params); +GLAPI void APIENTRY glGetTextureParameterIivEXT (GLuint texture, GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetTextureParameterIuivEXT (GLuint texture, GLenum target, GLenum pname, GLuint *params); +GLAPI void APIENTRY glMultiTexParameterIivEXT (GLenum texunit, GLenum target, GLenum pname, const GLint *params); +GLAPI void APIENTRY glMultiTexParameterIuivEXT (GLenum texunit, GLenum target, GLenum pname, const GLuint *params); +GLAPI void APIENTRY glGetMultiTexParameterIivEXT (GLenum texunit, GLenum target, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetMultiTexParameterIuivEXT (GLenum texunit, GLenum target, GLenum pname, GLuint *params); +GLAPI void APIENTRY glProgramUniform1fEXT (GLuint program, GLint location, GLfloat v0); +GLAPI void APIENTRY glProgramUniform2fEXT (GLuint program, GLint location, GLfloat v0, GLfloat v1); +GLAPI void APIENTRY glProgramUniform3fEXT (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +GLAPI void APIENTRY glProgramUniform4fEXT (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +GLAPI void APIENTRY glProgramUniform1iEXT (GLuint program, GLint location, GLint v0); +GLAPI void APIENTRY glProgramUniform2iEXT (GLuint program, GLint location, GLint v0, GLint v1); +GLAPI void APIENTRY glProgramUniform3iEXT (GLuint program, GLint location, GLint v0, GLint v1, GLint v2); +GLAPI void APIENTRY glProgramUniform4iEXT (GLuint program, GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +GLAPI void APIENTRY glProgramUniform1fvEXT (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform2fvEXT (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform3fvEXT (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform4fvEXT (GLuint program, GLint location, GLsizei count, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform1ivEXT (GLuint program, GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glProgramUniform2ivEXT (GLuint program, GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glProgramUniform3ivEXT (GLuint program, GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glProgramUniform4ivEXT (GLuint program, GLint location, GLsizei count, const GLint *value); +GLAPI void APIENTRY glProgramUniformMatrix2fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix3fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix4fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix2x3fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix3x2fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix2x4fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix4x2fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix3x4fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniformMatrix4x3fvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +GLAPI void APIENTRY glProgramUniform1uiEXT (GLuint program, GLint location, GLuint v0); +GLAPI void APIENTRY glProgramUniform2uiEXT (GLuint program, GLint location, GLuint v0, GLuint v1); +GLAPI void APIENTRY glProgramUniform3uiEXT (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2); +GLAPI void APIENTRY glProgramUniform4uiEXT (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); +GLAPI void APIENTRY glProgramUniform1uivEXT (GLuint program, GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glProgramUniform2uivEXT (GLuint program, GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glProgramUniform3uivEXT (GLuint program, GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glProgramUniform4uivEXT (GLuint program, GLint location, GLsizei count, const GLuint *value); +GLAPI void APIENTRY glNamedBufferDataEXT (GLuint buffer, GLsizeiptr size, const GLvoid *data, GLenum usage); +GLAPI void APIENTRY glNamedBufferSubDataEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, const GLvoid *data); +GLAPI GLvoid* APIENTRY glMapNamedBufferEXT (GLuint buffer, GLenum access); +GLAPI GLboolean APIENTRY glUnmapNamedBufferEXT (GLuint buffer); +GLAPI GLvoid* APIENTRY glMapNamedBufferRangeEXT (GLuint buffer, GLintptr offset, GLsizeiptr length, GLbitfield access); +GLAPI void APIENTRY glFlushMappedNamedBufferRangeEXT (GLuint buffer, GLintptr offset, GLsizeiptr length); +GLAPI void APIENTRY glNamedCopyBufferSubDataEXT (GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +GLAPI void APIENTRY glGetNamedBufferParameterivEXT (GLuint buffer, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetNamedBufferPointervEXT (GLuint buffer, GLenum pname, GLvoid* *params); +GLAPI void APIENTRY glGetNamedBufferSubDataEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, GLvoid *data); +GLAPI void APIENTRY glTextureBufferEXT (GLuint texture, GLenum target, GLenum internalformat, GLuint buffer); +GLAPI void APIENTRY glMultiTexBufferEXT (GLenum texunit, GLenum target, GLenum internalformat, GLuint buffer); +GLAPI void APIENTRY glNamedRenderbufferStorageEXT (GLuint renderbuffer, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glGetNamedRenderbufferParameterivEXT (GLuint renderbuffer, GLenum pname, GLint *params); +GLAPI GLenum APIENTRY glCheckNamedFramebufferStatusEXT (GLuint framebuffer, GLenum target); +GLAPI void APIENTRY glNamedFramebufferTexture1DEXT (GLuint framebuffer, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +GLAPI void APIENTRY glNamedFramebufferTexture2DEXT (GLuint framebuffer, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +GLAPI void APIENTRY glNamedFramebufferTexture3DEXT (GLuint framebuffer, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset); +GLAPI void APIENTRY glNamedFramebufferRenderbufferEXT (GLuint framebuffer, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +GLAPI void APIENTRY glGetNamedFramebufferAttachmentParameterivEXT (GLuint framebuffer, GLenum attachment, GLenum pname, GLint *params); +GLAPI void APIENTRY glGenerateTextureMipmapEXT (GLuint texture, GLenum target); +GLAPI void APIENTRY glGenerateMultiTexMipmapEXT (GLenum texunit, GLenum target); +GLAPI void APIENTRY glFramebufferDrawBufferEXT (GLuint framebuffer, GLenum mode); +GLAPI void APIENTRY glFramebufferDrawBuffersEXT (GLuint framebuffer, GLsizei n, const GLenum *bufs); +GLAPI void APIENTRY glFramebufferReadBufferEXT (GLuint framebuffer, GLenum mode); +GLAPI void APIENTRY glGetFramebufferParameterivEXT (GLuint framebuffer, GLenum pname, GLint *params); +GLAPI void APIENTRY glNamedRenderbufferStorageMultisampleEXT (GLuint renderbuffer, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glNamedRenderbufferStorageMultisampleCoverageEXT (GLuint renderbuffer, GLsizei coverageSamples, GLsizei colorSamples, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glNamedFramebufferTextureEXT (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level); +GLAPI void APIENTRY glNamedFramebufferTextureLayerEXT (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLint layer); +GLAPI void APIENTRY glNamedFramebufferTextureFaceEXT (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLenum face); +GLAPI void APIENTRY glTextureRenderbufferEXT (GLuint texture, GLenum target, GLuint renderbuffer); +GLAPI void APIENTRY glMultiTexRenderbufferEXT (GLenum texunit, GLenum target, GLuint renderbuffer); +GLAPI void APIENTRY glProgramUniform1dEXT (GLuint program, GLint location, GLdouble x); +GLAPI void APIENTRY glProgramUniform2dEXT (GLuint program, GLint location, GLdouble x, GLdouble y); +GLAPI void APIENTRY glProgramUniform3dEXT (GLuint program, GLint location, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glProgramUniform4dEXT (GLuint program, GLint location, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glProgramUniform1dvEXT (GLuint program, GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glProgramUniform2dvEXT (GLuint program, GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glProgramUniform3dvEXT (GLuint program, GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glProgramUniform4dvEXT (GLuint program, GLint location, GLsizei count, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix2dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix3dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix4dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix2x3dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix2x4dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix3x2dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix3x4dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix4x2dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +GLAPI void APIENTRY glProgramUniformMatrix4x3dvEXT (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCLIENTATTRIBDEFAULTEXTPROC) (GLbitfield mask); +typedef void (APIENTRYP PFNGLPUSHCLIENTATTRIBDEFAULTEXTPROC) (GLbitfield mask); +typedef void (APIENTRYP PFNGLMATRIXLOADFEXTPROC) (GLenum mode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXLOADDEXTPROC) (GLenum mode, const GLdouble *m); +typedef void (APIENTRYP PFNGLMATRIXMULTFEXTPROC) (GLenum mode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXMULTDEXTPROC) (GLenum mode, const GLdouble *m); +typedef void (APIENTRYP PFNGLMATRIXLOADIDENTITYEXTPROC) (GLenum mode); +typedef void (APIENTRYP PFNGLMATRIXROTATEFEXTPROC) (GLenum mode, GLfloat angle, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLMATRIXROTATEDEXTPROC) (GLenum mode, GLdouble angle, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLMATRIXSCALEFEXTPROC) (GLenum mode, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLMATRIXSCALEDEXTPROC) (GLenum mode, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLMATRIXTRANSLATEFEXTPROC) (GLenum mode, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLMATRIXTRANSLATEDEXTPROC) (GLenum mode, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLMATRIXFRUSTUMEXTPROC) (GLenum mode, GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); +typedef void (APIENTRYP PFNGLMATRIXORTHOEXTPROC) (GLenum mode, GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); +typedef void (APIENTRYP PFNGLMATRIXPOPEXTPROC) (GLenum mode); +typedef void (APIENTRYP PFNGLMATRIXPUSHEXTPROC) (GLenum mode); +typedef void (APIENTRYP PFNGLMATRIXLOADTRANSPOSEFEXTPROC) (GLenum mode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXLOADTRANSPOSEDEXTPROC) (GLenum mode, const GLdouble *m); +typedef void (APIENTRYP PFNGLMATRIXMULTTRANSPOSEFEXTPROC) (GLenum mode, const GLfloat *m); +typedef void (APIENTRYP PFNGLMATRIXMULTTRANSPOSEDEXTPROC) (GLenum mode, const GLdouble *m); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERFEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERFVEXTPROC) (GLuint texture, GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLTEXTUREIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLTEXTUREIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLCOPYTEXTUREIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); +typedef void (APIENTRYP PFNGLCOPYTEXTUREIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); +typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETTEXTUREIMAGEEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum format, GLenum type, GLvoid *pixels); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERFVEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETTEXTURELEVELPARAMETERFVEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETTEXTURELEVELPARAMETERIVEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLTEXTUREIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLTEXTURESUBIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLCOPYTEXTURESUBIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLMULTITEXPARAMETERFEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLMULTITEXPARAMETERFVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLMULTITEXPARAMETERIEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLMULTITEXPARAMETERIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLMULTITEXIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLMULTITEXIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLMULTITEXSUBIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLMULTITEXSUBIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLCOPYMULTITEXIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); +typedef void (APIENTRYP PFNGLCOPYMULTITEXIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); +typedef void (APIENTRYP PFNGLCOPYMULTITEXSUBIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLCOPYMULTITEXSUBIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETMULTITEXIMAGEEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum format, GLenum type, GLvoid *pixels); +typedef void (APIENTRYP PFNGLGETMULTITEXPARAMETERFVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETMULTITEXPARAMETERIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETMULTITEXLEVELPARAMETERFVEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETMULTITEXLEVELPARAMETERIVEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLMULTITEXIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLMULTITEXSUBIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLCOPYMULTITEXSUBIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLBINDMULTITEXTUREEXTPROC) (GLenum texunit, GLenum target, GLuint texture); +typedef void (APIENTRYP PFNGLENABLECLIENTSTATEINDEXEDEXTPROC) (GLenum array, GLuint index); +typedef void (APIENTRYP PFNGLDISABLECLIENTSTATEINDEXEDEXTPROC) (GLenum array, GLuint index); +typedef void (APIENTRYP PFNGLMULTITEXCOORDPOINTEREXTPROC) (GLenum texunit, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLMULTITEXENVFEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLMULTITEXENVFVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLMULTITEXENVIEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLMULTITEXENVIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLMULTITEXGENDEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, GLdouble param); +typedef void (APIENTRYP PFNGLMULTITEXGENDVEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, const GLdouble *params); +typedef void (APIENTRYP PFNGLMULTITEXGENFEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLMULTITEXGENFVEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLMULTITEXGENIEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLMULTITEXGENIVEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLGETMULTITEXENVFVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETMULTITEXENVIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETMULTITEXGENDVEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, GLdouble *params); +typedef void (APIENTRYP PFNGLGETMULTITEXGENFVEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETMULTITEXGENIVEXTPROC) (GLenum texunit, GLenum coord, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETFLOATINDEXEDVEXTPROC) (GLenum target, GLuint index, GLfloat *data); +typedef void (APIENTRYP PFNGLGETDOUBLEINDEXEDVEXTPROC) (GLenum target, GLuint index, GLdouble *data); +typedef void (APIENTRYP PFNGLGETPOINTERINDEXEDVEXTPROC) (GLenum target, GLuint index, GLvoid* *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTUREIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTUREIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTUREIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE3DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE2DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXTURESUBIMAGE1DEXTPROC) (GLuint texture, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *bits); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXTUREIMAGEEXTPROC) (GLuint texture, GLenum target, GLint lod, GLvoid *img); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXSUBIMAGE3DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXSUBIMAGE2DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *bits); +typedef void (APIENTRYP PFNGLCOMPRESSEDMULTITEXSUBIMAGE1DEXTPROC) (GLenum texunit, GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *bits); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDMULTITEXIMAGEEXTPROC) (GLenum texunit, GLenum target, GLint lod, GLvoid *img); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMSTRINGEXTPROC) (GLuint program, GLenum target, GLenum format, GLsizei len, const GLvoid *string); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETER4DEXTPROC) (GLuint program, GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETER4DVEXTPROC) (GLuint program, GLenum target, GLuint index, const GLdouble *params); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETER4FEXTPROC) (GLuint program, GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETER4FVEXTPROC) (GLuint program, GLenum target, GLuint index, const GLfloat *params); +typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMLOCALPARAMETERDVEXTPROC) (GLuint program, GLenum target, GLuint index, GLdouble *params); +typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMLOCALPARAMETERFVEXTPROC) (GLuint program, GLenum target, GLuint index, GLfloat *params); +typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMIVEXTPROC) (GLuint program, GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMSTRINGEXTPROC) (GLuint program, GLenum target, GLenum pname, GLvoid *string); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETERS4FVEXTPROC) (GLuint program, GLenum target, GLuint index, GLsizei count, const GLfloat *params); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETERI4IEXTPROC) (GLuint program, GLenum target, GLuint index, GLint x, GLint y, GLint z, GLint w); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETERI4IVEXTPROC) (GLuint program, GLenum target, GLuint index, const GLint *params); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETERSI4IVEXTPROC) (GLuint program, GLenum target, GLuint index, GLsizei count, const GLint *params); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETERI4UIEXTPROC) (GLuint program, GLenum target, GLuint index, GLuint x, GLuint y, GLuint z, GLuint w); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETERI4UIVEXTPROC) (GLuint program, GLenum target, GLuint index, const GLuint *params); +typedef void (APIENTRYP PFNGLNAMEDPROGRAMLOCALPARAMETERSI4UIVEXTPROC) (GLuint program, GLenum target, GLuint index, GLsizei count, const GLuint *params); +typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMLOCALPARAMETERIIVEXTPROC) (GLuint program, GLenum target, GLuint index, GLint *params); +typedef void (APIENTRYP PFNGLGETNAMEDPROGRAMLOCALPARAMETERIUIVEXTPROC) (GLuint program, GLenum target, GLuint index, GLuint *params); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLTEXTUREPARAMETERIUIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, const GLuint *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERIIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETTEXTUREPARAMETERIUIVEXTPROC) (GLuint texture, GLenum target, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLMULTITEXPARAMETERIIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLMULTITEXPARAMETERIUIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, const GLuint *params); +typedef void (APIENTRYP PFNGLGETMULTITEXPARAMETERIIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETMULTITEXPARAMETERIUIVEXTPROC) (GLenum texunit, GLenum target, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1FEXTPROC) (GLuint program, GLint location, GLfloat v0); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2FEXTPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3FEXTPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4FEXTPROC) (GLuint program, GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1IEXTPROC) (GLuint program, GLint location, GLint v0); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2IEXTPROC) (GLuint program, GLint location, GLint v0, GLint v1); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3IEXTPROC) (GLuint program, GLint location, GLint v0, GLint v1, GLint v2); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4IEXTPROC) (GLuint program, GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1FVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2FVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3FVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4FVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1IVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2IVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3IVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4IVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X3FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X2FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X4FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X2FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X4FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X3FVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UIEXTPROC) (GLuint program, GLint location, GLuint v0); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UIEXTPROC) (GLuint program, GLint location, GLuint v0, GLuint v1); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UIEXTPROC) (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UIEXTPROC) (GLuint program, GLint location, GLuint v0, GLuint v1, GLuint v2, GLuint v3); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UIVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UIVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UIVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UIVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLuint *value); +typedef void (APIENTRYP PFNGLNAMEDBUFFERDATAEXTPROC) (GLuint buffer, GLsizeiptr size, const GLvoid *data, GLenum usage); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSUBDATAEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, const GLvoid *data); +typedef GLvoid* (APIENTRYP PFNGLMAPNAMEDBUFFEREXTPROC) (GLuint buffer, GLenum access); +typedef GLboolean (APIENTRYP PFNGLUNMAPNAMEDBUFFEREXTPROC) (GLuint buffer); +typedef GLvoid* (APIENTRYP PFNGLMAPNAMEDBUFFERRANGEEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length, GLbitfield access); +typedef void (APIENTRYP PFNGLFLUSHMAPPEDNAMEDBUFFERRANGEEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length); +typedef void (APIENTRYP PFNGLNAMEDCOPYBUFFERSUBDATAEXTPROC) (GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPARAMETERIVEXTPROC) (GLuint buffer, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPOINTERVEXTPROC) (GLuint buffer, GLenum pname, GLvoid* *params); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERSUBDATAEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, GLvoid *data); +typedef void (APIENTRYP PFNGLTEXTUREBUFFEREXTPROC) (GLuint texture, GLenum target, GLenum internalformat, GLuint buffer); +typedef void (APIENTRYP PFNGLMULTITEXBUFFEREXTPROC) (GLenum texunit, GLenum target, GLenum internalformat, GLuint buffer); +typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEEXTPROC) (GLuint renderbuffer, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETNAMEDRENDERBUFFERPARAMETERIVEXTPROC) (GLuint renderbuffer, GLenum pname, GLint *params); +typedef GLenum (APIENTRYP PFNGLCHECKNAMEDFRAMEBUFFERSTATUSEXTPROC) (GLuint framebuffer, GLenum target); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTURE1DEXTPROC) (GLuint framebuffer, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTURE2DEXTPROC) (GLuint framebuffer, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTURE3DEXTPROC) (GLuint framebuffer, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERRENDERBUFFEREXTPROC) (GLuint framebuffer, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLGETNAMEDFRAMEBUFFERATTACHMENTPARAMETERIVEXTPROC) (GLuint framebuffer, GLenum attachment, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGENERATETEXTUREMIPMAPEXTPROC) (GLuint texture, GLenum target); +typedef void (APIENTRYP PFNGLGENERATEMULTITEXMIPMAPEXTPROC) (GLenum texunit, GLenum target); +typedef void (APIENTRYP PFNGLFRAMEBUFFERDRAWBUFFEREXTPROC) (GLuint framebuffer, GLenum mode); +typedef void (APIENTRYP PFNGLFRAMEBUFFERDRAWBUFFERSEXTPROC) (GLuint framebuffer, GLsizei n, const GLenum *bufs); +typedef void (APIENTRYP PFNGLFRAMEBUFFERREADBUFFEREXTPROC) (GLuint framebuffer, GLenum mode); +typedef void (APIENTRYP PFNGLGETFRAMEBUFFERPARAMETERIVEXTPROC) (GLuint framebuffer, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLEEXTPROC) (GLuint renderbuffer, GLsizei samples, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLECOVERAGEEXTPROC) (GLuint renderbuffer, GLsizei coverageSamples, GLsizei colorSamples, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTUREEXTPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTURELAYEREXTPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLint layer); +typedef void (APIENTRYP PFNGLNAMEDFRAMEBUFFERTEXTUREFACEEXTPROC) (GLuint framebuffer, GLenum attachment, GLuint texture, GLint level, GLenum face); +typedef void (APIENTRYP PFNGLTEXTURERENDERBUFFEREXTPROC) (GLuint texture, GLenum target, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLMULTITEXRENDERBUFFEREXTPROC) (GLenum texunit, GLenum target, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1DEXTPROC) (GLuint program, GLint location, GLdouble x); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2DEXTPROC) (GLuint program, GLint location, GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3DEXTPROC) (GLuint program, GLint location, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4DEXTPROC) (GLuint program, GLint location, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1DVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2DVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3DVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4DVEXTPROC) (GLuint program, GLint location, GLsizei count, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X3DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX2X4DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X2DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX3X4DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X2DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMMATRIX4X3DVEXTPROC) (GLuint program, GLint location, GLsizei count, GLboolean transpose, const GLdouble *value); +#endif + +#ifndef GL_EXT_vertex_array_bgra +#define GL_EXT_vertex_array_bgra 1 +#endif + +#ifndef GL_EXT_texture_swizzle +#define GL_EXT_texture_swizzle 1 +#endif + +#ifndef GL_NV_explicit_multisample +#define GL_NV_explicit_multisample 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetMultisamplefvNV (GLenum pname, GLuint index, GLfloat *val); +GLAPI void APIENTRY glSampleMaskIndexedNV (GLuint index, GLbitfield mask); +GLAPI void APIENTRY glTexRenderbufferNV (GLenum target, GLuint renderbuffer); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGETMULTISAMPLEFVNVPROC) (GLenum pname, GLuint index, GLfloat *val); +typedef void (APIENTRYP PFNGLSAMPLEMASKINDEXEDNVPROC) (GLuint index, GLbitfield mask); +typedef void (APIENTRYP PFNGLTEXRENDERBUFFERNVPROC) (GLenum target, GLuint renderbuffer); +#endif + +#ifndef GL_NV_transform_feedback2 +#define GL_NV_transform_feedback2 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBindTransformFeedbackNV (GLenum target, GLuint id); +GLAPI void APIENTRY glDeleteTransformFeedbacksNV (GLsizei n, const GLuint *ids); +GLAPI void APIENTRY glGenTransformFeedbacksNV (GLsizei n, GLuint *ids); +GLAPI GLboolean APIENTRY glIsTransformFeedbackNV (GLuint id); +GLAPI void APIENTRY glPauseTransformFeedbackNV (void); +GLAPI void APIENTRY glResumeTransformFeedbackNV (void); +GLAPI void APIENTRY glDrawTransformFeedbackNV (GLenum mode, GLuint id); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBINDTRANSFORMFEEDBACKNVPROC) (GLenum target, GLuint id); +typedef void (APIENTRYP PFNGLDELETETRANSFORMFEEDBACKSNVPROC) (GLsizei n, const GLuint *ids); +typedef void (APIENTRYP PFNGLGENTRANSFORMFEEDBACKSNVPROC) (GLsizei n, GLuint *ids); +typedef GLboolean (APIENTRYP PFNGLISTRANSFORMFEEDBACKNVPROC) (GLuint id); +typedef void (APIENTRYP PFNGLPAUSETRANSFORMFEEDBACKNVPROC) (void); +typedef void (APIENTRYP PFNGLRESUMETRANSFORMFEEDBACKNVPROC) (void); +typedef void (APIENTRYP PFNGLDRAWTRANSFORMFEEDBACKNVPROC) (GLenum mode, GLuint id); +#endif + +#ifndef GL_ATI_meminfo +#define GL_ATI_meminfo 1 +#endif + +#ifndef GL_AMD_performance_monitor +#define GL_AMD_performance_monitor 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetPerfMonitorGroupsAMD (GLint *numGroups, GLsizei groupsSize, GLuint *groups); +GLAPI void APIENTRY glGetPerfMonitorCountersAMD (GLuint group, GLint *numCounters, GLint *maxActiveCounters, GLsizei counterSize, GLuint *counters); +GLAPI void APIENTRY glGetPerfMonitorGroupStringAMD (GLuint group, GLsizei bufSize, GLsizei *length, GLchar *groupString); +GLAPI void APIENTRY glGetPerfMonitorCounterStringAMD (GLuint group, GLuint counter, GLsizei bufSize, GLsizei *length, GLchar *counterString); +GLAPI void APIENTRY glGetPerfMonitorCounterInfoAMD (GLuint group, GLuint counter, GLenum pname, GLvoid *data); +GLAPI void APIENTRY glGenPerfMonitorsAMD (GLsizei n, GLuint *monitors); +GLAPI void APIENTRY glDeletePerfMonitorsAMD (GLsizei n, GLuint *monitors); +GLAPI void APIENTRY glSelectPerfMonitorCountersAMD (GLuint monitor, GLboolean enable, GLuint group, GLint numCounters, GLuint *counterList); +GLAPI void APIENTRY glBeginPerfMonitorAMD (GLuint monitor); +GLAPI void APIENTRY glEndPerfMonitorAMD (GLuint monitor); +GLAPI void APIENTRY glGetPerfMonitorCounterDataAMD (GLuint monitor, GLenum pname, GLsizei dataSize, GLuint *data, GLint *bytesWritten); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGETPERFMONITORGROUPSAMDPROC) (GLint *numGroups, GLsizei groupsSize, GLuint *groups); +typedef void (APIENTRYP PFNGLGETPERFMONITORCOUNTERSAMDPROC) (GLuint group, GLint *numCounters, GLint *maxActiveCounters, GLsizei counterSize, GLuint *counters); +typedef void (APIENTRYP PFNGLGETPERFMONITORGROUPSTRINGAMDPROC) (GLuint group, GLsizei bufSize, GLsizei *length, GLchar *groupString); +typedef void (APIENTRYP PFNGLGETPERFMONITORCOUNTERSTRINGAMDPROC) (GLuint group, GLuint counter, GLsizei bufSize, GLsizei *length, GLchar *counterString); +typedef void (APIENTRYP PFNGLGETPERFMONITORCOUNTERINFOAMDPROC) (GLuint group, GLuint counter, GLenum pname, GLvoid *data); +typedef void (APIENTRYP PFNGLGENPERFMONITORSAMDPROC) (GLsizei n, GLuint *monitors); +typedef void (APIENTRYP PFNGLDELETEPERFMONITORSAMDPROC) (GLsizei n, GLuint *monitors); +typedef void (APIENTRYP PFNGLSELECTPERFMONITORCOUNTERSAMDPROC) (GLuint monitor, GLboolean enable, GLuint group, GLint numCounters, GLuint *counterList); +typedef void (APIENTRYP PFNGLBEGINPERFMONITORAMDPROC) (GLuint monitor); +typedef void (APIENTRYP PFNGLENDPERFMONITORAMDPROC) (GLuint monitor); +typedef void (APIENTRYP PFNGLGETPERFMONITORCOUNTERDATAAMDPROC) (GLuint monitor, GLenum pname, GLsizei dataSize, GLuint *data, GLint *bytesWritten); +#endif + +#ifndef GL_AMD_texture_texture4 +#define GL_AMD_texture_texture4 1 +#endif + +#ifndef GL_AMD_vertex_shader_tesselator +#define GL_AMD_vertex_shader_tesselator 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTessellationFactorAMD (GLfloat factor); +GLAPI void APIENTRY glTessellationModeAMD (GLenum mode); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTESSELLATIONFACTORAMDPROC) (GLfloat factor); +typedef void (APIENTRYP PFNGLTESSELLATIONMODEAMDPROC) (GLenum mode); +#endif + +#ifndef GL_EXT_provoking_vertex +#define GL_EXT_provoking_vertex 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glProvokingVertexEXT (GLenum mode); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPROVOKINGVERTEXEXTPROC) (GLenum mode); +#endif + +#ifndef GL_EXT_texture_snorm +#define GL_EXT_texture_snorm 1 +#endif + +#ifndef GL_AMD_draw_buffers_blend +#define GL_AMD_draw_buffers_blend 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendFuncIndexedAMD (GLuint buf, GLenum src, GLenum dst); +GLAPI void APIENTRY glBlendFuncSeparateIndexedAMD (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); +GLAPI void APIENTRY glBlendEquationIndexedAMD (GLuint buf, GLenum mode); +GLAPI void APIENTRY glBlendEquationSeparateIndexedAMD (GLuint buf, GLenum modeRGB, GLenum modeAlpha); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBLENDFUNCINDEXEDAMDPROC) (GLuint buf, GLenum src, GLenum dst); +typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEINDEXEDAMDPROC) (GLuint buf, GLenum srcRGB, GLenum dstRGB, GLenum srcAlpha, GLenum dstAlpha); +typedef void (APIENTRYP PFNGLBLENDEQUATIONINDEXEDAMDPROC) (GLuint buf, GLenum mode); +typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEINDEXEDAMDPROC) (GLuint buf, GLenum modeRGB, GLenum modeAlpha); +#endif + +#ifndef GL_APPLE_texture_range +#define GL_APPLE_texture_range 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTextureRangeAPPLE (GLenum target, GLsizei length, const GLvoid *pointer); +GLAPI void APIENTRY glGetTexParameterPointervAPPLE (GLenum target, GLenum pname, GLvoid* *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTEXTURERANGEAPPLEPROC) (GLenum target, GLsizei length, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLGETTEXPARAMETERPOINTERVAPPLEPROC) (GLenum target, GLenum pname, GLvoid* *params); +#endif + +#ifndef GL_APPLE_float_pixels +#define GL_APPLE_float_pixels 1 +#endif + +#ifndef GL_APPLE_vertex_program_evaluators +#define GL_APPLE_vertex_program_evaluators 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glEnableVertexAttribAPPLE (GLuint index, GLenum pname); +GLAPI void APIENTRY glDisableVertexAttribAPPLE (GLuint index, GLenum pname); +GLAPI GLboolean APIENTRY glIsVertexAttribEnabledAPPLE (GLuint index, GLenum pname); +GLAPI void APIENTRY glMapVertexAttrib1dAPPLE (GLuint index, GLuint size, GLdouble u1, GLdouble u2, GLint stride, GLint order, const GLdouble *points); +GLAPI void APIENTRY glMapVertexAttrib1fAPPLE (GLuint index, GLuint size, GLfloat u1, GLfloat u2, GLint stride, GLint order, const GLfloat *points); +GLAPI void APIENTRY glMapVertexAttrib2dAPPLE (GLuint index, GLuint size, GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, const GLdouble *points); +GLAPI void APIENTRY glMapVertexAttrib2fAPPLE (GLuint index, GLuint size, GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, const GLfloat *points); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLENABLEVERTEXATTRIBAPPLEPROC) (GLuint index, GLenum pname); +typedef void (APIENTRYP PFNGLDISABLEVERTEXATTRIBAPPLEPROC) (GLuint index, GLenum pname); +typedef GLboolean (APIENTRYP PFNGLISVERTEXATTRIBENABLEDAPPLEPROC) (GLuint index, GLenum pname); +typedef void (APIENTRYP PFNGLMAPVERTEXATTRIB1DAPPLEPROC) (GLuint index, GLuint size, GLdouble u1, GLdouble u2, GLint stride, GLint order, const GLdouble *points); +typedef void (APIENTRYP PFNGLMAPVERTEXATTRIB1FAPPLEPROC) (GLuint index, GLuint size, GLfloat u1, GLfloat u2, GLint stride, GLint order, const GLfloat *points); +typedef void (APIENTRYP PFNGLMAPVERTEXATTRIB2DAPPLEPROC) (GLuint index, GLuint size, GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, const GLdouble *points); +typedef void (APIENTRYP PFNGLMAPVERTEXATTRIB2FAPPLEPROC) (GLuint index, GLuint size, GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, const GLfloat *points); +#endif + +#ifndef GL_APPLE_aux_depth_stencil +#define GL_APPLE_aux_depth_stencil 1 +#endif + +#ifndef GL_APPLE_object_purgeable +#define GL_APPLE_object_purgeable 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLenum APIENTRY glObjectPurgeableAPPLE (GLenum objectType, GLuint name, GLenum option); +GLAPI GLenum APIENTRY glObjectUnpurgeableAPPLE (GLenum objectType, GLuint name, GLenum option); +GLAPI void APIENTRY glGetObjectParameterivAPPLE (GLenum objectType, GLuint name, GLenum pname, GLint *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef GLenum (APIENTRYP PFNGLOBJECTPURGEABLEAPPLEPROC) (GLenum objectType, GLuint name, GLenum option); +typedef GLenum (APIENTRYP PFNGLOBJECTUNPURGEABLEAPPLEPROC) (GLenum objectType, GLuint name, GLenum option); +typedef void (APIENTRYP PFNGLGETOBJECTPARAMETERIVAPPLEPROC) (GLenum objectType, GLuint name, GLenum pname, GLint *params); +#endif + +#ifndef GL_APPLE_row_bytes +#define GL_APPLE_row_bytes 1 +#endif + +#ifndef GL_APPLE_rgb_422 +#define GL_APPLE_rgb_422 1 +#endif + +#ifndef GL_NV_video_capture +#define GL_NV_video_capture 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBeginVideoCaptureNV (GLuint video_capture_slot); +GLAPI void APIENTRY glBindVideoCaptureStreamBufferNV (GLuint video_capture_slot, GLuint stream, GLenum frame_region, GLintptrARB offset); +GLAPI void APIENTRY glBindVideoCaptureStreamTextureNV (GLuint video_capture_slot, GLuint stream, GLenum frame_region, GLenum target, GLuint texture); +GLAPI void APIENTRY glEndVideoCaptureNV (GLuint video_capture_slot); +GLAPI void APIENTRY glGetVideoCaptureivNV (GLuint video_capture_slot, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetVideoCaptureStreamivNV (GLuint video_capture_slot, GLuint stream, GLenum pname, GLint *params); +GLAPI void APIENTRY glGetVideoCaptureStreamfvNV (GLuint video_capture_slot, GLuint stream, GLenum pname, GLfloat *params); +GLAPI void APIENTRY glGetVideoCaptureStreamdvNV (GLuint video_capture_slot, GLuint stream, GLenum pname, GLdouble *params); +GLAPI GLenum APIENTRY glVideoCaptureNV (GLuint video_capture_slot, GLuint *sequence_num, GLuint64EXT *capture_time); +GLAPI void APIENTRY glVideoCaptureStreamParameterivNV (GLuint video_capture_slot, GLuint stream, GLenum pname, const GLint *params); +GLAPI void APIENTRY glVideoCaptureStreamParameterfvNV (GLuint video_capture_slot, GLuint stream, GLenum pname, const GLfloat *params); +GLAPI void APIENTRY glVideoCaptureStreamParameterdvNV (GLuint video_capture_slot, GLuint stream, GLenum pname, const GLdouble *params); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBEGINVIDEOCAPTURENVPROC) (GLuint video_capture_slot); +typedef void (APIENTRYP PFNGLBINDVIDEOCAPTURESTREAMBUFFERNVPROC) (GLuint video_capture_slot, GLuint stream, GLenum frame_region, GLintptrARB offset); +typedef void (APIENTRYP PFNGLBINDVIDEOCAPTURESTREAMTEXTURENVPROC) (GLuint video_capture_slot, GLuint stream, GLenum frame_region, GLenum target, GLuint texture); +typedef void (APIENTRYP PFNGLENDVIDEOCAPTURENVPROC) (GLuint video_capture_slot); +typedef void (APIENTRYP PFNGLGETVIDEOCAPTUREIVNVPROC) (GLuint video_capture_slot, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVIDEOCAPTURESTREAMIVNVPROC) (GLuint video_capture_slot, GLuint stream, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVIDEOCAPTURESTREAMFVNVPROC) (GLuint video_capture_slot, GLuint stream, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETVIDEOCAPTURESTREAMDVNVPROC) (GLuint video_capture_slot, GLuint stream, GLenum pname, GLdouble *params); +typedef GLenum (APIENTRYP PFNGLVIDEOCAPTURENVPROC) (GLuint video_capture_slot, GLuint *sequence_num, GLuint64EXT *capture_time); +typedef void (APIENTRYP PFNGLVIDEOCAPTURESTREAMPARAMETERIVNVPROC) (GLuint video_capture_slot, GLuint stream, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLVIDEOCAPTURESTREAMPARAMETERFVNVPROC) (GLuint video_capture_slot, GLuint stream, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLVIDEOCAPTURESTREAMPARAMETERDVNVPROC) (GLuint video_capture_slot, GLuint stream, GLenum pname, const GLdouble *params); +#endif + +#ifndef GL_NV_copy_image +#define GL_NV_copy_image 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCopyImageSubDataNV (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei width, GLsizei height, GLsizei depth); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCOPYIMAGESUBDATANVPROC) (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei width, GLsizei height, GLsizei depth); +#endif + +#ifndef GL_EXT_separate_shader_objects +#define GL_EXT_separate_shader_objects 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glUseShaderProgramEXT (GLenum type, GLuint program); +GLAPI void APIENTRY glActiveProgramEXT (GLuint program); +GLAPI GLuint APIENTRY glCreateShaderProgramEXT (GLenum type, const GLchar *string); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLUSESHADERPROGRAMEXTPROC) (GLenum type, GLuint program); +typedef void (APIENTRYP PFNGLACTIVEPROGRAMEXTPROC) (GLuint program); +typedef GLuint (APIENTRYP PFNGLCREATESHADERPROGRAMEXTPROC) (GLenum type, const GLchar *string); +#endif + +#ifndef GL_NV_parameter_buffer_object2 +#define GL_NV_parameter_buffer_object2 1 +#endif + +#ifndef GL_NV_shader_buffer_load +#define GL_NV_shader_buffer_load 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMakeBufferResidentNV (GLenum target, GLenum access); +GLAPI void APIENTRY glMakeBufferNonResidentNV (GLenum target); +GLAPI GLboolean APIENTRY glIsBufferResidentNV (GLenum target); +GLAPI void APIENTRY glMakeNamedBufferResidentNV (GLuint buffer, GLenum access); +GLAPI void APIENTRY glMakeNamedBufferNonResidentNV (GLuint buffer); +GLAPI GLboolean APIENTRY glIsNamedBufferResidentNV (GLuint buffer); +GLAPI void APIENTRY glGetBufferParameterui64vNV (GLenum target, GLenum pname, GLuint64EXT *params); +GLAPI void APIENTRY glGetNamedBufferParameterui64vNV (GLuint buffer, GLenum pname, GLuint64EXT *params); +GLAPI void APIENTRY glGetIntegerui64vNV (GLenum value, GLuint64EXT *result); +GLAPI void APIENTRY glUniformui64NV (GLint location, GLuint64EXT value); +GLAPI void APIENTRY glUniformui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glGetUniformui64vNV (GLuint program, GLint location, GLuint64EXT *params); +GLAPI void APIENTRY glProgramUniformui64NV (GLuint program, GLint location, GLuint64EXT value); +GLAPI void APIENTRY glProgramUniformui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLMAKEBUFFERRESIDENTNVPROC) (GLenum target, GLenum access); +typedef void (APIENTRYP PFNGLMAKEBUFFERNONRESIDENTNVPROC) (GLenum target); +typedef GLboolean (APIENTRYP PFNGLISBUFFERRESIDENTNVPROC) (GLenum target); +typedef void (APIENTRYP PFNGLMAKENAMEDBUFFERRESIDENTNVPROC) (GLuint buffer, GLenum access); +typedef void (APIENTRYP PFNGLMAKENAMEDBUFFERNONRESIDENTNVPROC) (GLuint buffer); +typedef GLboolean (APIENTRYP PFNGLISNAMEDBUFFERRESIDENTNVPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERUI64VNVPROC) (GLenum target, GLenum pname, GLuint64EXT *params); +typedef void (APIENTRYP PFNGLGETNAMEDBUFFERPARAMETERUI64VNVPROC) (GLuint buffer, GLenum pname, GLuint64EXT *params); +typedef void (APIENTRYP PFNGLGETINTEGERUI64VNVPROC) (GLenum value, GLuint64EXT *result); +typedef void (APIENTRYP PFNGLUNIFORMUI64NVPROC) (GLint location, GLuint64EXT value); +typedef void (APIENTRYP PFNGLUNIFORMUI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLGETUNIFORMUI64VNVPROC) (GLuint program, GLint location, GLuint64EXT *params); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMUI64NVPROC) (GLuint program, GLint location, GLuint64EXT value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORMUI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +#endif + +#ifndef GL_NV_vertex_buffer_unified_memory +#define GL_NV_vertex_buffer_unified_memory 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBufferAddressRangeNV (GLenum pname, GLuint index, GLuint64EXT address, GLsizeiptr length); +GLAPI void APIENTRY glVertexFormatNV (GLint size, GLenum type, GLsizei stride); +GLAPI void APIENTRY glNormalFormatNV (GLenum type, GLsizei stride); +GLAPI void APIENTRY glColorFormatNV (GLint size, GLenum type, GLsizei stride); +GLAPI void APIENTRY glIndexFormatNV (GLenum type, GLsizei stride); +GLAPI void APIENTRY glTexCoordFormatNV (GLint size, GLenum type, GLsizei stride); +GLAPI void APIENTRY glEdgeFlagFormatNV (GLsizei stride); +GLAPI void APIENTRY glSecondaryColorFormatNV (GLint size, GLenum type, GLsizei stride); +GLAPI void APIENTRY glFogCoordFormatNV (GLenum type, GLsizei stride); +GLAPI void APIENTRY glVertexAttribFormatNV (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride); +GLAPI void APIENTRY glVertexAttribIFormatNV (GLuint index, GLint size, GLenum type, GLsizei stride); +GLAPI void APIENTRY glGetIntegerui64i_vNV (GLenum value, GLuint index, GLuint64EXT *result); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBUFFERADDRESSRANGENVPROC) (GLenum pname, GLuint index, GLuint64EXT address, GLsizeiptr length); +typedef void (APIENTRYP PFNGLVERTEXFORMATNVPROC) (GLint size, GLenum type, GLsizei stride); +typedef void (APIENTRYP PFNGLNORMALFORMATNVPROC) (GLenum type, GLsizei stride); +typedef void (APIENTRYP PFNGLCOLORFORMATNVPROC) (GLint size, GLenum type, GLsizei stride); +typedef void (APIENTRYP PFNGLINDEXFORMATNVPROC) (GLenum type, GLsizei stride); +typedef void (APIENTRYP PFNGLTEXCOORDFORMATNVPROC) (GLint size, GLenum type, GLsizei stride); +typedef void (APIENTRYP PFNGLEDGEFLAGFORMATNVPROC) (GLsizei stride); +typedef void (APIENTRYP PFNGLSECONDARYCOLORFORMATNVPROC) (GLint size, GLenum type, GLsizei stride); +typedef void (APIENTRYP PFNGLFOGCOORDFORMATNVPROC) (GLenum type, GLsizei stride); +typedef void (APIENTRYP PFNGLVERTEXATTRIBFORMATNVPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride); +typedef void (APIENTRYP PFNGLVERTEXATTRIBIFORMATNVPROC) (GLuint index, GLint size, GLenum type, GLsizei stride); +typedef void (APIENTRYP PFNGLGETINTEGERUI64I_VNVPROC) (GLenum value, GLuint index, GLuint64EXT *result); +#endif + +#ifndef GL_NV_texture_barrier +#define GL_NV_texture_barrier 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTextureBarrierNV (void); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTEXTUREBARRIERNVPROC) (void); +#endif + +#ifndef GL_AMD_shader_stencil_export +#define GL_AMD_shader_stencil_export 1 +#endif + +#ifndef GL_AMD_seamless_cubemap_per_texture +#define GL_AMD_seamless_cubemap_per_texture 1 +#endif + +#ifndef GL_AMD_conservative_depth +#define GL_AMD_conservative_depth 1 +#endif + +#ifndef GL_EXT_shader_image_load_store +#define GL_EXT_shader_image_load_store 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBindImageTextureEXT (GLuint index, GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum access, GLint format); +GLAPI void APIENTRY glMemoryBarrierEXT (GLbitfield barriers); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBINDIMAGETEXTUREEXTPROC) (GLuint index, GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum access, GLint format); +typedef void (APIENTRYP PFNGLMEMORYBARRIEREXTPROC) (GLbitfield barriers); +#endif + +#ifndef GL_EXT_vertex_attrib_64bit +#define GL_EXT_vertex_attrib_64bit 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexAttribL1dEXT (GLuint index, GLdouble x); +GLAPI void APIENTRY glVertexAttribL2dEXT (GLuint index, GLdouble x, GLdouble y); +GLAPI void APIENTRY glVertexAttribL3dEXT (GLuint index, GLdouble x, GLdouble y, GLdouble z); +GLAPI void APIENTRY glVertexAttribL4dEXT (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +GLAPI void APIENTRY glVertexAttribL1dvEXT (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribL2dvEXT (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribL3dvEXT (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribL4dvEXT (GLuint index, const GLdouble *v); +GLAPI void APIENTRY glVertexAttribLPointerEXT (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +GLAPI void APIENTRY glGetVertexAttribLdvEXT (GLuint index, GLenum pname, GLdouble *params); +GLAPI void APIENTRY glVertexArrayVertexAttribLOffsetEXT (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLsizei stride, GLintptr offset); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1DEXTPROC) (GLuint index, GLdouble x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL2DEXTPROC) (GLuint index, GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL3DEXTPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL4DEXTPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1DVEXTPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL2DVEXTPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL3DVEXTPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL4DVEXTPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBLPOINTEREXTPROC) (GLuint index, GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBLDVEXTPROC) (GLuint index, GLenum pname, GLdouble *params); +typedef void (APIENTRYP PFNGLVERTEXARRAYVERTEXATTRIBLOFFSETEXTPROC) (GLuint vaobj, GLuint buffer, GLuint index, GLint size, GLenum type, GLsizei stride, GLintptr offset); +#endif + +#ifndef GL_NV_gpu_program5 +#define GL_NV_gpu_program5 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glProgramSubroutineParametersuivNV (GLenum target, GLsizei count, const GLuint *params); +GLAPI void APIENTRY glGetProgramSubroutineParameteruivNV (GLenum target, GLuint index, GLuint *param); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPROGRAMSUBROUTINEPARAMETERSUIVNVPROC) (GLenum target, GLsizei count, const GLuint *params); +typedef void (APIENTRYP PFNGLGETPROGRAMSUBROUTINEPARAMETERUIVNVPROC) (GLenum target, GLuint index, GLuint *param); +#endif + +#ifndef GL_NV_gpu_shader5 +#define GL_NV_gpu_shader5 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glUniform1i64NV (GLint location, GLint64EXT x); +GLAPI void APIENTRY glUniform2i64NV (GLint location, GLint64EXT x, GLint64EXT y); +GLAPI void APIENTRY glUniform3i64NV (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); +GLAPI void APIENTRY glUniform4i64NV (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +GLAPI void APIENTRY glUniform1i64vNV (GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glUniform2i64vNV (GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glUniform3i64vNV (GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glUniform4i64vNV (GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glUniform1ui64NV (GLint location, GLuint64EXT x); +GLAPI void APIENTRY glUniform2ui64NV (GLint location, GLuint64EXT x, GLuint64EXT y); +GLAPI void APIENTRY glUniform3ui64NV (GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +GLAPI void APIENTRY glUniform4ui64NV (GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +GLAPI void APIENTRY glUniform1ui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glUniform2ui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glUniform3ui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glUniform4ui64vNV (GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glGetUniformi64vNV (GLuint program, GLint location, GLint64EXT *params); +GLAPI void APIENTRY glProgramUniform1i64NV (GLuint program, GLint location, GLint64EXT x); +GLAPI void APIENTRY glProgramUniform2i64NV (GLuint program, GLint location, GLint64EXT x, GLint64EXT y); +GLAPI void APIENTRY glProgramUniform3i64NV (GLuint program, GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); +GLAPI void APIENTRY glProgramUniform4i64NV (GLuint program, GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +GLAPI void APIENTRY glProgramUniform1i64vNV (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glProgramUniform2i64vNV (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glProgramUniform3i64vNV (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glProgramUniform4i64vNV (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +GLAPI void APIENTRY glProgramUniform1ui64NV (GLuint program, GLint location, GLuint64EXT x); +GLAPI void APIENTRY glProgramUniform2ui64NV (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y); +GLAPI void APIENTRY glProgramUniform3ui64NV (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +GLAPI void APIENTRY glProgramUniform4ui64NV (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +GLAPI void APIENTRY glProgramUniform1ui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glProgramUniform2ui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glProgramUniform3ui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +GLAPI void APIENTRY glProgramUniform4ui64vNV (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLUNIFORM1I64NVPROC) (GLint location, GLint64EXT x); +typedef void (APIENTRYP PFNGLUNIFORM2I64NVPROC) (GLint location, GLint64EXT x, GLint64EXT y); +typedef void (APIENTRYP PFNGLUNIFORM3I64NVPROC) (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); +typedef void (APIENTRYP PFNGLUNIFORM4I64NVPROC) (GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +typedef void (APIENTRYP PFNGLUNIFORM1I64VNVPROC) (GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM2I64VNVPROC) (GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM3I64VNVPROC) (GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM4I64VNVPROC) (GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM1UI64NVPROC) (GLint location, GLuint64EXT x); +typedef void (APIENTRYP PFNGLUNIFORM2UI64NVPROC) (GLint location, GLuint64EXT x, GLuint64EXT y); +typedef void (APIENTRYP PFNGLUNIFORM3UI64NVPROC) (GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +typedef void (APIENTRYP PFNGLUNIFORM4UI64NVPROC) (GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +typedef void (APIENTRYP PFNGLUNIFORM1UI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM2UI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM3UI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLUNIFORM4UI64VNVPROC) (GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLGETUNIFORMI64VNVPROC) (GLuint program, GLint location, GLint64EXT *params); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1I64NVPROC) (GLuint program, GLint location, GLint64EXT x); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2I64NVPROC) (GLuint program, GLint location, GLint64EXT x, GLint64EXT y); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3I64NVPROC) (GLuint program, GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4I64NVPROC) (GLuint program, GLint location, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1I64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2I64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3I64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4I64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UI64NVPROC) (GLuint program, GLint location, GLuint64EXT x); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UI64NVPROC) (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UI64NVPROC) (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UI64NVPROC) (GLuint program, GLint location, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM1UI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM2UI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM3UI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +typedef void (APIENTRYP PFNGLPROGRAMUNIFORM4UI64VNVPROC) (GLuint program, GLint location, GLsizei count, const GLuint64EXT *value); +#endif + +#ifndef GL_NV_shader_buffer_store +#define GL_NV_shader_buffer_store 1 +#endif + +#ifndef GL_NV_tessellation_program5 +#define GL_NV_tessellation_program5 1 +#endif + +#ifndef GL_NV_vertex_attrib_integer_64bit +#define GL_NV_vertex_attrib_integer_64bit 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexAttribL1i64NV (GLuint index, GLint64EXT x); +GLAPI void APIENTRY glVertexAttribL2i64NV (GLuint index, GLint64EXT x, GLint64EXT y); +GLAPI void APIENTRY glVertexAttribL3i64NV (GLuint index, GLint64EXT x, GLint64EXT y, GLint64EXT z); +GLAPI void APIENTRY glVertexAttribL4i64NV (GLuint index, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +GLAPI void APIENTRY glVertexAttribL1i64vNV (GLuint index, const GLint64EXT *v); +GLAPI void APIENTRY glVertexAttribL2i64vNV (GLuint index, const GLint64EXT *v); +GLAPI void APIENTRY glVertexAttribL3i64vNV (GLuint index, const GLint64EXT *v); +GLAPI void APIENTRY glVertexAttribL4i64vNV (GLuint index, const GLint64EXT *v); +GLAPI void APIENTRY glVertexAttribL1ui64NV (GLuint index, GLuint64EXT x); +GLAPI void APIENTRY glVertexAttribL2ui64NV (GLuint index, GLuint64EXT x, GLuint64EXT y); +GLAPI void APIENTRY glVertexAttribL3ui64NV (GLuint index, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +GLAPI void APIENTRY glVertexAttribL4ui64NV (GLuint index, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +GLAPI void APIENTRY glVertexAttribL1ui64vNV (GLuint index, const GLuint64EXT *v); +GLAPI void APIENTRY glVertexAttribL2ui64vNV (GLuint index, const GLuint64EXT *v); +GLAPI void APIENTRY glVertexAttribL3ui64vNV (GLuint index, const GLuint64EXT *v); +GLAPI void APIENTRY glVertexAttribL4ui64vNV (GLuint index, const GLuint64EXT *v); +GLAPI void APIENTRY glGetVertexAttribLi64vNV (GLuint index, GLenum pname, GLint64EXT *params); +GLAPI void APIENTRY glGetVertexAttribLui64vNV (GLuint index, GLenum pname, GLuint64EXT *params); +GLAPI void APIENTRY glVertexAttribLFormatNV (GLuint index, GLint size, GLenum type, GLsizei stride); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1I64NVPROC) (GLuint index, GLint64EXT x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL2I64NVPROC) (GLuint index, GLint64EXT x, GLint64EXT y); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL3I64NVPROC) (GLuint index, GLint64EXT x, GLint64EXT y, GLint64EXT z); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL4I64NVPROC) (GLuint index, GLint64EXT x, GLint64EXT y, GLint64EXT z, GLint64EXT w); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1I64VNVPROC) (GLuint index, const GLint64EXT *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL2I64VNVPROC) (GLuint index, const GLint64EXT *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL3I64VNVPROC) (GLuint index, const GLint64EXT *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL4I64VNVPROC) (GLuint index, const GLint64EXT *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1UI64NVPROC) (GLuint index, GLuint64EXT x); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL2UI64NVPROC) (GLuint index, GLuint64EXT x, GLuint64EXT y); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL3UI64NVPROC) (GLuint index, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL4UI64NVPROC) (GLuint index, GLuint64EXT x, GLuint64EXT y, GLuint64EXT z, GLuint64EXT w); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL1UI64VNVPROC) (GLuint index, const GLuint64EXT *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL2UI64VNVPROC) (GLuint index, const GLuint64EXT *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL3UI64VNVPROC) (GLuint index, const GLuint64EXT *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBL4UI64VNVPROC) (GLuint index, const GLuint64EXT *v); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBLI64VNVPROC) (GLuint index, GLenum pname, GLint64EXT *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBLUI64VNVPROC) (GLuint index, GLenum pname, GLuint64EXT *params); +typedef void (APIENTRYP PFNGLVERTEXATTRIBLFORMATNVPROC) (GLuint index, GLint size, GLenum type, GLsizei stride); +#endif + +#ifndef GL_NV_multisample_coverage +#define GL_NV_multisample_coverage 1 +#endif + +#ifndef GL_AMD_name_gen_delete +#define GL_AMD_name_gen_delete 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGenNamesAMD (GLenum identifier, GLuint num, GLuint *names); +GLAPI void APIENTRY glDeleteNamesAMD (GLenum identifier, GLuint num, const GLuint *names); +GLAPI GLboolean APIENTRY glIsNameAMD (GLenum identifier, GLuint name); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGENNAMESAMDPROC) (GLenum identifier, GLuint num, GLuint *names); +typedef void (APIENTRYP PFNGLDELETENAMESAMDPROC) (GLenum identifier, GLuint num, const GLuint *names); +typedef GLboolean (APIENTRYP PFNGLISNAMEAMDPROC) (GLenum identifier, GLuint name); +#endif + +#ifndef GL_AMD_debug_output +#define GL_AMD_debug_output 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDebugMessageEnableAMD (GLenum category, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); +GLAPI void APIENTRY glDebugMessageInsertAMD (GLenum category, GLenum severity, GLuint id, GLsizei length, const GLchar *buf); +GLAPI void APIENTRY glDebugMessageCallbackAMD (GLDEBUGPROCAMD callback, GLvoid *userParam); +GLAPI GLuint APIENTRY glGetDebugMessageLogAMD (GLuint count, GLsizei bufsize, GLenum *categories, GLuint *severities, GLuint *ids, GLsizei *lengths, GLchar *message); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDEBUGMESSAGEENABLEAMDPROC) (GLenum category, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); +typedef void (APIENTRYP PFNGLDEBUGMESSAGEINSERTAMDPROC) (GLenum category, GLenum severity, GLuint id, GLsizei length, const GLchar *buf); +typedef void (APIENTRYP PFNGLDEBUGMESSAGECALLBACKAMDPROC) (GLDEBUGPROCAMD callback, GLvoid *userParam); +typedef GLuint (APIENTRYP PFNGLGETDEBUGMESSAGELOGAMDPROC) (GLuint count, GLsizei bufsize, GLenum *categories, GLuint *severities, GLuint *ids, GLsizei *lengths, GLchar *message); +#endif + +#ifndef GL_NV_vdpau_interop +#define GL_NV_vdpau_interop 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVDPAUInitNV (const GLvoid *vdpDevice, const GLvoid *getProcAddress); +GLAPI void APIENTRY glVDPAUFiniNV (void); +GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterVideoSurfaceNV (GLvoid *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); +GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterOutputSurfaceNV (GLvoid *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); +GLAPI void APIENTRY glVDPAUIsSurfaceNV (GLvdpauSurfaceNV surface); +GLAPI void APIENTRY glVDPAUUnregisterSurfaceNV (GLvdpauSurfaceNV surface); +GLAPI void APIENTRY glVDPAUGetSurfaceivNV (GLvdpauSurfaceNV surface, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values); +GLAPI void APIENTRY glVDPAUSurfaceAccessNV (GLvdpauSurfaceNV surface, GLenum access); +GLAPI void APIENTRY glVDPAUMapSurfacesNV (GLsizei numSurfaces, const GLvdpauSurfaceNV *surfaces); +GLAPI void APIENTRY glVDPAUUnmapSurfacesNV (GLsizei numSurface, const GLvdpauSurfaceNV *surfaces); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLVDPAUINITNVPROC) (const GLvoid *vdpDevice, const GLvoid *getProcAddress); +typedef void (APIENTRYP PFNGLVDPAUFININVPROC) (void); +typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTERVIDEOSURFACENVPROC) (GLvoid *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); +typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTEROUTPUTSURFACENVPROC) (GLvoid *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); +typedef void (APIENTRYP PFNGLVDPAUISSURFACENVPROC) (GLvdpauSurfaceNV surface); +typedef void (APIENTRYP PFNGLVDPAUUNREGISTERSURFACENVPROC) (GLvdpauSurfaceNV surface); +typedef void (APIENTRYP PFNGLVDPAUGETSURFACEIVNVPROC) (GLvdpauSurfaceNV surface, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values); +typedef void (APIENTRYP PFNGLVDPAUSURFACEACCESSNVPROC) (GLvdpauSurfaceNV surface, GLenum access); +typedef void (APIENTRYP PFNGLVDPAUMAPSURFACESNVPROC) (GLsizei numSurfaces, const GLvdpauSurfaceNV *surfaces); +typedef void (APIENTRYP PFNGLVDPAUUNMAPSURFACESNVPROC) (GLsizei numSurface, const GLvdpauSurfaceNV *surfaces); +#endif + +#ifndef GL_AMD_transform_feedback3_lines_triangles +#define GL_AMD_transform_feedback3_lines_triangles 1 +#endif + + +#ifdef __cplusplus +} +#endif + +#endif diff --git a/engine/inc/GL/wglext.h b/engine/inc/GL/wglext.h new file mode 100644 index 00000000..22fd372b --- /dev/null +++ b/engine/inc/GL/wglext.h @@ -0,0 +1,901 @@ +#ifndef __wglext_h_ +#define __wglext_h_ + +#ifdef __cplusplus +extern "C" { +#endif + +/* +** Copyright (c) 2007-2010 The Khronos Group Inc. +** +** Permission is hereby granted, free of charge, to any person obtaining a +** copy of this software and/or associated documentation files (the +** "Materials"), to deal in the Materials without restriction, including +** without limitation the rights to use, copy, modify, merge, publish, +** distribute, sublicense, and/or sell copies of the Materials, and to +** permit persons to whom the Materials are furnished to do so, subject to +** the following conditions: +** +** The above copyright notice and this permission notice shall be included +** in all copies or substantial portions of the Materials. +** +** THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, +** EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF +** MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. +** IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY +** CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, +** TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE +** MATERIALS OR THE USE OR OTHER DEALINGS IN THE MATERIALS. +*/ + +/* Function declaration macros - to move into glplatform.h */ + +#if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__) && !defined(__SCITECH_SNAP__) +#define WIN32_LEAN_AND_MEAN 1 +#include +#endif + +#ifndef APIENTRY +#define APIENTRY +#endif +#ifndef APIENTRYP +#define APIENTRYP APIENTRY * +#endif +#ifndef GLAPI +#define GLAPI extern +#endif + +/*************************************************************/ + +/* Header file version number */ +/* wglext.h last updated 2010/08/06 */ +/* Current version at http://www.opengl.org/registry/ */ +#define WGL_WGLEXT_VERSION 22 + +#ifndef WGL_ARB_buffer_region +#define WGL_FRONT_COLOR_BUFFER_BIT_ARB 0x00000001 +#define WGL_BACK_COLOR_BUFFER_BIT_ARB 0x00000002 +#define WGL_DEPTH_BUFFER_BIT_ARB 0x00000004 +#define WGL_STENCIL_BUFFER_BIT_ARB 0x00000008 +#endif + +#ifndef WGL_ARB_multisample +#define WGL_SAMPLE_BUFFERS_ARB 0x2041 +#define WGL_SAMPLES_ARB 0x2042 +#endif + +#ifndef WGL_ARB_extensions_string +#endif + +#ifndef WGL_ARB_pixel_format +#define WGL_NUMBER_PIXEL_FORMATS_ARB 0x2000 +#define WGL_DRAW_TO_WINDOW_ARB 0x2001 +#define WGL_DRAW_TO_BITMAP_ARB 0x2002 +#define WGL_ACCELERATION_ARB 0x2003 +#define WGL_NEED_PALETTE_ARB 0x2004 +#define WGL_NEED_SYSTEM_PALETTE_ARB 0x2005 +#define WGL_SWAP_LAYER_BUFFERS_ARB 0x2006 +#define WGL_SWAP_METHOD_ARB 0x2007 +#define WGL_NUMBER_OVERLAYS_ARB 0x2008 +#define WGL_NUMBER_UNDERLAYS_ARB 0x2009 +#define WGL_TRANSPARENT_ARB 0x200A +#define WGL_TRANSPARENT_RED_VALUE_ARB 0x2037 +#define WGL_TRANSPARENT_GREEN_VALUE_ARB 0x2038 +#define WGL_TRANSPARENT_BLUE_VALUE_ARB 0x2039 +#define WGL_TRANSPARENT_ALPHA_VALUE_ARB 0x203A +#define WGL_TRANSPARENT_INDEX_VALUE_ARB 0x203B +#define WGL_SHARE_DEPTH_ARB 0x200C +#define WGL_SHARE_STENCIL_ARB 0x200D +#define WGL_SHARE_ACCUM_ARB 0x200E +#define WGL_SUPPORT_GDI_ARB 0x200F +#define WGL_SUPPORT_OPENGL_ARB 0x2010 +#define WGL_DOUBLE_BUFFER_ARB 0x2011 +#define WGL_STEREO_ARB 0x2012 +#define WGL_PIXEL_TYPE_ARB 0x2013 +#define WGL_COLOR_BITS_ARB 0x2014 +#define WGL_RED_BITS_ARB 0x2015 +#define WGL_RED_SHIFT_ARB 0x2016 +#define WGL_GREEN_BITS_ARB 0x2017 +#define WGL_GREEN_SHIFT_ARB 0x2018 +#define WGL_BLUE_BITS_ARB 0x2019 +#define WGL_BLUE_SHIFT_ARB 0x201A +#define WGL_ALPHA_BITS_ARB 0x201B +#define WGL_ALPHA_SHIFT_ARB 0x201C +#define WGL_ACCUM_BITS_ARB 0x201D +#define WGL_ACCUM_RED_BITS_ARB 0x201E +#define WGL_ACCUM_GREEN_BITS_ARB 0x201F +#define WGL_ACCUM_BLUE_BITS_ARB 0x2020 +#define WGL_ACCUM_ALPHA_BITS_ARB 0x2021 +#define WGL_DEPTH_BITS_ARB 0x2022 +#define WGL_STENCIL_BITS_ARB 0x2023 +#define WGL_AUX_BUFFERS_ARB 0x2024 +#define WGL_NO_ACCELERATION_ARB 0x2025 +#define WGL_GENERIC_ACCELERATION_ARB 0x2026 +#define WGL_FULL_ACCELERATION_ARB 0x2027 +#define WGL_SWAP_EXCHANGE_ARB 0x2028 +#define WGL_SWAP_COPY_ARB 0x2029 +#define WGL_SWAP_UNDEFINED_ARB 0x202A +#define WGL_TYPE_RGBA_ARB 0x202B +#define WGL_TYPE_COLORINDEX_ARB 0x202C +#endif + +#ifndef WGL_ARB_make_current_read +#define ERROR_INVALID_PIXEL_TYPE_ARB 0x2043 +#define ERROR_INCOMPATIBLE_DEVICE_CONTEXTS_ARB 0x2054 +#endif + +#ifndef WGL_ARB_pbuffer +#define WGL_DRAW_TO_PBUFFER_ARB 0x202D +#define WGL_MAX_PBUFFER_PIXELS_ARB 0x202E +#define WGL_MAX_PBUFFER_WIDTH_ARB 0x202F +#define WGL_MAX_PBUFFER_HEIGHT_ARB 0x2030 +#define WGL_PBUFFER_LARGEST_ARB 0x2033 +#define WGL_PBUFFER_WIDTH_ARB 0x2034 +#define WGL_PBUFFER_HEIGHT_ARB 0x2035 +#define WGL_PBUFFER_LOST_ARB 0x2036 +#endif + +#ifndef WGL_ARB_render_texture +#define WGL_BIND_TO_TEXTURE_RGB_ARB 0x2070 +#define WGL_BIND_TO_TEXTURE_RGBA_ARB 0x2071 +#define WGL_TEXTURE_FORMAT_ARB 0x2072 +#define WGL_TEXTURE_TARGET_ARB 0x2073 +#define WGL_MIPMAP_TEXTURE_ARB 0x2074 +#define WGL_TEXTURE_RGB_ARB 0x2075 +#define WGL_TEXTURE_RGBA_ARB 0x2076 +#define WGL_NO_TEXTURE_ARB 0x2077 +#define WGL_TEXTURE_CUBE_MAP_ARB 0x2078 +#define WGL_TEXTURE_1D_ARB 0x2079 +#define WGL_TEXTURE_2D_ARB 0x207A +#define WGL_MIPMAP_LEVEL_ARB 0x207B +#define WGL_CUBE_MAP_FACE_ARB 0x207C +#define WGL_TEXTURE_CUBE_MAP_POSITIVE_X_ARB 0x207D +#define WGL_TEXTURE_CUBE_MAP_NEGATIVE_X_ARB 0x207E +#define WGL_TEXTURE_CUBE_MAP_POSITIVE_Y_ARB 0x207F +#define WGL_TEXTURE_CUBE_MAP_NEGATIVE_Y_ARB 0x2080 +#define WGL_TEXTURE_CUBE_MAP_POSITIVE_Z_ARB 0x2081 +#define WGL_TEXTURE_CUBE_MAP_NEGATIVE_Z_ARB 0x2082 +#define WGL_FRONT_LEFT_ARB 0x2083 +#define WGL_FRONT_RIGHT_ARB 0x2084 +#define WGL_BACK_LEFT_ARB 0x2085 +#define WGL_BACK_RIGHT_ARB 0x2086 +#define WGL_AUX0_ARB 0x2087 +#define WGL_AUX1_ARB 0x2088 +#define WGL_AUX2_ARB 0x2089 +#define WGL_AUX3_ARB 0x208A +#define WGL_AUX4_ARB 0x208B +#define WGL_AUX5_ARB 0x208C +#define WGL_AUX6_ARB 0x208D +#define WGL_AUX7_ARB 0x208E +#define WGL_AUX8_ARB 0x208F +#define WGL_AUX9_ARB 0x2090 +#endif + +#ifndef WGL_ARB_pixel_format_float +#define WGL_TYPE_RGBA_FLOAT_ARB 0x21A0 +#endif + +#ifndef WGL_ARB_framebuffer_sRGB +#define WGL_FRAMEBUFFER_SRGB_CAPABLE_ARB 0x20A9 +#endif + +#ifndef WGL_ARB_create_context +#define WGL_CONTEXT_DEBUG_BIT_ARB 0x00000001 +#define WGL_CONTEXT_FORWARD_COMPATIBLE_BIT_ARB 0x00000002 +#define WGL_CONTEXT_MAJOR_VERSION_ARB 0x2091 +#define WGL_CONTEXT_MINOR_VERSION_ARB 0x2092 +#define WGL_CONTEXT_LAYER_PLANE_ARB 0x2093 +#define WGL_CONTEXT_FLAGS_ARB 0x2094 +#define ERROR_INVALID_VERSION_ARB 0x2095 +#endif + +#ifndef WGL_ARB_create_context_profile +#define WGL_CONTEXT_PROFILE_MASK_ARB 0x9126 +#define WGL_CONTEXT_CORE_PROFILE_BIT_ARB 0x00000001 +#define WGL_CONTEXT_COMPATIBILITY_PROFILE_BIT_ARB 0x00000002 +#define ERROR_INVALID_PROFILE_ARB 0x2096 +#endif + +#ifndef WGL_ARB_create_context_robustness +#define WGL_CONTEXT_ROBUST_ACCESS_BIT_ARB 0x00000004 +#define WGL_LOSE_CONTEXT_ON_RESET_ARB 0x8252 +#define WGL_CONTEXT_RESET_NOTIFICATION_STRATEGY_ARB 0x8256 +#define WGL_NO_RESET_NOTIFICATION_ARB 0x8261 +#endif + +#ifndef WGL_EXT_make_current_read +#define ERROR_INVALID_PIXEL_TYPE_EXT 0x2043 +#endif + +#ifndef WGL_EXT_pixel_format +#define WGL_NUMBER_PIXEL_FORMATS_EXT 0x2000 +#define WGL_DRAW_TO_WINDOW_EXT 0x2001 +#define WGL_DRAW_TO_BITMAP_EXT 0x2002 +#define WGL_ACCELERATION_EXT 0x2003 +#define WGL_NEED_PALETTE_EXT 0x2004 +#define WGL_NEED_SYSTEM_PALETTE_EXT 0x2005 +#define WGL_SWAP_LAYER_BUFFERS_EXT 0x2006 +#define WGL_SWAP_METHOD_EXT 0x2007 +#define WGL_NUMBER_OVERLAYS_EXT 0x2008 +#define WGL_NUMBER_UNDERLAYS_EXT 0x2009 +#define WGL_TRANSPARENT_EXT 0x200A +#define WGL_TRANSPARENT_VALUE_EXT 0x200B +#define WGL_SHARE_DEPTH_EXT 0x200C +#define WGL_SHARE_STENCIL_EXT 0x200D +#define WGL_SHARE_ACCUM_EXT 0x200E +#define WGL_SUPPORT_GDI_EXT 0x200F +#define WGL_SUPPORT_OPENGL_EXT 0x2010 +#define WGL_DOUBLE_BUFFER_EXT 0x2011 +#define WGL_STEREO_EXT 0x2012 +#define WGL_PIXEL_TYPE_EXT 0x2013 +#define WGL_COLOR_BITS_EXT 0x2014 +#define WGL_RED_BITS_EXT 0x2015 +#define WGL_RED_SHIFT_EXT 0x2016 +#define WGL_GREEN_BITS_EXT 0x2017 +#define WGL_GREEN_SHIFT_EXT 0x2018 +#define WGL_BLUE_BITS_EXT 0x2019 +#define WGL_BLUE_SHIFT_EXT 0x201A +#define WGL_ALPHA_BITS_EXT 0x201B +#define WGL_ALPHA_SHIFT_EXT 0x201C +#define WGL_ACCUM_BITS_EXT 0x201D +#define WGL_ACCUM_RED_BITS_EXT 0x201E +#define WGL_ACCUM_GREEN_BITS_EXT 0x201F +#define WGL_ACCUM_BLUE_BITS_EXT 0x2020 +#define WGL_ACCUM_ALPHA_BITS_EXT 0x2021 +#define WGL_DEPTH_BITS_EXT 0x2022 +#define WGL_STENCIL_BITS_EXT 0x2023 +#define WGL_AUX_BUFFERS_EXT 0x2024 +#define WGL_NO_ACCELERATION_EXT 0x2025 +#define WGL_GENERIC_ACCELERATION_EXT 0x2026 +#define WGL_FULL_ACCELERATION_EXT 0x2027 +#define WGL_SWAP_EXCHANGE_EXT 0x2028 +#define WGL_SWAP_COPY_EXT 0x2029 +#define WGL_SWAP_UNDEFINED_EXT 0x202A +#define WGL_TYPE_RGBA_EXT 0x202B +#define WGL_TYPE_COLORINDEX_EXT 0x202C +#endif + +#ifndef WGL_EXT_pbuffer +#define WGL_DRAW_TO_PBUFFER_EXT 0x202D +#define WGL_MAX_PBUFFER_PIXELS_EXT 0x202E +#define WGL_MAX_PBUFFER_WIDTH_EXT 0x202F +#define WGL_MAX_PBUFFER_HEIGHT_EXT 0x2030 +#define WGL_OPTIMAL_PBUFFER_WIDTH_EXT 0x2031 +#define WGL_OPTIMAL_PBUFFER_HEIGHT_EXT 0x2032 +#define WGL_PBUFFER_LARGEST_EXT 0x2033 +#define WGL_PBUFFER_WIDTH_EXT 0x2034 +#define WGL_PBUFFER_HEIGHT_EXT 0x2035 +#endif + +#ifndef WGL_EXT_depth_float +#define WGL_DEPTH_FLOAT_EXT 0x2040 +#endif + +#ifndef WGL_3DFX_multisample +#define WGL_SAMPLE_BUFFERS_3DFX 0x2060 +#define WGL_SAMPLES_3DFX 0x2061 +#endif + +#ifndef WGL_EXT_multisample +#define WGL_SAMPLE_BUFFERS_EXT 0x2041 +#define WGL_SAMPLES_EXT 0x2042 +#endif + +#ifndef WGL_I3D_digital_video_control +#define WGL_DIGITAL_VIDEO_CURSOR_ALPHA_FRAMEBUFFER_I3D 0x2050 +#define WGL_DIGITAL_VIDEO_CURSOR_ALPHA_VALUE_I3D 0x2051 +#define WGL_DIGITAL_VIDEO_CURSOR_INCLUDED_I3D 0x2052 +#define WGL_DIGITAL_VIDEO_GAMMA_CORRECTED_I3D 0x2053 +#endif + +#ifndef WGL_I3D_gamma +#define WGL_GAMMA_TABLE_SIZE_I3D 0x204E +#define WGL_GAMMA_EXCLUDE_DESKTOP_I3D 0x204F +#endif + +#ifndef WGL_I3D_genlock +#define WGL_GENLOCK_SOURCE_MULTIVIEW_I3D 0x2044 +#define WGL_GENLOCK_SOURCE_EXTENAL_SYNC_I3D 0x2045 +#define WGL_GENLOCK_SOURCE_EXTENAL_FIELD_I3D 0x2046 +#define WGL_GENLOCK_SOURCE_EXTENAL_TTL_I3D 0x2047 +#define WGL_GENLOCK_SOURCE_DIGITAL_SYNC_I3D 0x2048 +#define WGL_GENLOCK_SOURCE_DIGITAL_FIELD_I3D 0x2049 +#define WGL_GENLOCK_SOURCE_EDGE_FALLING_I3D 0x204A +#define WGL_GENLOCK_SOURCE_EDGE_RISING_I3D 0x204B +#define WGL_GENLOCK_SOURCE_EDGE_BOTH_I3D 0x204C +#endif + +#ifndef WGL_I3D_image_buffer +#define WGL_IMAGE_BUFFER_MIN_ACCESS_I3D 0x00000001 +#define WGL_IMAGE_BUFFER_LOCK_I3D 0x00000002 +#endif + +#ifndef WGL_I3D_swap_frame_lock +#endif + +#ifndef WGL_NV_render_depth_texture +#define WGL_BIND_TO_TEXTURE_DEPTH_NV 0x20A3 +#define WGL_BIND_TO_TEXTURE_RECTANGLE_DEPTH_NV 0x20A4 +#define WGL_DEPTH_TEXTURE_FORMAT_NV 0x20A5 +#define WGL_TEXTURE_DEPTH_COMPONENT_NV 0x20A6 +#define WGL_DEPTH_COMPONENT_NV 0x20A7 +#endif + +#ifndef WGL_NV_render_texture_rectangle +#define WGL_BIND_TO_TEXTURE_RECTANGLE_RGB_NV 0x20A0 +#define WGL_BIND_TO_TEXTURE_RECTANGLE_RGBA_NV 0x20A1 +#define WGL_TEXTURE_RECTANGLE_NV 0x20A2 +#endif + +#ifndef WGL_ATI_pixel_format_float +#define WGL_TYPE_RGBA_FLOAT_ATI 0x21A0 +#endif + +#ifndef WGL_NV_float_buffer +#define WGL_FLOAT_COMPONENTS_NV 0x20B0 +#define WGL_BIND_TO_TEXTURE_RECTANGLE_FLOAT_R_NV 0x20B1 +#define WGL_BIND_TO_TEXTURE_RECTANGLE_FLOAT_RG_NV 0x20B2 +#define WGL_BIND_TO_TEXTURE_RECTANGLE_FLOAT_RGB_NV 0x20B3 +#define WGL_BIND_TO_TEXTURE_RECTANGLE_FLOAT_RGBA_NV 0x20B4 +#define WGL_TEXTURE_FLOAT_R_NV 0x20B5 +#define WGL_TEXTURE_FLOAT_RG_NV 0x20B6 +#define WGL_TEXTURE_FLOAT_RGB_NV 0x20B7 +#define WGL_TEXTURE_FLOAT_RGBA_NV 0x20B8 +#endif + +#ifndef WGL_3DL_stereo_control +#define WGL_STEREO_EMITTER_ENABLE_3DL 0x2055 +#define WGL_STEREO_EMITTER_DISABLE_3DL 0x2056 +#define WGL_STEREO_POLARITY_NORMAL_3DL 0x2057 +#define WGL_STEREO_POLARITY_INVERT_3DL 0x2058 +#endif + +#ifndef WGL_EXT_pixel_format_packed_float +#define WGL_TYPE_RGBA_UNSIGNED_FLOAT_EXT 0x20A8 +#endif + +#ifndef WGL_EXT_framebuffer_sRGB +#define WGL_FRAMEBUFFER_SRGB_CAPABLE_EXT 0x20A9 +#endif + +#ifndef WGL_NV_present_video +#define WGL_NUM_VIDEO_SLOTS_NV 0x20F0 +#endif + +#ifndef WGL_NV_video_out +#define WGL_BIND_TO_VIDEO_RGB_NV 0x20C0 +#define WGL_BIND_TO_VIDEO_RGBA_NV 0x20C1 +#define WGL_BIND_TO_VIDEO_RGB_AND_DEPTH_NV 0x20C2 +#define WGL_VIDEO_OUT_COLOR_NV 0x20C3 +#define WGL_VIDEO_OUT_ALPHA_NV 0x20C4 +#define WGL_VIDEO_OUT_DEPTH_NV 0x20C5 +#define WGL_VIDEO_OUT_COLOR_AND_ALPHA_NV 0x20C6 +#define WGL_VIDEO_OUT_COLOR_AND_DEPTH_NV 0x20C7 +#define WGL_VIDEO_OUT_FRAME 0x20C8 +#define WGL_VIDEO_OUT_FIELD_1 0x20C9 +#define WGL_VIDEO_OUT_FIELD_2 0x20CA +#define WGL_VIDEO_OUT_STACKED_FIELDS_1_2 0x20CB +#define WGL_VIDEO_OUT_STACKED_FIELDS_2_1 0x20CC +#endif + +#ifndef WGL_NV_swap_group +#endif + +#ifndef WGL_NV_gpu_affinity +#define WGL_ERROR_INCOMPATIBLE_AFFINITY_MASKS_NV 0x20D0 +#define WGL_ERROR_MISSING_AFFINITY_MASK_NV 0x20D1 +#endif + +#ifndef WGL_AMD_gpu_association +#define WGL_GPU_VENDOR_AMD 0x1F00 +#define WGL_GPU_RENDERER_STRING_AMD 0x1F01 +#define WGL_GPU_OPENGL_VERSION_STRING_AMD 0x1F02 +#define WGL_GPU_FASTEST_TARGET_GPUS_AMD 0x21A2 +#define WGL_GPU_RAM_AMD 0x21A3 +#define WGL_GPU_CLOCK_AMD 0x21A4 +#define WGL_GPU_NUM_PIPES_AMD 0x21A5 +#define WGL_GPU_NUM_SIMD_AMD 0x21A6 +#define WGL_GPU_NUM_RB_AMD 0x21A7 +#define WGL_GPU_NUM_SPI_AMD 0x21A8 +#endif + +#ifndef WGL_NV_video_capture +#define WGL_UNIQUE_ID_NV 0x20CE +#define WGL_NUM_VIDEO_CAPTURE_SLOTS_NV 0x20CF +#endif + +#ifndef WGL_NV_copy_image +#endif + +#ifndef WGL_NV_multisample_coverage +#define WGL_COVERAGE_SAMPLES_NV 0x2042 +#define WGL_COLOR_SAMPLES_NV 0x20B9 +#endif + +#ifndef WGL_EXT_create_context_es2_profile +#define WGL_CONTEXT_ES2_PROFILE_BIT_EXT 0x00000004 +#endif + + +/*************************************************************/ + +#ifndef WGL_ARB_pbuffer +DECLARE_HANDLE(HPBUFFERARB); +#endif +#ifndef WGL_EXT_pbuffer +DECLARE_HANDLE(HPBUFFEREXT); +#endif +#ifndef WGL_NV_present_video +DECLARE_HANDLE(HVIDEOOUTPUTDEVICENV); +#endif +#ifndef WGL_NV_video_output +DECLARE_HANDLE(HPVIDEODEV); +#endif +#ifndef WGL_NV_gpu_affinity +DECLARE_HANDLE(HPGPUNV); +DECLARE_HANDLE(HGPUNV); + +typedef struct _GPU_DEVICE { + DWORD cb; + CHAR DeviceName[32]; + CHAR DeviceString[128]; + DWORD Flags; + RECT rcVirtualScreen; +} GPU_DEVICE, *PGPU_DEVICE; +#endif +#ifndef WGL_NV_video_capture +DECLARE_HANDLE(HVIDEOINPUTDEVICENV); +#endif + +#ifndef WGL_ARB_buffer_region +#define WGL_ARB_buffer_region 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern HANDLE WINAPI wglCreateBufferRegionARB (HDC hDC, int iLayerPlane, UINT uType); +extern VOID WINAPI wglDeleteBufferRegionARB (HANDLE hRegion); +extern BOOL WINAPI wglSaveBufferRegionARB (HANDLE hRegion, int x, int y, int width, int height); +extern BOOL WINAPI wglRestoreBufferRegionARB (HANDLE hRegion, int x, int y, int width, int height, int xSrc, int ySrc); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef HANDLE (WINAPI * PFNWGLCREATEBUFFERREGIONARBPROC) (HDC hDC, int iLayerPlane, UINT uType); +typedef VOID (WINAPI * PFNWGLDELETEBUFFERREGIONARBPROC) (HANDLE hRegion); +typedef BOOL (WINAPI * PFNWGLSAVEBUFFERREGIONARBPROC) (HANDLE hRegion, int x, int y, int width, int height); +typedef BOOL (WINAPI * PFNWGLRESTOREBUFFERREGIONARBPROC) (HANDLE hRegion, int x, int y, int width, int height, int xSrc, int ySrc); +#endif + +#ifndef WGL_ARB_multisample +#define WGL_ARB_multisample 1 +#endif + +#ifndef WGL_ARB_extensions_string +#define WGL_ARB_extensions_string 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern const char * WINAPI wglGetExtensionsStringARB (HDC hdc); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef const char * (WINAPI * PFNWGLGETEXTENSIONSSTRINGARBPROC) (HDC hdc); +#endif + +#ifndef WGL_ARB_pixel_format +#define WGL_ARB_pixel_format 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern BOOL WINAPI wglGetPixelFormatAttribivARB (HDC hdc, int iPixelFormat, int iLayerPlane, UINT nAttributes, const int *piAttributes, int *piValues); +extern BOOL WINAPI wglGetPixelFormatAttribfvARB (HDC hdc, int iPixelFormat, int iLayerPlane, UINT nAttributes, const int *piAttributes, FLOAT *pfValues); +extern BOOL WINAPI wglChoosePixelFormatARB (HDC hdc, const int *piAttribIList, const FLOAT *pfAttribFList, UINT nMaxFormats, int *piFormats, UINT *nNumFormats); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef BOOL (WINAPI * PFNWGLGETPIXELFORMATATTRIBIVARBPROC) (HDC hdc, int iPixelFormat, int iLayerPlane, UINT nAttributes, const int *piAttributes, int *piValues); +typedef BOOL (WINAPI * PFNWGLGETPIXELFORMATATTRIBFVARBPROC) (HDC hdc, int iPixelFormat, int iLayerPlane, UINT nAttributes, const int *piAttributes, FLOAT *pfValues); +typedef BOOL (WINAPI * PFNWGLCHOOSEPIXELFORMATARBPROC) (HDC hdc, const int *piAttribIList, const FLOAT *pfAttribFList, UINT nMaxFormats, int *piFormats, UINT *nNumFormats); +#endif + +#ifndef WGL_ARB_make_current_read +#define WGL_ARB_make_current_read 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern BOOL WINAPI wglMakeContextCurrentARB (HDC hDrawDC, HDC hReadDC, HGLRC hglrc); +extern HDC WINAPI wglGetCurrentReadDCARB (void); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef BOOL (WINAPI * PFNWGLMAKECONTEXTCURRENTARBPROC) (HDC hDrawDC, HDC hReadDC, HGLRC hglrc); +typedef HDC (WINAPI * PFNWGLGETCURRENTREADDCARBPROC) (void); +#endif + +#ifndef WGL_ARB_pbuffer +#define WGL_ARB_pbuffer 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern HPBUFFERARB WINAPI wglCreatePbufferARB (HDC hDC, int iPixelFormat, int iWidth, int iHeight, const int *piAttribList); +extern HDC WINAPI wglGetPbufferDCARB (HPBUFFERARB hPbuffer); +extern int WINAPI wglReleasePbufferDCARB (HPBUFFERARB hPbuffer, HDC hDC); +extern BOOL WINAPI wglDestroyPbufferARB (HPBUFFERARB hPbuffer); +extern BOOL WINAPI wglQueryPbufferARB (HPBUFFERARB hPbuffer, int iAttribute, int *piValue); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef HPBUFFERARB (WINAPI * PFNWGLCREATEPBUFFERARBPROC) (HDC hDC, int iPixelFormat, int iWidth, int iHeight, const int *piAttribList); +typedef HDC (WINAPI * PFNWGLGETPBUFFERDCARBPROC) (HPBUFFERARB hPbuffer); +typedef int (WINAPI * PFNWGLRELEASEPBUFFERDCARBPROC) (HPBUFFERARB hPbuffer, HDC hDC); +typedef BOOL (WINAPI * PFNWGLDESTROYPBUFFERARBPROC) (HPBUFFERARB hPbuffer); +typedef BOOL (WINAPI * PFNWGLQUERYPBUFFERARBPROC) (HPBUFFERARB hPbuffer, int iAttribute, int *piValue); +#endif + +#ifndef WGL_ARB_render_texture +#define WGL_ARB_render_texture 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern BOOL WINAPI wglBindTexImageARB (HPBUFFERARB hPbuffer, int iBuffer); +extern BOOL WINAPI wglReleaseTexImageARB (HPBUFFERARB hPbuffer, int iBuffer); +extern BOOL WINAPI wglSetPbufferAttribARB (HPBUFFERARB hPbuffer, const int *piAttribList); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef BOOL (WINAPI * PFNWGLBINDTEXIMAGEARBPROC) (HPBUFFERARB hPbuffer, int iBuffer); +typedef BOOL (WINAPI * PFNWGLRELEASETEXIMAGEARBPROC) (HPBUFFERARB hPbuffer, int iBuffer); +typedef BOOL (WINAPI * PFNWGLSETPBUFFERATTRIBARBPROC) (HPBUFFERARB hPbuffer, const int *piAttribList); +#endif + +#ifndef WGL_ARB_pixel_format_float +#define WGL_ARB_pixel_format_float 1 +#endif + +#ifndef WGL_ARB_framebuffer_sRGB +#define WGL_ARB_framebuffer_sRGB 1 +#endif + +#ifndef WGL_ARB_create_context +#define WGL_ARB_create_context 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern HGLRC WINAPI wglCreateContextAttribsARB (HDC hDC, HGLRC hShareContext, const int *attribList); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef HGLRC (WINAPI * PFNWGLCREATECONTEXTATTRIBSARBPROC) (HDC hDC, HGLRC hShareContext, const int *attribList); +#endif + +#ifndef WGL_ARB_create_context_profile +#define WGL_ARB_create_context_profile 1 +#endif + +#ifndef WGL_ARB_create_context_robustness +#define WGL_ARB_create_context_robustness 1 +#endif + +#ifndef WGL_EXT_display_color_table +#define WGL_EXT_display_color_table 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern GLboolean WINAPI wglCreateDisplayColorTableEXT (GLushort id); +extern GLboolean WINAPI wglLoadDisplayColorTableEXT (const GLushort *table, GLuint length); +extern GLboolean WINAPI wglBindDisplayColorTableEXT (GLushort id); +extern VOID WINAPI wglDestroyDisplayColorTableEXT (GLushort id); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef GLboolean (WINAPI * PFNWGLCREATEDISPLAYCOLORTABLEEXTPROC) (GLushort id); +typedef GLboolean (WINAPI * PFNWGLLOADDISPLAYCOLORTABLEEXTPROC) (const GLushort *table, GLuint length); +typedef GLboolean (WINAPI * PFNWGLBINDDISPLAYCOLORTABLEEXTPROC) (GLushort id); +typedef VOID (WINAPI * PFNWGLDESTROYDISPLAYCOLORTABLEEXTPROC) (GLushort id); +#endif + +#ifndef WGL_EXT_extensions_string +#define WGL_EXT_extensions_string 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern const char * WINAPI wglGetExtensionsStringEXT (void); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef const char * (WINAPI * PFNWGLGETEXTENSIONSSTRINGEXTPROC) (void); +#endif + +#ifndef WGL_EXT_make_current_read +#define WGL_EXT_make_current_read 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern BOOL WINAPI wglMakeContextCurrentEXT (HDC hDrawDC, HDC hReadDC, HGLRC hglrc); +extern HDC WINAPI wglGetCurrentReadDCEXT (void); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef BOOL (WINAPI * PFNWGLMAKECONTEXTCURRENTEXTPROC) (HDC hDrawDC, HDC hReadDC, HGLRC hglrc); +typedef HDC (WINAPI * PFNWGLGETCURRENTREADDCEXTPROC) (void); +#endif + +#ifndef WGL_EXT_pbuffer +#define WGL_EXT_pbuffer 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern HPBUFFEREXT WINAPI wglCreatePbufferEXT (HDC hDC, int iPixelFormat, int iWidth, int iHeight, const int *piAttribList); +extern HDC WINAPI wglGetPbufferDCEXT (HPBUFFEREXT hPbuffer); +extern int WINAPI wglReleasePbufferDCEXT (HPBUFFEREXT hPbuffer, HDC hDC); +extern BOOL WINAPI wglDestroyPbufferEXT (HPBUFFEREXT hPbuffer); +extern BOOL WINAPI wglQueryPbufferEXT (HPBUFFEREXT hPbuffer, int iAttribute, int *piValue); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef HPBUFFEREXT (WINAPI * PFNWGLCREATEPBUFFEREXTPROC) (HDC hDC, int iPixelFormat, int iWidth, int iHeight, const int *piAttribList); +typedef HDC (WINAPI * PFNWGLGETPBUFFERDCEXTPROC) (HPBUFFEREXT hPbuffer); +typedef int (WINAPI * PFNWGLRELEASEPBUFFERDCEXTPROC) (HPBUFFEREXT hPbuffer, HDC hDC); +typedef BOOL (WINAPI * PFNWGLDESTROYPBUFFEREXTPROC) (HPBUFFEREXT hPbuffer); +typedef BOOL (WINAPI * PFNWGLQUERYPBUFFEREXTPROC) (HPBUFFEREXT hPbuffer, int iAttribute, int *piValue); +#endif + +#ifndef WGL_EXT_pixel_format +#define WGL_EXT_pixel_format 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern BOOL WINAPI wglGetPixelFormatAttribivEXT (HDC hdc, int iPixelFormat, int iLayerPlane, UINT nAttributes, int *piAttributes, int *piValues); +extern BOOL WINAPI wglGetPixelFormatAttribfvEXT (HDC hdc, int iPixelFormat, int iLayerPlane, UINT nAttributes, int *piAttributes, FLOAT *pfValues); +extern BOOL WINAPI wglChoosePixelFormatEXT (HDC hdc, const int *piAttribIList, const FLOAT *pfAttribFList, UINT nMaxFormats, int *piFormats, UINT *nNumFormats); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef BOOL (WINAPI * PFNWGLGETPIXELFORMATATTRIBIVEXTPROC) (HDC hdc, int iPixelFormat, int iLayerPlane, UINT nAttributes, int *piAttributes, int *piValues); +typedef BOOL (WINAPI * PFNWGLGETPIXELFORMATATTRIBFVEXTPROC) (HDC hdc, int iPixelFormat, int iLayerPlane, UINT nAttributes, int *piAttributes, FLOAT *pfValues); +typedef BOOL (WINAPI * PFNWGLCHOOSEPIXELFORMATEXTPROC) (HDC hdc, const int *piAttribIList, const FLOAT *pfAttribFList, UINT nMaxFormats, int *piFormats, UINT *nNumFormats); +#endif + +#ifndef WGL_EXT_swap_control +#define WGL_EXT_swap_control 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern BOOL WINAPI wglSwapIntervalEXT (int interval); +extern int WINAPI wglGetSwapIntervalEXT (void); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef BOOL (WINAPI * PFNWGLSWAPINTERVALEXTPROC) (int interval); +typedef int (WINAPI * PFNWGLGETSWAPINTERVALEXTPROC) (void); +#endif + +#ifndef WGL_EXT_depth_float +#define WGL_EXT_depth_float 1 +#endif + +#ifndef WGL_NV_vertex_array_range +#define WGL_NV_vertex_array_range 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern void* WINAPI wglAllocateMemoryNV (GLsizei size, GLfloat readfreq, GLfloat writefreq, GLfloat priority); +extern void WINAPI wglFreeMemoryNV (void *pointer); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef void* (WINAPI * PFNWGLALLOCATEMEMORYNVPROC) (GLsizei size, GLfloat readfreq, GLfloat writefreq, GLfloat priority); +typedef void (WINAPI * PFNWGLFREEMEMORYNVPROC) (void *pointer); +#endif + +#ifndef WGL_3DFX_multisample +#define WGL_3DFX_multisample 1 +#endif + +#ifndef WGL_EXT_multisample +#define WGL_EXT_multisample 1 +#endif + +#ifndef WGL_OML_sync_control +#define WGL_OML_sync_control 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern BOOL WINAPI wglGetSyncValuesOML (HDC hdc, INT64 *ust, INT64 *msc, INT64 *sbc); +extern BOOL WINAPI wglGetMscRateOML (HDC hdc, INT32 *numerator, INT32 *denominator); +extern INT64 WINAPI wglSwapBuffersMscOML (HDC hdc, INT64 target_msc, INT64 divisor, INT64 remainder); +extern INT64 WINAPI wglSwapLayerBuffersMscOML (HDC hdc, int fuPlanes, INT64 target_msc, INT64 divisor, INT64 remainder); +extern BOOL WINAPI wglWaitForMscOML (HDC hdc, INT64 target_msc, INT64 divisor, INT64 remainder, INT64 *ust, INT64 *msc, INT64 *sbc); +extern BOOL WINAPI wglWaitForSbcOML (HDC hdc, INT64 target_sbc, INT64 *ust, INT64 *msc, INT64 *sbc); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef BOOL (WINAPI * PFNWGLGETSYNCVALUESOMLPROC) (HDC hdc, INT64 *ust, INT64 *msc, INT64 *sbc); +typedef BOOL (WINAPI * PFNWGLGETMSCRATEOMLPROC) (HDC hdc, INT32 *numerator, INT32 *denominator); +typedef INT64 (WINAPI * PFNWGLSWAPBUFFERSMSCOMLPROC) (HDC hdc, INT64 target_msc, INT64 divisor, INT64 remainder); +typedef INT64 (WINAPI * PFNWGLSWAPLAYERBUFFERSMSCOMLPROC) (HDC hdc, int fuPlanes, INT64 target_msc, INT64 divisor, INT64 remainder); +typedef BOOL (WINAPI * PFNWGLWAITFORMSCOMLPROC) (HDC hdc, INT64 target_msc, INT64 divisor, INT64 remainder, INT64 *ust, INT64 *msc, INT64 *sbc); +typedef BOOL (WINAPI * PFNWGLWAITFORSBCOMLPROC) (HDC hdc, INT64 target_sbc, INT64 *ust, INT64 *msc, INT64 *sbc); +#endif + +#ifndef WGL_I3D_digital_video_control +#define WGL_I3D_digital_video_control 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern BOOL WINAPI wglGetDigitalVideoParametersI3D (HDC hDC, int iAttribute, int *piValue); +extern BOOL WINAPI wglSetDigitalVideoParametersI3D (HDC hDC, int iAttribute, const int *piValue); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef BOOL (WINAPI * PFNWGLGETDIGITALVIDEOPARAMETERSI3DPROC) (HDC hDC, int iAttribute, int *piValue); +typedef BOOL (WINAPI * PFNWGLSETDIGITALVIDEOPARAMETERSI3DPROC) (HDC hDC, int iAttribute, const int *piValue); +#endif + +#ifndef WGL_I3D_gamma +#define WGL_I3D_gamma 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern BOOL WINAPI wglGetGammaTableParametersI3D (HDC hDC, int iAttribute, int *piValue); +extern BOOL WINAPI wglSetGammaTableParametersI3D (HDC hDC, int iAttribute, const int *piValue); +extern BOOL WINAPI wglGetGammaTableI3D (HDC hDC, int iEntries, USHORT *puRed, USHORT *puGreen, USHORT *puBlue); +extern BOOL WINAPI wglSetGammaTableI3D (HDC hDC, int iEntries, const USHORT *puRed, const USHORT *puGreen, const USHORT *puBlue); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef BOOL (WINAPI * PFNWGLGETGAMMATABLEPARAMETERSI3DPROC) (HDC hDC, int iAttribute, int *piValue); +typedef BOOL (WINAPI * PFNWGLSETGAMMATABLEPARAMETERSI3DPROC) (HDC hDC, int iAttribute, const int *piValue); +typedef BOOL (WINAPI * PFNWGLGETGAMMATABLEI3DPROC) (HDC hDC, int iEntries, USHORT *puRed, USHORT *puGreen, USHORT *puBlue); +typedef BOOL (WINAPI * PFNWGLSETGAMMATABLEI3DPROC) (HDC hDC, int iEntries, const USHORT *puRed, const USHORT *puGreen, const USHORT *puBlue); +#endif + +#ifndef WGL_I3D_genlock +#define WGL_I3D_genlock 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern BOOL WINAPI wglEnableGenlockI3D (HDC hDC); +extern BOOL WINAPI wglDisableGenlockI3D (HDC hDC); +extern BOOL WINAPI wglIsEnabledGenlockI3D (HDC hDC, BOOL *pFlag); +extern BOOL WINAPI wglGenlockSourceI3D (HDC hDC, UINT uSource); +extern BOOL WINAPI wglGetGenlockSourceI3D (HDC hDC, UINT *uSource); +extern BOOL WINAPI wglGenlockSourceEdgeI3D (HDC hDC, UINT uEdge); +extern BOOL WINAPI wglGetGenlockSourceEdgeI3D (HDC hDC, UINT *uEdge); +extern BOOL WINAPI wglGenlockSampleRateI3D (HDC hDC, UINT uRate); +extern BOOL WINAPI wglGetGenlockSampleRateI3D (HDC hDC, UINT *uRate); +extern BOOL WINAPI wglGenlockSourceDelayI3D (HDC hDC, UINT uDelay); +extern BOOL WINAPI wglGetGenlockSourceDelayI3D (HDC hDC, UINT *uDelay); +extern BOOL WINAPI wglQueryGenlockMaxSourceDelayI3D (HDC hDC, UINT *uMaxLineDelay, UINT *uMaxPixelDelay); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef BOOL (WINAPI * PFNWGLENABLEGENLOCKI3DPROC) (HDC hDC); +typedef BOOL (WINAPI * PFNWGLDISABLEGENLOCKI3DPROC) (HDC hDC); +typedef BOOL (WINAPI * PFNWGLISENABLEDGENLOCKI3DPROC) (HDC hDC, BOOL *pFlag); +typedef BOOL (WINAPI * PFNWGLGENLOCKSOURCEI3DPROC) (HDC hDC, UINT uSource); +typedef BOOL (WINAPI * PFNWGLGETGENLOCKSOURCEI3DPROC) (HDC hDC, UINT *uSource); +typedef BOOL (WINAPI * PFNWGLGENLOCKSOURCEEDGEI3DPROC) (HDC hDC, UINT uEdge); +typedef BOOL (WINAPI * PFNWGLGETGENLOCKSOURCEEDGEI3DPROC) (HDC hDC, UINT *uEdge); +typedef BOOL (WINAPI * PFNWGLGENLOCKSAMPLERATEI3DPROC) (HDC hDC, UINT uRate); +typedef BOOL (WINAPI * PFNWGLGETGENLOCKSAMPLERATEI3DPROC) (HDC hDC, UINT *uRate); +typedef BOOL (WINAPI * PFNWGLGENLOCKSOURCEDELAYI3DPROC) (HDC hDC, UINT uDelay); +typedef BOOL (WINAPI * PFNWGLGETGENLOCKSOURCEDELAYI3DPROC) (HDC hDC, UINT *uDelay); +typedef BOOL (WINAPI * PFNWGLQUERYGENLOCKMAXSOURCEDELAYI3DPROC) (HDC hDC, UINT *uMaxLineDelay, UINT *uMaxPixelDelay); +#endif + +#ifndef WGL_I3D_image_buffer +#define WGL_I3D_image_buffer 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern LPVOID WINAPI wglCreateImageBufferI3D (HDC hDC, DWORD dwSize, UINT uFlags); +extern BOOL WINAPI wglDestroyImageBufferI3D (HDC hDC, LPVOID pAddress); +extern BOOL WINAPI wglAssociateImageBufferEventsI3D (HDC hDC, const HANDLE *pEvent, const LPVOID *pAddress, const DWORD *pSize, UINT count); +extern BOOL WINAPI wglReleaseImageBufferEventsI3D (HDC hDC, const LPVOID *pAddress, UINT count); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef LPVOID (WINAPI * PFNWGLCREATEIMAGEBUFFERI3DPROC) (HDC hDC, DWORD dwSize, UINT uFlags); +typedef BOOL (WINAPI * PFNWGLDESTROYIMAGEBUFFERI3DPROC) (HDC hDC, LPVOID pAddress); +typedef BOOL (WINAPI * PFNWGLASSOCIATEIMAGEBUFFEREVENTSI3DPROC) (HDC hDC, const HANDLE *pEvent, const LPVOID *pAddress, const DWORD *pSize, UINT count); +typedef BOOL (WINAPI * PFNWGLRELEASEIMAGEBUFFEREVENTSI3DPROC) (HDC hDC, const LPVOID *pAddress, UINT count); +#endif + +#ifndef WGL_I3D_swap_frame_lock +#define WGL_I3D_swap_frame_lock 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern BOOL WINAPI wglEnableFrameLockI3D (void); +extern BOOL WINAPI wglDisableFrameLockI3D (void); +extern BOOL WINAPI wglIsEnabledFrameLockI3D (BOOL *pFlag); +extern BOOL WINAPI wglQueryFrameLockMasterI3D (BOOL *pFlag); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef BOOL (WINAPI * PFNWGLENABLEFRAMELOCKI3DPROC) (void); +typedef BOOL (WINAPI * PFNWGLDISABLEFRAMELOCKI3DPROC) (void); +typedef BOOL (WINAPI * PFNWGLISENABLEDFRAMELOCKI3DPROC) (BOOL *pFlag); +typedef BOOL (WINAPI * PFNWGLQUERYFRAMELOCKMASTERI3DPROC) (BOOL *pFlag); +#endif + +#ifndef WGL_I3D_swap_frame_usage +#define WGL_I3D_swap_frame_usage 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern BOOL WINAPI wglGetFrameUsageI3D (float *pUsage); +extern BOOL WINAPI wglBeginFrameTrackingI3D (void); +extern BOOL WINAPI wglEndFrameTrackingI3D (void); +extern BOOL WINAPI wglQueryFrameTrackingI3D (DWORD *pFrameCount, DWORD *pMissedFrames, float *pLastMissedUsage); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef BOOL (WINAPI * PFNWGLGETFRAMEUSAGEI3DPROC) (float *pUsage); +typedef BOOL (WINAPI * PFNWGLBEGINFRAMETRACKINGI3DPROC) (void); +typedef BOOL (WINAPI * PFNWGLENDFRAMETRACKINGI3DPROC) (void); +typedef BOOL (WINAPI * PFNWGLQUERYFRAMETRACKINGI3DPROC) (DWORD *pFrameCount, DWORD *pMissedFrames, float *pLastMissedUsage); +#endif + +#ifndef WGL_ATI_pixel_format_float +#define WGL_ATI_pixel_format_float 1 +#endif + +#ifndef WGL_NV_float_buffer +#define WGL_NV_float_buffer 1 +#endif + +#ifndef WGL_3DL_stereo_control +#define WGL_3DL_stereo_control 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern BOOL WINAPI wglSetStereoEmitterState3DL (HDC hDC, UINT uState); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef BOOL (WINAPI * PFNWGLSETSTEREOEMITTERSTATE3DLPROC) (HDC hDC, UINT uState); +#endif + +#ifndef WGL_EXT_pixel_format_packed_float +#define WGL_EXT_pixel_format_packed_float 1 +#endif + +#ifndef WGL_EXT_framebuffer_sRGB +#define WGL_EXT_framebuffer_sRGB 1 +#endif + +#ifndef WGL_NV_present_video +#define WGL_NV_present_video 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern int WINAPI wglEnumerateVideoDevicesNV (HDC hDC, HVIDEOOUTPUTDEVICENV *phDeviceList); +extern BOOL WINAPI wglBindVideoDeviceNV (HDC hDC, unsigned int uVideoSlot, HVIDEOOUTPUTDEVICENV hVideoDevice, const int *piAttribList); +extern BOOL WINAPI wglQueryCurrentContextNV (int iAttribute, int *piValue); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef int (WINAPI * PFNWGLENUMERATEVIDEODEVICESNVPROC) (HDC hDC, HVIDEOOUTPUTDEVICENV *phDeviceList); +typedef BOOL (WINAPI * PFNWGLBINDVIDEODEVICENVPROC) (HDC hDC, unsigned int uVideoSlot, HVIDEOOUTPUTDEVICENV hVideoDevice, const int *piAttribList); +typedef BOOL (WINAPI * PFNWGLQUERYCURRENTCONTEXTNVPROC) (int iAttribute, int *piValue); +#endif + +#ifndef WGL_NV_video_output +#define WGL_NV_video_output 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern BOOL WINAPI wglGetVideoDeviceNV (HDC hDC, int numDevices, HPVIDEODEV *hVideoDevice); +extern BOOL WINAPI wglReleaseVideoDeviceNV (HPVIDEODEV hVideoDevice); +extern BOOL WINAPI wglBindVideoImageNV (HPVIDEODEV hVideoDevice, HPBUFFERARB hPbuffer, int iVideoBuffer); +extern BOOL WINAPI wglReleaseVideoImageNV (HPBUFFERARB hPbuffer, int iVideoBuffer); +extern BOOL WINAPI wglSendPbufferToVideoNV (HPBUFFERARB hPbuffer, int iBufferType, unsigned long *pulCounterPbuffer, BOOL bBlock); +extern BOOL WINAPI wglGetVideoInfoNV (HPVIDEODEV hpVideoDevice, unsigned long *pulCounterOutputPbuffer, unsigned long *pulCounterOutputVideo); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef BOOL (WINAPI * PFNWGLGETVIDEODEVICENVPROC) (HDC hDC, int numDevices, HPVIDEODEV *hVideoDevice); +typedef BOOL (WINAPI * PFNWGLRELEASEVIDEODEVICENVPROC) (HPVIDEODEV hVideoDevice); +typedef BOOL (WINAPI * PFNWGLBINDVIDEOIMAGENVPROC) (HPVIDEODEV hVideoDevice, HPBUFFERARB hPbuffer, int iVideoBuffer); +typedef BOOL (WINAPI * PFNWGLRELEASEVIDEOIMAGENVPROC) (HPBUFFERARB hPbuffer, int iVideoBuffer); +typedef BOOL (WINAPI * PFNWGLSENDPBUFFERTOVIDEONVPROC) (HPBUFFERARB hPbuffer, int iBufferType, unsigned long *pulCounterPbuffer, BOOL bBlock); +typedef BOOL (WINAPI * PFNWGLGETVIDEOINFONVPROC) (HPVIDEODEV hpVideoDevice, unsigned long *pulCounterOutputPbuffer, unsigned long *pulCounterOutputVideo); +#endif + +#ifndef WGL_NV_swap_group +#define WGL_NV_swap_group 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern BOOL WINAPI wglJoinSwapGroupNV (HDC hDC, GLuint group); +extern BOOL WINAPI wglBindSwapBarrierNV (GLuint group, GLuint barrier); +extern BOOL WINAPI wglQuerySwapGroupNV (HDC hDC, GLuint *group, GLuint *barrier); +extern BOOL WINAPI wglQueryMaxSwapGroupsNV (HDC hDC, GLuint *maxGroups, GLuint *maxBarriers); +extern BOOL WINAPI wglQueryFrameCountNV (HDC hDC, GLuint *count); +extern BOOL WINAPI wglResetFrameCountNV (HDC hDC); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef BOOL (WINAPI * PFNWGLJOINSWAPGROUPNVPROC) (HDC hDC, GLuint group); +typedef BOOL (WINAPI * PFNWGLBINDSWAPBARRIERNVPROC) (GLuint group, GLuint barrier); +typedef BOOL (WINAPI * PFNWGLQUERYSWAPGROUPNVPROC) (HDC hDC, GLuint *group, GLuint *barrier); +typedef BOOL (WINAPI * PFNWGLQUERYMAXSWAPGROUPSNVPROC) (HDC hDC, GLuint *maxGroups, GLuint *maxBarriers); +typedef BOOL (WINAPI * PFNWGLQUERYFRAMECOUNTNVPROC) (HDC hDC, GLuint *count); +typedef BOOL (WINAPI * PFNWGLRESETFRAMECOUNTNVPROC) (HDC hDC); +#endif + +#ifndef WGL_NV_gpu_affinity +#define WGL_NV_gpu_affinity 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern BOOL WINAPI wglEnumGpusNV (UINT iGpuIndex, HGPUNV *phGpu); +extern BOOL WINAPI wglEnumGpuDevicesNV (HGPUNV hGpu, UINT iDeviceIndex, PGPU_DEVICE lpGpuDevice); +extern HDC WINAPI wglCreateAffinityDCNV (const HGPUNV *phGpuList); +extern BOOL WINAPI wglEnumGpusFromAffinityDCNV (HDC hAffinityDC, UINT iGpuIndex, HGPUNV *hGpu); +extern BOOL WINAPI wglDeleteDCNV (HDC hdc); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef BOOL (WINAPI * PFNWGLENUMGPUSNVPROC) (UINT iGpuIndex, HGPUNV *phGpu); +typedef BOOL (WINAPI * PFNWGLENUMGPUDEVICESNVPROC) (HGPUNV hGpu, UINT iDeviceIndex, PGPU_DEVICE lpGpuDevice); +typedef HDC (WINAPI * PFNWGLCREATEAFFINITYDCNVPROC) (const HGPUNV *phGpuList); +typedef BOOL (WINAPI * PFNWGLENUMGPUSFROMAFFINITYDCNVPROC) (HDC hAffinityDC, UINT iGpuIndex, HGPUNV *hGpu); +typedef BOOL (WINAPI * PFNWGLDELETEDCNVPROC) (HDC hdc); +#endif + +#ifndef WGL_AMD_gpu_association +#define WGL_AMD_gpu_association 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern UINT WINAPI wglGetGPUIDsAMD (UINT maxCount, UINT *ids); +extern INT WINAPI wglGetGPUInfoAMD (UINT id, int property, GLenum dataType, UINT size, void *data); +extern UINT WINAPI wglGetContextGPUIDAMD (HGLRC hglrc); +extern HGLRC WINAPI wglCreateAssociatedContextAMD (UINT id); +extern HGLRC WINAPI wglCreateAssociatedContextAttribsAMD (UINT id, HGLRC hShareContext, const int *attribList); +extern BOOL WINAPI wglDeleteAssociatedContextAMD (HGLRC hglrc); +extern BOOL WINAPI wglMakeAssociatedContextCurrentAMD (HGLRC hglrc); +extern HGLRC WINAPI wglGetCurrentAssociatedContextAMD (void); +extern VOID WINAPI wglBlitContextFramebufferAMD (HGLRC dstCtx, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef UINT (WINAPI * PFNWGLGETGPUIDSAMDPROC) (UINT maxCount, UINT *ids); +typedef INT (WINAPI * PFNWGLGETGPUINFOAMDPROC) (UINT id, int property, GLenum dataType, UINT size, void *data); +typedef UINT (WINAPI * PFNWGLGETCONTEXTGPUIDAMDPROC) (HGLRC hglrc); +typedef HGLRC (WINAPI * PFNWGLCREATEASSOCIATEDCONTEXTAMDPROC) (UINT id); +typedef HGLRC (WINAPI * PFNWGLCREATEASSOCIATEDCONTEXTATTRIBSAMDPROC) (UINT id, HGLRC hShareContext, const int *attribList); +typedef BOOL (WINAPI * PFNWGLDELETEASSOCIATEDCONTEXTAMDPROC) (HGLRC hglrc); +typedef BOOL (WINAPI * PFNWGLMAKEASSOCIATEDCONTEXTCURRENTAMDPROC) (HGLRC hglrc); +typedef HGLRC (WINAPI * PFNWGLGETCURRENTASSOCIATEDCONTEXTAMDPROC) (void); +typedef VOID (WINAPI * PFNWGLBLITCONTEXTFRAMEBUFFERAMDPROC) (HGLRC dstCtx, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); +#endif + +#ifndef WGL_NV_video_capture +#define WGL_NV_video_capture 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern BOOL WINAPI wglBindVideoCaptureDeviceNV (UINT uVideoSlot, HVIDEOINPUTDEVICENV hDevice); +extern UINT WINAPI wglEnumerateVideoCaptureDevicesNV (HDC hDc, HVIDEOINPUTDEVICENV *phDeviceList); +extern BOOL WINAPI wglLockVideoCaptureDeviceNV (HDC hDc, HVIDEOINPUTDEVICENV hDevice); +extern BOOL WINAPI wglQueryVideoCaptureDeviceNV (HDC hDc, HVIDEOINPUTDEVICENV hDevice, int iAttribute, int *piValue); +extern BOOL WINAPI wglReleaseVideoCaptureDeviceNV (HDC hDc, HVIDEOINPUTDEVICENV hDevice); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef BOOL (WINAPI * PFNWGLBINDVIDEOCAPTUREDEVICENVPROC) (UINT uVideoSlot, HVIDEOINPUTDEVICENV hDevice); +typedef UINT (WINAPI * PFNWGLENUMERATEVIDEOCAPTUREDEVICESNVPROC) (HDC hDc, HVIDEOINPUTDEVICENV *phDeviceList); +typedef BOOL (WINAPI * PFNWGLLOCKVIDEOCAPTUREDEVICENVPROC) (HDC hDc, HVIDEOINPUTDEVICENV hDevice); +typedef BOOL (WINAPI * PFNWGLQUERYVIDEOCAPTUREDEVICENVPROC) (HDC hDc, HVIDEOINPUTDEVICENV hDevice, int iAttribute, int *piValue); +typedef BOOL (WINAPI * PFNWGLRELEASEVIDEOCAPTUREDEVICENVPROC) (HDC hDc, HVIDEOINPUTDEVICENV hDevice); +#endif + +#ifndef WGL_NV_copy_image +#define WGL_NV_copy_image 1 +#ifdef WGL_WGLEXT_PROTOTYPES +extern BOOL WINAPI wglCopyImageSubDataNV (HGLRC hSrcRC, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, HGLRC hDstRC, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei width, GLsizei height, GLsizei depth); +#endif /* WGL_WGLEXT_PROTOTYPES */ +typedef BOOL (WINAPI * PFNWGLCOPYIMAGESUBDATANVPROC) (HGLRC hSrcRC, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, HGLRC hDstRC, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei width, GLsizei height, GLsizei depth); +#endif + +#ifndef WGL_NV_multisample_coverage +#define WGL_NV_multisample_coverage 1 +#endif + + +#ifdef __cplusplus +} +#endif + +#endif diff --git a/engine/inc/GLFW/glfw3.h b/engine/inc/GLFW/glfw3.h new file mode 100644 index 00000000..95caa955 --- /dev/null +++ b/engine/inc/GLFW/glfw3.h @@ -0,0 +1,4248 @@ +/************************************************************************* + * GLFW 3.2 - www.glfw.org + * A library for OpenGL, window and input + *------------------------------------------------------------------------ + * Copyright (c) 2002-2006 Marcus Geelnard + * Copyright (c) 2006-2016 Camilla Berglund + * + * This software is provided 'as-is', without any express or implied + * warranty. In no event will the authors be held liable for any damages + * arising from the use of this software. + * + * Permission is granted to anyone to use this software for any purpose, + * including commercial applications, and to alter it and redistribute it + * freely, subject to the following restrictions: + * + * 1. The origin of this software must not be misrepresented; you must not + * claim that you wrote the original software. If you use this software + * in a product, an acknowledgment in the product documentation would + * be appreciated but is not required. + * + * 2. Altered source versions must be plainly marked as such, and must not + * be misrepresented as being the original software. + * + * 3. This notice may not be removed or altered from any source + * distribution. + * + *************************************************************************/ + +#ifndef _glfw3_h_ +#define _glfw3_h_ + +#ifdef __cplusplus +extern "C" { +#endif + + +/************************************************************************* + * Doxygen documentation + *************************************************************************/ + +/*! @file glfw3.h + * @brief The header of the GLFW 3 API. + * + * This is the header file of the GLFW 3 API. It defines all its types and + * declares all its functions. + * + * For more information about how to use this file, see @ref build_include. + */ +/*! @defgroup context Context reference + * + * This is the reference documentation for OpenGL and OpenGL ES context related + * functions. For more task-oriented information, see the @ref context_guide. + */ +/*! @defgroup vulkan Vulkan reference + * + * This is the reference documentation for Vulkan related functions and types. + * For more task-oriented information, see the @ref vulkan_guide. + */ +/*! @defgroup init Initialization, version and error reference + * + * This is the reference documentation for initialization and termination of + * the library, version management and error handling. For more task-oriented + * information, see the @ref intro_guide. + */ +/*! @defgroup input Input reference + * + * This is the reference documentation for input related functions and types. + * For more task-oriented information, see the @ref input_guide. + */ +/*! @defgroup monitor Monitor reference + * + * This is the reference documentation for monitor related functions and types. + * For more task-oriented information, see the @ref monitor_guide. + */ +/*! @defgroup window Window reference + * + * This is the reference documentation for window related functions and types, + * including creation, deletion and event polling. For more task-oriented + * information, see the @ref window_guide. + */ + + +/************************************************************************* + * Compiler- and platform-specific preprocessor work + *************************************************************************/ + +/* If we are we on Windows, we want a single define for it. + */ +#if !defined(_WIN32) && (defined(__WIN32__) || defined(WIN32) || defined(__MINGW32__)) + #define _WIN32 +#endif /* _WIN32 */ + +/* It is customary to use APIENTRY for OpenGL function pointer declarations on + * all platforms. Additionally, the Windows OpenGL header needs APIENTRY. + */ +#ifndef APIENTRY + #ifdef _WIN32 + #define APIENTRY __stdcall + #else + #define APIENTRY + #endif +#endif /* APIENTRY */ + +/* Some Windows OpenGL headers need this. + */ +#if !defined(WINGDIAPI) && defined(_WIN32) + #define WINGDIAPI __declspec(dllimport) + #define GLFW_WINGDIAPI_DEFINED +#endif /* WINGDIAPI */ + +/* Some Windows GLU headers need this. + */ +#if !defined(CALLBACK) && defined(_WIN32) + #define CALLBACK __stdcall + #define GLFW_CALLBACK_DEFINED +#endif /* CALLBACK */ + +/* Include because most Windows GLU headers need wchar_t and + * the OS X OpenGL header blocks the definition of ptrdiff_t by glext.h. + * Include it unconditionally to avoid surprising side-effects. + */ +#include + +/* Include because it is needed by Vulkan and related functions. + */ +#include + +/* Include the chosen client API headers. + */ +#if defined(__APPLE__) + #if defined(GLFW_INCLUDE_GLCOREARB) + #include + #if defined(GLFW_INCLUDE_GLEXT) + #include + #endif + #elif !defined(GLFW_INCLUDE_NONE) + #if !defined(GLFW_INCLUDE_GLEXT) + #define GL_GLEXT_LEGACY + #endif + #include + #endif + #if defined(GLFW_INCLUDE_GLU) + #include + #endif +#else + #if defined(GLFW_INCLUDE_GLCOREARB) + #include + #elif defined(GLFW_INCLUDE_ES1) + #include + #if defined(GLFW_INCLUDE_GLEXT) + #include + #endif + #elif defined(GLFW_INCLUDE_ES2) + #include + #if defined(GLFW_INCLUDE_GLEXT) + #include + #endif + #elif defined(GLFW_INCLUDE_ES3) + #include + #if defined(GLFW_INCLUDE_GLEXT) + #include + #endif + #elif defined(GLFW_INCLUDE_ES31) + #include + #if defined(GLFW_INCLUDE_GLEXT) + #include + #endif + #elif defined(GLFW_INCLUDE_VULKAN) + #include + #elif !defined(GLFW_INCLUDE_NONE) + #include + #if defined(GLFW_INCLUDE_GLEXT) + #include + #endif + #endif + #if defined(GLFW_INCLUDE_GLU) + #include + #endif +#endif + +#if defined(GLFW_DLL) && defined(_GLFW_BUILD_DLL) + /* GLFW_DLL must be defined by applications that are linking against the DLL + * version of the GLFW library. _GLFW_BUILD_DLL is defined by the GLFW + * configuration header when compiling the DLL version of the library. + */ + #error "You must not have both GLFW_DLL and _GLFW_BUILD_DLL defined" +#endif + +/* GLFWAPI is used to declare public API functions for export + * from the DLL / shared library / dynamic library. + */ +#if defined(_WIN32) && defined(_GLFW_BUILD_DLL) + /* We are building GLFW as a Win32 DLL */ + #define GLFWAPI __declspec(dllexport) +#elif defined(_WIN32) && defined(GLFW_DLL) + /* We are calling GLFW as a Win32 DLL */ + #define GLFWAPI __declspec(dllimport) +#elif defined(__GNUC__) && defined(_GLFW_BUILD_DLL) + /* We are building GLFW as a shared / dynamic library */ + #define GLFWAPI __attribute__((visibility("default"))) +#else + /* We are building or calling GLFW as a static library */ + #define GLFWAPI +#endif + + +/************************************************************************* + * GLFW API tokens + *************************************************************************/ + +/*! @name GLFW version macros + * @{ */ +/*! @brief The major version number of the GLFW library. + * + * This is incremented when the API is changed in non-compatible ways. + * @ingroup init + */ +#define GLFW_VERSION_MAJOR 3 +/*! @brief The minor version number of the GLFW library. + * + * This is incremented when features are added to the API but it remains + * backward-compatible. + * @ingroup init + */ +#define GLFW_VERSION_MINOR 2 +/*! @brief The revision number of the GLFW library. + * + * This is incremented when a bug fix release is made that does not contain any + * API changes. + * @ingroup init + */ +#define GLFW_VERSION_REVISION 1 +/*! @} */ + +/*! @name Boolean values + * @{ */ +/*! @brief One. + * + * One. Seriously. You don't _need_ to use this symbol in your code. It's + * just semantic sugar for the number 1. You can use `1` or `true` or `_True` + * or `GL_TRUE` or whatever you want. + */ +#define GLFW_TRUE 1 +/*! @brief Zero. + * + * Zero. Seriously. You don't _need_ to use this symbol in your code. It's + * just just semantic sugar for the number 0. You can use `0` or `false` or + * `_False` or `GL_FALSE` or whatever you want. + */ +#define GLFW_FALSE 0 +/*! @} */ + +/*! @name Key and button actions + * @{ */ +/*! @brief The key or mouse button was released. + * + * The key or mouse button was released. + * + * @ingroup input + */ +#define GLFW_RELEASE 0 +/*! @brief The key or mouse button was pressed. + * + * The key or mouse button was pressed. + * + * @ingroup input + */ +#define GLFW_PRESS 1 +/*! @brief The key was held down until it repeated. + * + * The key was held down until it repeated. + * + * @ingroup input + */ +#define GLFW_REPEAT 2 +/*! @} */ + +/*! @defgroup keys Keyboard keys + * + * See [key input](@ref input_key) for how these are used. + * + * These key codes are inspired by the _USB HID Usage Tables v1.12_ (p. 53-60), + * but re-arranged to map to 7-bit ASCII for printable keys (function keys are + * put in the 256+ range). + * + * The naming of the key codes follow these rules: + * - The US keyboard layout is used + * - Names of printable alpha-numeric characters are used (e.g. "A", "R", + * "3", etc.) + * - For non-alphanumeric characters, Unicode:ish names are used (e.g. + * "COMMA", "LEFT_SQUARE_BRACKET", etc.). Note that some names do not + * correspond to the Unicode standard (usually for brevity) + * - Keys that lack a clear US mapping are named "WORLD_x" + * - For non-printable keys, custom names are used (e.g. "F4", + * "BACKSPACE", etc.) + * + * @ingroup input + * @{ + */ + +/* The unknown key */ +#define GLFW_KEY_UNKNOWN -1 + +/* Printable keys */ +#define GLFW_KEY_SPACE 32 +#define GLFW_KEY_APOSTROPHE 39 /* ' */ +#define GLFW_KEY_COMMA 44 /* , */ +#define GLFW_KEY_MINUS 45 /* - */ +#define GLFW_KEY_PERIOD 46 /* . */ +#define GLFW_KEY_SLASH 47 /* / */ +#define GLFW_KEY_0 48 +#define GLFW_KEY_1 49 +#define GLFW_KEY_2 50 +#define GLFW_KEY_3 51 +#define GLFW_KEY_4 52 +#define GLFW_KEY_5 53 +#define GLFW_KEY_6 54 +#define GLFW_KEY_7 55 +#define GLFW_KEY_8 56 +#define GLFW_KEY_9 57 +#define GLFW_KEY_SEMICOLON 59 /* ; */ +#define GLFW_KEY_EQUAL 61 /* = */ +#define GLFW_KEY_A 65 +#define GLFW_KEY_B 66 +#define GLFW_KEY_C 67 +#define GLFW_KEY_D 68 +#define GLFW_KEY_E 69 +#define GLFW_KEY_F 70 +#define GLFW_KEY_G 71 +#define GLFW_KEY_H 72 +#define GLFW_KEY_I 73 +#define GLFW_KEY_J 74 +#define GLFW_KEY_K 75 +#define GLFW_KEY_L 76 +#define GLFW_KEY_M 77 +#define GLFW_KEY_N 78 +#define GLFW_KEY_O 79 +#define GLFW_KEY_P 80 +#define GLFW_KEY_Q 81 +#define GLFW_KEY_R 82 +#define GLFW_KEY_S 83 +#define GLFW_KEY_T 84 +#define GLFW_KEY_U 85 +#define GLFW_KEY_V 86 +#define GLFW_KEY_W 87 +#define GLFW_KEY_X 88 +#define GLFW_KEY_Y 89 +#define GLFW_KEY_Z 90 +#define GLFW_KEY_LEFT_BRACKET 91 /* [ */ +#define GLFW_KEY_BACKSLASH 92 /* \ */ +#define GLFW_KEY_RIGHT_BRACKET 93 /* ] */ +#define GLFW_KEY_GRAVE_ACCENT 96 /* ` */ +#define GLFW_KEY_WORLD_1 161 /* non-US #1 */ +#define GLFW_KEY_WORLD_2 162 /* non-US #2 */ + +/* Function keys */ +#define GLFW_KEY_ESCAPE 256 +#define GLFW_KEY_ENTER 257 +#define GLFW_KEY_TAB 258 +#define GLFW_KEY_BACKSPACE 259 +#define GLFW_KEY_INSERT 260 +#define GLFW_KEY_DELETE 261 +#define GLFW_KEY_RIGHT 262 +#define GLFW_KEY_LEFT 263 +#define GLFW_KEY_DOWN 264 +#define GLFW_KEY_UP 265 +#define GLFW_KEY_PAGE_UP 266 +#define GLFW_KEY_PAGE_DOWN 267 +#define GLFW_KEY_HOME 268 +#define GLFW_KEY_END 269 +#define GLFW_KEY_CAPS_LOCK 280 +#define GLFW_KEY_SCROLL_LOCK 281 +#define GLFW_KEY_NUM_LOCK 282 +#define GLFW_KEY_PRINT_SCREEN 283 +#define GLFW_KEY_PAUSE 284 +#define GLFW_KEY_F1 290 +#define GLFW_KEY_F2 291 +#define GLFW_KEY_F3 292 +#define GLFW_KEY_F4 293 +#define GLFW_KEY_F5 294 +#define GLFW_KEY_F6 295 +#define GLFW_KEY_F7 296 +#define GLFW_KEY_F8 297 +#define GLFW_KEY_F9 298 +#define GLFW_KEY_F10 299 +#define GLFW_KEY_F11 300 +#define GLFW_KEY_F12 301 +#define GLFW_KEY_F13 302 +#define GLFW_KEY_F14 303 +#define GLFW_KEY_F15 304 +#define GLFW_KEY_F16 305 +#define GLFW_KEY_F17 306 +#define GLFW_KEY_F18 307 +#define GLFW_KEY_F19 308 +#define GLFW_KEY_F20 309 +#define GLFW_KEY_F21 310 +#define GLFW_KEY_F22 311 +#define GLFW_KEY_F23 312 +#define GLFW_KEY_F24 313 +#define GLFW_KEY_F25 314 +#define GLFW_KEY_KP_0 320 +#define GLFW_KEY_KP_1 321 +#define GLFW_KEY_KP_2 322 +#define GLFW_KEY_KP_3 323 +#define GLFW_KEY_KP_4 324 +#define GLFW_KEY_KP_5 325 +#define GLFW_KEY_KP_6 326 +#define GLFW_KEY_KP_7 327 +#define GLFW_KEY_KP_8 328 +#define GLFW_KEY_KP_9 329 +#define GLFW_KEY_KP_DECIMAL 330 +#define GLFW_KEY_KP_DIVIDE 331 +#define GLFW_KEY_KP_MULTIPLY 332 +#define GLFW_KEY_KP_SUBTRACT 333 +#define GLFW_KEY_KP_ADD 334 +#define GLFW_KEY_KP_ENTER 335 +#define GLFW_KEY_KP_EQUAL 336 +#define GLFW_KEY_LEFT_SHIFT 340 +#define GLFW_KEY_LEFT_CONTROL 341 +#define GLFW_KEY_LEFT_ALT 342 +#define GLFW_KEY_LEFT_SUPER 343 +#define GLFW_KEY_RIGHT_SHIFT 344 +#define GLFW_KEY_RIGHT_CONTROL 345 +#define GLFW_KEY_RIGHT_ALT 346 +#define GLFW_KEY_RIGHT_SUPER 347 +#define GLFW_KEY_MENU 348 + +#define GLFW_KEY_LAST GLFW_KEY_MENU + +/*! @} */ + +/*! @defgroup mods Modifier key flags + * + * See [key input](@ref input_key) for how these are used. + * + * @ingroup input + * @{ */ + +/*! @brief If this bit is set one or more Shift keys were held down. + */ +#define GLFW_MOD_SHIFT 0x0001 +/*! @brief If this bit is set one or more Control keys were held down. + */ +#define GLFW_MOD_CONTROL 0x0002 +/*! @brief If this bit is set one or more Alt keys were held down. + */ +#define GLFW_MOD_ALT 0x0004 +/*! @brief If this bit is set one or more Super keys were held down. + */ +#define GLFW_MOD_SUPER 0x0008 + +/*! @} */ + +/*! @defgroup buttons Mouse buttons + * + * See [mouse button input](@ref input_mouse_button) for how these are used. + * + * @ingroup input + * @{ */ +#define GLFW_MOUSE_BUTTON_1 0 +#define GLFW_MOUSE_BUTTON_2 1 +#define GLFW_MOUSE_BUTTON_3 2 +#define GLFW_MOUSE_BUTTON_4 3 +#define GLFW_MOUSE_BUTTON_5 4 +#define GLFW_MOUSE_BUTTON_6 5 +#define GLFW_MOUSE_BUTTON_7 6 +#define GLFW_MOUSE_BUTTON_8 7 +#define GLFW_MOUSE_BUTTON_LAST GLFW_MOUSE_BUTTON_8 +#define GLFW_MOUSE_BUTTON_LEFT GLFW_MOUSE_BUTTON_1 +#define GLFW_MOUSE_BUTTON_RIGHT GLFW_MOUSE_BUTTON_2 +#define GLFW_MOUSE_BUTTON_MIDDLE GLFW_MOUSE_BUTTON_3 +/*! @} */ + +/*! @defgroup joysticks Joysticks + * + * See [joystick input](@ref joystick) for how these are used. + * + * @ingroup input + * @{ */ +#define GLFW_JOYSTICK_1 0 +#define GLFW_JOYSTICK_2 1 +#define GLFW_JOYSTICK_3 2 +#define GLFW_JOYSTICK_4 3 +#define GLFW_JOYSTICK_5 4 +#define GLFW_JOYSTICK_6 5 +#define GLFW_JOYSTICK_7 6 +#define GLFW_JOYSTICK_8 7 +#define GLFW_JOYSTICK_9 8 +#define GLFW_JOYSTICK_10 9 +#define GLFW_JOYSTICK_11 10 +#define GLFW_JOYSTICK_12 11 +#define GLFW_JOYSTICK_13 12 +#define GLFW_JOYSTICK_14 13 +#define GLFW_JOYSTICK_15 14 +#define GLFW_JOYSTICK_16 15 +#define GLFW_JOYSTICK_LAST GLFW_JOYSTICK_16 +/*! @} */ + +/*! @defgroup errors Error codes + * + * See [error handling](@ref error_handling) for how these are used. + * + * @ingroup init + * @{ */ +/*! @brief GLFW has not been initialized. + * + * This occurs if a GLFW function was called that must not be called unless the + * library is [initialized](@ref intro_init). + * + * @analysis Application programmer error. Initialize GLFW before calling any + * function that requires initialization. + */ +#define GLFW_NOT_INITIALIZED 0x00010001 +/*! @brief No context is current for this thread. + * + * This occurs if a GLFW function was called that needs and operates on the + * current OpenGL or OpenGL ES context but no context is current on the calling + * thread. One such function is @ref glfwSwapInterval. + * + * @analysis Application programmer error. Ensure a context is current before + * calling functions that require a current context. + */ +#define GLFW_NO_CURRENT_CONTEXT 0x00010002 +/*! @brief One of the arguments to the function was an invalid enum value. + * + * One of the arguments to the function was an invalid enum value, for example + * requesting [GLFW_RED_BITS](@ref window_hints_fb) with @ref + * glfwGetWindowAttrib. + * + * @analysis Application programmer error. Fix the offending call. + */ +#define GLFW_INVALID_ENUM 0x00010003 +/*! @brief One of the arguments to the function was an invalid value. + * + * One of the arguments to the function was an invalid value, for example + * requesting a non-existent OpenGL or OpenGL ES version like 2.7. + * + * Requesting a valid but unavailable OpenGL or OpenGL ES version will instead + * result in a @ref GLFW_VERSION_UNAVAILABLE error. + * + * @analysis Application programmer error. Fix the offending call. + */ +#define GLFW_INVALID_VALUE 0x00010004 +/*! @brief A memory allocation failed. + * + * A memory allocation failed. + * + * @analysis A bug in GLFW or the underlying operating system. Report the bug + * to our [issue tracker](https://github.com/glfw/glfw/issues). + */ +#define GLFW_OUT_OF_MEMORY 0x00010005 +/*! @brief GLFW could not find support for the requested API on the system. + * + * GLFW could not find support for the requested API on the system. + * + * @analysis The installed graphics driver does not support the requested + * API, or does not support it via the chosen context creation backend. + * Below are a few examples. + * + * @par + * Some pre-installed Windows graphics drivers do not support OpenGL. AMD only + * supports OpenGL ES via EGL, while Nvidia and Intel only support it via + * a WGL or GLX extension. OS X does not provide OpenGL ES at all. The Mesa + * EGL, OpenGL and OpenGL ES libraries do not interface with the Nvidia binary + * driver. Older graphics drivers do not support Vulkan. + */ +#define GLFW_API_UNAVAILABLE 0x00010006 +/*! @brief The requested OpenGL or OpenGL ES version is not available. + * + * The requested OpenGL or OpenGL ES version (including any requested context + * or framebuffer hints) is not available on this machine. + * + * @analysis The machine does not support your requirements. If your + * application is sufficiently flexible, downgrade your requirements and try + * again. Otherwise, inform the user that their machine does not match your + * requirements. + * + * @par + * Future invalid OpenGL and OpenGL ES versions, for example OpenGL 4.8 if 5.0 + * comes out before the 4.x series gets that far, also fail with this error and + * not @ref GLFW_INVALID_VALUE, because GLFW cannot know what future versions + * will exist. + */ +#define GLFW_VERSION_UNAVAILABLE 0x00010007 +/*! @brief A platform-specific error occurred that does not match any of the + * more specific categories. + * + * A platform-specific error occurred that does not match any of the more + * specific categories. + * + * @analysis A bug or configuration error in GLFW, the underlying operating + * system or its drivers, or a lack of required resources. Report the issue to + * our [issue tracker](https://github.com/glfw/glfw/issues). + */ +#define GLFW_PLATFORM_ERROR 0x00010008 +/*! @brief The requested format is not supported or available. + * + * If emitted during window creation, the requested pixel format is not + * supported. + * + * If emitted when querying the clipboard, the contents of the clipboard could + * not be converted to the requested format. + * + * @analysis If emitted during window creation, one or more + * [hard constraints](@ref window_hints_hard) did not match any of the + * available pixel formats. If your application is sufficiently flexible, + * downgrade your requirements and try again. Otherwise, inform the user that + * their machine does not match your requirements. + * + * @par + * If emitted when querying the clipboard, ignore the error or report it to + * the user, as appropriate. + */ +#define GLFW_FORMAT_UNAVAILABLE 0x00010009 +/*! @brief The specified window does not have an OpenGL or OpenGL ES context. + * + * A window that does not have an OpenGL or OpenGL ES context was passed to + * a function that requires it to have one. + * + * @analysis Application programmer error. Fix the offending call. + */ +#define GLFW_NO_WINDOW_CONTEXT 0x0001000A +/*! @} */ + +#define GLFW_FOCUSED 0x00020001 +#define GLFW_ICONIFIED 0x00020002 +#define GLFW_RESIZABLE 0x00020003 +#define GLFW_VISIBLE 0x00020004 +#define GLFW_DECORATED 0x00020005 +#define GLFW_AUTO_ICONIFY 0x00020006 +#define GLFW_FLOATING 0x00020007 +#define GLFW_MAXIMIZED 0x00020008 + +#define GLFW_RED_BITS 0x00021001 +#define GLFW_GREEN_BITS 0x00021002 +#define GLFW_BLUE_BITS 0x00021003 +#define GLFW_ALPHA_BITS 0x00021004 +#define GLFW_DEPTH_BITS 0x00021005 +#define GLFW_STENCIL_BITS 0x00021006 +#define GLFW_ACCUM_RED_BITS 0x00021007 +#define GLFW_ACCUM_GREEN_BITS 0x00021008 +#define GLFW_ACCUM_BLUE_BITS 0x00021009 +#define GLFW_ACCUM_ALPHA_BITS 0x0002100A +#define GLFW_AUX_BUFFERS 0x0002100B +#define GLFW_STEREO 0x0002100C +#define GLFW_SAMPLES 0x0002100D +#define GLFW_SRGB_CAPABLE 0x0002100E +#define GLFW_REFRESH_RATE 0x0002100F +#define GLFW_DOUBLEBUFFER 0x00021010 + +#define GLFW_CLIENT_API 0x00022001 +#define GLFW_CONTEXT_VERSION_MAJOR 0x00022002 +#define GLFW_CONTEXT_VERSION_MINOR 0x00022003 +#define GLFW_CONTEXT_REVISION 0x00022004 +#define GLFW_CONTEXT_ROBUSTNESS 0x00022005 +#define GLFW_OPENGL_FORWARD_COMPAT 0x00022006 +#define GLFW_OPENGL_DEBUG_CONTEXT 0x00022007 +#define GLFW_OPENGL_PROFILE 0x00022008 +#define GLFW_CONTEXT_RELEASE_BEHAVIOR 0x00022009 +#define GLFW_CONTEXT_NO_ERROR 0x0002200A +#define GLFW_CONTEXT_CREATION_API 0x0002200B + +#define GLFW_NO_API 0 +#define GLFW_OPENGL_API 0x00030001 +#define GLFW_OPENGL_ES_API 0x00030002 + +#define GLFW_NO_ROBUSTNESS 0 +#define GLFW_NO_RESET_NOTIFICATION 0x00031001 +#define GLFW_LOSE_CONTEXT_ON_RESET 0x00031002 + +#define GLFW_OPENGL_ANY_PROFILE 0 +#define GLFW_OPENGL_CORE_PROFILE 0x00032001 +#define GLFW_OPENGL_COMPAT_PROFILE 0x00032002 + +#define GLFW_CURSOR 0x00033001 +#define GLFW_STICKY_KEYS 0x00033002 +#define GLFW_STICKY_MOUSE_BUTTONS 0x00033003 + +#define GLFW_CURSOR_NORMAL 0x00034001 +#define GLFW_CURSOR_HIDDEN 0x00034002 +#define GLFW_CURSOR_DISABLED 0x00034003 + +#define GLFW_ANY_RELEASE_BEHAVIOR 0 +#define GLFW_RELEASE_BEHAVIOR_FLUSH 0x00035001 +#define GLFW_RELEASE_BEHAVIOR_NONE 0x00035002 + +#define GLFW_NATIVE_CONTEXT_API 0x00036001 +#define GLFW_EGL_CONTEXT_API 0x00036002 + +/*! @defgroup shapes Standard cursor shapes + * + * See [standard cursor creation](@ref cursor_standard) for how these are used. + * + * @ingroup input + * @{ */ + +/*! @brief The regular arrow cursor shape. + * + * The regular arrow cursor. + */ +#define GLFW_ARROW_CURSOR 0x00036001 +/*! @brief The text input I-beam cursor shape. + * + * The text input I-beam cursor shape. + */ +#define GLFW_IBEAM_CURSOR 0x00036002 +/*! @brief The crosshair shape. + * + * The crosshair shape. + */ +#define GLFW_CROSSHAIR_CURSOR 0x00036003 +/*! @brief The hand shape. + * + * The hand shape. + */ +#define GLFW_HAND_CURSOR 0x00036004 +/*! @brief The horizontal resize arrow shape. + * + * The horizontal resize arrow shape. + */ +#define GLFW_HRESIZE_CURSOR 0x00036005 +/*! @brief The vertical resize arrow shape. + * + * The vertical resize arrow shape. + */ +#define GLFW_VRESIZE_CURSOR 0x00036006 +/*! @} */ + +#define GLFW_CONNECTED 0x00040001 +#define GLFW_DISCONNECTED 0x00040002 + +#define GLFW_DONT_CARE -1 + + +/************************************************************************* + * GLFW API types + *************************************************************************/ + +/*! @brief Client API function pointer type. + * + * Generic function pointer used for returning client API function pointers + * without forcing a cast from a regular pointer. + * + * @sa @ref context_glext + * @sa glfwGetProcAddress + * + * @since Added in version 3.0. + + * @ingroup context + */ +typedef void (*GLFWglproc)(void); + +/*! @brief Vulkan API function pointer type. + * + * Generic function pointer used for returning Vulkan API function pointers + * without forcing a cast from a regular pointer. + * + * @sa @ref vulkan_proc + * @sa glfwGetInstanceProcAddress + * + * @since Added in version 3.2. + * + * @ingroup vulkan + */ +typedef void (*GLFWvkproc)(void); + +/*! @brief Opaque monitor object. + * + * Opaque monitor object. + * + * @see @ref monitor_object + * + * @since Added in version 3.0. + * + * @ingroup monitor + */ +typedef struct GLFWmonitor GLFWmonitor; + +/*! @brief Opaque window object. + * + * Opaque window object. + * + * @see @ref window_object + * + * @since Added in version 3.0. + * + * @ingroup window + */ +typedef struct GLFWwindow GLFWwindow; + +/*! @brief Opaque cursor object. + * + * Opaque cursor object. + * + * @see @ref cursor_object + * + * @since Added in version 3.1. + * + * @ingroup cursor + */ +typedef struct GLFWcursor GLFWcursor; + +/*! @brief The function signature for error callbacks. + * + * This is the function signature for error callback functions. + * + * @param[in] error An [error code](@ref errors). + * @param[in] description A UTF-8 encoded string describing the error. + * + * @sa @ref error_handling + * @sa glfwSetErrorCallback + * + * @since Added in version 3.0. + * + * @ingroup init + */ +typedef void (* GLFWerrorfun)(int,const char*); + +/*! @brief The function signature for window position callbacks. + * + * This is the function signature for window position callback functions. + * + * @param[in] window The window that was moved. + * @param[in] xpos The new x-coordinate, in screen coordinates, of the + * upper-left corner of the client area of the window. + * @param[in] ypos The new y-coordinate, in screen coordinates, of the + * upper-left corner of the client area of the window. + * + * @sa @ref window_pos + * @sa glfwSetWindowPosCallback + * + * @since Added in version 3.0. + * + * @ingroup window + */ +typedef void (* GLFWwindowposfun)(GLFWwindow*,int,int); + +/*! @brief The function signature for window resize callbacks. + * + * This is the function signature for window size callback functions. + * + * @param[in] window The window that was resized. + * @param[in] width The new width, in screen coordinates, of the window. + * @param[in] height The new height, in screen coordinates, of the window. + * + * @sa @ref window_size + * @sa glfwSetWindowSizeCallback + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter. + * + * @ingroup window + */ +typedef void (* GLFWwindowsizefun)(GLFWwindow*,int,int); + +/*! @brief The function signature for window close callbacks. + * + * This is the function signature for window close callback functions. + * + * @param[in] window The window that the user attempted to close. + * + * @sa @ref window_close + * @sa glfwSetWindowCloseCallback + * + * @since Added in version 2.5. + * @glfw3 Added window handle parameter. + * + * @ingroup window + */ +typedef void (* GLFWwindowclosefun)(GLFWwindow*); + +/*! @brief The function signature for window content refresh callbacks. + * + * This is the function signature for window refresh callback functions. + * + * @param[in] window The window whose content needs to be refreshed. + * + * @sa @ref window_refresh + * @sa glfwSetWindowRefreshCallback + * + * @since Added in version 2.5. + * @glfw3 Added window handle parameter. + * + * @ingroup window + */ +typedef void (* GLFWwindowrefreshfun)(GLFWwindow*); + +/*! @brief The function signature for window focus/defocus callbacks. + * + * This is the function signature for window focus callback functions. + * + * @param[in] window The window that gained or lost input focus. + * @param[in] focused `GLFW_TRUE` if the window was given input focus, or + * `GLFW_FALSE` if it lost it. + * + * @sa @ref window_focus + * @sa glfwSetWindowFocusCallback + * + * @since Added in version 3.0. + * + * @ingroup window + */ +typedef void (* GLFWwindowfocusfun)(GLFWwindow*,int); + +/*! @brief The function signature for window iconify/restore callbacks. + * + * This is the function signature for window iconify/restore callback + * functions. + * + * @param[in] window The window that was iconified or restored. + * @param[in] iconified `GLFW_TRUE` if the window was iconified, or + * `GLFW_FALSE` if it was restored. + * + * @sa @ref window_iconify + * @sa glfwSetWindowIconifyCallback + * + * @since Added in version 3.0. + * + * @ingroup window + */ +typedef void (* GLFWwindowiconifyfun)(GLFWwindow*,int); + +/*! @brief The function signature for framebuffer resize callbacks. + * + * This is the function signature for framebuffer resize callback + * functions. + * + * @param[in] window The window whose framebuffer was resized. + * @param[in] width The new width, in pixels, of the framebuffer. + * @param[in] height The new height, in pixels, of the framebuffer. + * + * @sa @ref window_fbsize + * @sa glfwSetFramebufferSizeCallback + * + * @since Added in version 3.0. + * + * @ingroup window + */ +typedef void (* GLFWframebuffersizefun)(GLFWwindow*,int,int); + +/*! @brief The function signature for mouse button callbacks. + * + * This is the function signature for mouse button callback functions. + * + * @param[in] window The window that received the event. + * @param[in] button The [mouse button](@ref buttons) that was pressed or + * released. + * @param[in] action One of `GLFW_PRESS` or `GLFW_RELEASE`. + * @param[in] mods Bit field describing which [modifier keys](@ref mods) were + * held down. + * + * @sa @ref input_mouse_button + * @sa glfwSetMouseButtonCallback + * + * @since Added in version 1.0. + * @glfw3 Added window handle and modifier mask parameters. + * + * @ingroup input + */ +typedef void (* GLFWmousebuttonfun)(GLFWwindow*,int,int,int); + +/*! @brief The function signature for cursor position callbacks. + * + * This is the function signature for cursor position callback functions. + * + * @param[in] window The window that received the event. + * @param[in] xpos The new cursor x-coordinate, relative to the left edge of + * the client area. + * @param[in] ypos The new cursor y-coordinate, relative to the top edge of the + * client area. + * + * @sa @ref cursor_pos + * @sa glfwSetCursorPosCallback + * + * @since Added in version 3.0. Replaces `GLFWmouseposfun`. + * + * @ingroup input + */ +typedef void (* GLFWcursorposfun)(GLFWwindow*,double,double); + +/*! @brief The function signature for cursor enter/leave callbacks. + * + * This is the function signature for cursor enter/leave callback functions. + * + * @param[in] window The window that received the event. + * @param[in] entered `GLFW_TRUE` if the cursor entered the window's client + * area, or `GLFW_FALSE` if it left it. + * + * @sa @ref cursor_enter + * @sa glfwSetCursorEnterCallback + * + * @since Added in version 3.0. + * + * @ingroup input + */ +typedef void (* GLFWcursorenterfun)(GLFWwindow*,int); + +/*! @brief The function signature for scroll callbacks. + * + * This is the function signature for scroll callback functions. + * + * @param[in] window The window that received the event. + * @param[in] xoffset The scroll offset along the x-axis. + * @param[in] yoffset The scroll offset along the y-axis. + * + * @sa @ref scrolling + * @sa glfwSetScrollCallback + * + * @since Added in version 3.0. Replaces `GLFWmousewheelfun`. + * + * @ingroup input + */ +typedef void (* GLFWscrollfun)(GLFWwindow*,double,double); + +/*! @brief The function signature for keyboard key callbacks. + * + * This is the function signature for keyboard key callback functions. + * + * @param[in] window The window that received the event. + * @param[in] key The [keyboard key](@ref keys) that was pressed or released. + * @param[in] scancode The system-specific scancode of the key. + * @param[in] action `GLFW_PRESS`, `GLFW_RELEASE` or `GLFW_REPEAT`. + * @param[in] mods Bit field describing which [modifier keys](@ref mods) were + * held down. + * + * @sa @ref input_key + * @sa glfwSetKeyCallback + * + * @since Added in version 1.0. + * @glfw3 Added window handle, scancode and modifier mask parameters. + * + * @ingroup input + */ +typedef void (* GLFWkeyfun)(GLFWwindow*,int,int,int,int); + +/*! @brief The function signature for Unicode character callbacks. + * + * This is the function signature for Unicode character callback functions. + * + * @param[in] window The window that received the event. + * @param[in] codepoint The Unicode code point of the character. + * + * @sa @ref input_char + * @sa glfwSetCharCallback + * + * @since Added in version 2.4. + * @glfw3 Added window handle parameter. + * + * @ingroup input + */ +typedef void (* GLFWcharfun)(GLFWwindow*,unsigned int); + +/*! @brief The function signature for Unicode character with modifiers + * callbacks. + * + * This is the function signature for Unicode character with modifiers callback + * functions. It is called for each input character, regardless of what + * modifier keys are held down. + * + * @param[in] window The window that received the event. + * @param[in] codepoint The Unicode code point of the character. + * @param[in] mods Bit field describing which [modifier keys](@ref mods) were + * held down. + * + * @sa @ref input_char + * @sa glfwSetCharModsCallback + * + * @since Added in version 3.1. + * + * @ingroup input + */ +typedef void (* GLFWcharmodsfun)(GLFWwindow*,unsigned int,int); + +/*! @brief The function signature for file drop callbacks. + * + * This is the function signature for file drop callbacks. + * + * @param[in] window The window that received the event. + * @param[in] count The number of dropped files. + * @param[in] paths The UTF-8 encoded file and/or directory path names. + * + * @sa @ref path_drop + * @sa glfwSetDropCallback + * + * @since Added in version 3.1. + * + * @ingroup input + */ +typedef void (* GLFWdropfun)(GLFWwindow*,int,const char**); + +/*! @brief The function signature for monitor configuration callbacks. + * + * This is the function signature for monitor configuration callback functions. + * + * @param[in] monitor The monitor that was connected or disconnected. + * @param[in] event One of `GLFW_CONNECTED` or `GLFW_DISCONNECTED`. + * + * @sa @ref monitor_event + * @sa glfwSetMonitorCallback + * + * @since Added in version 3.0. + * + * @ingroup monitor + */ +typedef void (* GLFWmonitorfun)(GLFWmonitor*,int); + +/*! @brief The function signature for joystick configuration callbacks. + * + * This is the function signature for joystick configuration callback + * functions. + * + * @param[in] joy The joystick that was connected or disconnected. + * @param[in] event One of `GLFW_CONNECTED` or `GLFW_DISCONNECTED`. + * + * @sa @ref joystick_event + * @sa glfwSetJoystickCallback + * + * @since Added in version 3.2. + * + * @ingroup input + */ +typedef void (* GLFWjoystickfun)(int,int); + +/*! @brief Video mode type. + * + * This describes a single video mode. + * + * @sa @ref monitor_modes + * @sa glfwGetVideoMode glfwGetVideoModes + * + * @since Added in version 1.0. + * @glfw3 Added refresh rate member. + * + * @ingroup monitor + */ +typedef struct GLFWvidmode +{ + /*! The width, in screen coordinates, of the video mode. + */ + int width; + /*! The height, in screen coordinates, of the video mode. + */ + int height; + /*! The bit depth of the red channel of the video mode. + */ + int redBits; + /*! The bit depth of the green channel of the video mode. + */ + int greenBits; + /*! The bit depth of the blue channel of the video mode. + */ + int blueBits; + /*! The refresh rate, in Hz, of the video mode. + */ + int refreshRate; +} GLFWvidmode; + +/*! @brief Gamma ramp. + * + * This describes the gamma ramp for a monitor. + * + * @sa @ref monitor_gamma + * @sa glfwGetGammaRamp glfwSetGammaRamp + * + * @since Added in version 3.0. + * + * @ingroup monitor + */ +typedef struct GLFWgammaramp +{ + /*! An array of value describing the response of the red channel. + */ + unsigned short* red; + /*! An array of value describing the response of the green channel. + */ + unsigned short* green; + /*! An array of value describing the response of the blue channel. + */ + unsigned short* blue; + /*! The number of elements in each array. + */ + unsigned int size; +} GLFWgammaramp; + +/*! @brief Image data. + * + * @sa @ref cursor_custom + * @sa @ref window_icon + * + * @since Added in version 2.1. + * @glfw3 Removed format and bytes-per-pixel members. + */ +typedef struct GLFWimage +{ + /*! The width, in pixels, of this image. + */ + int width; + /*! The height, in pixels, of this image. + */ + int height; + /*! The pixel data of this image, arranged left-to-right, top-to-bottom. + */ + unsigned char* pixels; +} GLFWimage; + + +/************************************************************************* + * GLFW API functions + *************************************************************************/ + +/*! @brief Initializes the GLFW library. + * + * This function initializes the GLFW library. Before most GLFW functions can + * be used, GLFW must be initialized, and before an application terminates GLFW + * should be terminated in order to free any resources allocated during or + * after initialization. + * + * If this function fails, it calls @ref glfwTerminate before returning. If it + * succeeds, you should call @ref glfwTerminate before the application exits. + * + * Additional calls to this function after successful initialization but before + * termination will return `GLFW_TRUE` immediately. + * + * @return `GLFW_TRUE` if successful, or `GLFW_FALSE` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_PLATFORM_ERROR. + * + * @remark @osx This function will change the current directory of the + * application to the `Contents/Resources` subdirectory of the application's + * bundle, if present. This can be disabled with a + * [compile-time option](@ref compile_options_osx). + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref intro_init + * @sa glfwTerminate + * + * @since Added in version 1.0. + * + * @ingroup init + */ +GLFWAPI int glfwInit(void); + +/*! @brief Terminates the GLFW library. + * + * This function destroys all remaining windows and cursors, restores any + * modified gamma ramps and frees any other allocated resources. Once this + * function is called, you must again call @ref glfwInit successfully before + * you will be able to use most GLFW functions. + * + * If GLFW has been successfully initialized, this function should be called + * before the application exits. If initialization fails, there is no need to + * call this function, as it is called by @ref glfwInit before it returns + * failure. + * + * @errors Possible errors include @ref GLFW_PLATFORM_ERROR. + * + * @remark This function may be called before @ref glfwInit. + * + * @warning The contexts of any remaining windows must not be current on any + * other thread when this function is called. + * + * @reentrancy This function must not be called from a callback. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref intro_init + * @sa glfwInit + * + * @since Added in version 1.0. + * + * @ingroup init + */ +GLFWAPI void glfwTerminate(void); + +/*! @brief Retrieves the version of the GLFW library. + * + * This function retrieves the major, minor and revision numbers of the GLFW + * library. It is intended for when you are using GLFW as a shared library and + * want to ensure that you are using the minimum required version. + * + * Any or all of the version arguments may be `NULL`. + * + * @param[out] major Where to store the major version number, or `NULL`. + * @param[out] minor Where to store the minor version number, or `NULL`. + * @param[out] rev Where to store the revision number, or `NULL`. + * + * @errors None. + * + * @remark This function may be called before @ref glfwInit. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref intro_version + * @sa glfwGetVersionString + * + * @since Added in version 1.0. + * + * @ingroup init + */ +GLFWAPI void glfwGetVersion(int* major, int* minor, int* rev); + +/*! @brief Returns a string describing the compile-time configuration. + * + * This function returns the compile-time generated + * [version string](@ref intro_version_string) of the GLFW library binary. It + * describes the version, platform, compiler and any platform-specific + * compile-time options. It should not be confused with the OpenGL or OpenGL + * ES version string, queried with `glGetString`. + * + * __Do not use the version string__ to parse the GLFW library version. The + * @ref glfwGetVersion function provides the version of the running library + * binary in numerical format. + * + * @return The ASCII encoded GLFW version string. + * + * @errors None. + * + * @remark This function may be called before @ref glfwInit. + * + * @pointer_lifetime The returned string is static and compile-time generated. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref intro_version + * @sa glfwGetVersion + * + * @since Added in version 3.0. + * + * @ingroup init + */ +GLFWAPI const char* glfwGetVersionString(void); + +/*! @brief Sets the error callback. + * + * This function sets the error callback, which is called with an error code + * and a human-readable description each time a GLFW error occurs. + * + * The error callback is called on the thread where the error occurred. If you + * are using GLFW from multiple threads, your error callback needs to be + * written accordingly. + * + * Because the description string may have been generated specifically for that + * error, it is not guaranteed to be valid after the callback has returned. If + * you wish to use it after the callback returns, you need to make a copy. + * + * Once set, the error callback remains set even after the library has been + * terminated. + * + * @param[in] cbfun The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set. + * + * @errors None. + * + * @remark This function may be called before @ref glfwInit. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref error_handling + * + * @since Added in version 3.0. + * + * @ingroup init + */ +GLFWAPI GLFWerrorfun glfwSetErrorCallback(GLFWerrorfun cbfun); + +/*! @brief Returns the currently connected monitors. + * + * This function returns an array of handles for all currently connected + * monitors. The primary monitor is always first in the returned array. If no + * monitors were found, this function returns `NULL`. + * + * @param[out] count Where to store the number of monitors in the returned + * array. This is set to zero if an error occurred. + * @return An array of monitor handles, or `NULL` if no monitors were found or + * if an [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @pointer_lifetime The returned array is allocated and freed by GLFW. You + * should not free it yourself. It is guaranteed to be valid only until the + * monitor configuration changes or the library is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref monitor_monitors + * @sa @ref monitor_event + * @sa glfwGetPrimaryMonitor + * + * @since Added in version 3.0. + * + * @ingroup monitor + */ +GLFWAPI GLFWmonitor** glfwGetMonitors(int* count); + +/*! @brief Returns the primary monitor. + * + * This function returns the primary monitor. This is usually the monitor + * where elements like the task bar or global menu bar are located. + * + * @return The primary monitor, or `NULL` if no monitors were found or if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @remark The primary monitor is always first in the array returned by @ref + * glfwGetMonitors. + * + * @sa @ref monitor_monitors + * @sa glfwGetMonitors + * + * @since Added in version 3.0. + * + * @ingroup monitor + */ +GLFWAPI GLFWmonitor* glfwGetPrimaryMonitor(void); + +/*! @brief Returns the position of the monitor's viewport on the virtual screen. + * + * This function returns the position, in screen coordinates, of the upper-left + * corner of the specified monitor. + * + * Any or all of the position arguments may be `NULL`. If an error occurs, all + * non-`NULL` position arguments will be set to zero. + * + * @param[in] monitor The monitor to query. + * @param[out] xpos Where to store the monitor x-coordinate, or `NULL`. + * @param[out] ypos Where to store the monitor y-coordinate, or `NULL`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref monitor_properties + * + * @since Added in version 3.0. + * + * @ingroup monitor + */ +GLFWAPI void glfwGetMonitorPos(GLFWmonitor* monitor, int* xpos, int* ypos); + +/*! @brief Returns the physical size of the monitor. + * + * This function returns the size, in millimetres, of the display area of the + * specified monitor. + * + * Some systems do not provide accurate monitor size information, either + * because the monitor + * [EDID](https://en.wikipedia.org/wiki/Extended_display_identification_data) + * data is incorrect or because the driver does not report it accurately. + * + * Any or all of the size arguments may be `NULL`. If an error occurs, all + * non-`NULL` size arguments will be set to zero. + * + * @param[in] monitor The monitor to query. + * @param[out] widthMM Where to store the width, in millimetres, of the + * monitor's display area, or `NULL`. + * @param[out] heightMM Where to store the height, in millimetres, of the + * monitor's display area, or `NULL`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @remark @win32 calculates the returned physical size from the + * current resolution and system DPI instead of querying the monitor EDID data. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref monitor_properties + * + * @since Added in version 3.0. + * + * @ingroup monitor + */ +GLFWAPI void glfwGetMonitorPhysicalSize(GLFWmonitor* monitor, int* widthMM, int* heightMM); + +/*! @brief Returns the name of the specified monitor. + * + * This function returns a human-readable name, encoded as UTF-8, of the + * specified monitor. The name typically reflects the make and model of the + * monitor and is not guaranteed to be unique among the connected monitors. + * + * @param[in] monitor The monitor to query. + * @return The UTF-8 encoded name of the monitor, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @pointer_lifetime The returned string is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the specified monitor is + * disconnected or the library is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref monitor_properties + * + * @since Added in version 3.0. + * + * @ingroup monitor + */ +GLFWAPI const char* glfwGetMonitorName(GLFWmonitor* monitor); + +/*! @brief Sets the monitor configuration callback. + * + * This function sets the monitor configuration callback, or removes the + * currently set callback. This is called when a monitor is connected to or + * disconnected from the system. + * + * @param[in] cbfun The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref monitor_event + * + * @since Added in version 3.0. + * + * @ingroup monitor + */ +GLFWAPI GLFWmonitorfun glfwSetMonitorCallback(GLFWmonitorfun cbfun); + +/*! @brief Returns the available video modes for the specified monitor. + * + * This function returns an array of all video modes supported by the specified + * monitor. The returned array is sorted in ascending order, first by color + * bit depth (the sum of all channel depths) and then by resolution area (the + * product of width and height). + * + * @param[in] monitor The monitor to query. + * @param[out] count Where to store the number of video modes in the returned + * array. This is set to zero if an error occurred. + * @return An array of video modes, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The returned array is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the specified monitor is + * disconnected, this function is called again for that monitor or the library + * is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref monitor_modes + * @sa glfwGetVideoMode + * + * @since Added in version 1.0. + * @glfw3 Changed to return an array of modes for a specific monitor. + * + * @ingroup monitor + */ +GLFWAPI const GLFWvidmode* glfwGetVideoModes(GLFWmonitor* monitor, int* count); + +/*! @brief Returns the current mode of the specified monitor. + * + * This function returns the current video mode of the specified monitor. If + * you have created a full screen window for that monitor, the return value + * will depend on whether that window is iconified. + * + * @param[in] monitor The monitor to query. + * @return The current mode of the monitor, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The returned array is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the specified monitor is + * disconnected or the library is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref monitor_modes + * @sa glfwGetVideoModes + * + * @since Added in version 3.0. Replaces `glfwGetDesktopMode`. + * + * @ingroup monitor + */ +GLFWAPI const GLFWvidmode* glfwGetVideoMode(GLFWmonitor* monitor); + +/*! @brief Generates a gamma ramp and sets it for the specified monitor. + * + * This function generates a 256-element gamma ramp from the specified exponent + * and then calls @ref glfwSetGammaRamp with it. The value must be a finite + * number greater than zero. + * + * @param[in] monitor The monitor whose gamma ramp to set. + * @param[in] gamma The desired exponent. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_VALUE and @ref GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref monitor_gamma + * + * @since Added in version 3.0. + * + * @ingroup monitor + */ +GLFWAPI void glfwSetGamma(GLFWmonitor* monitor, float gamma); + +/*! @brief Returns the current gamma ramp for the specified monitor. + * + * This function returns the current gamma ramp of the specified monitor. + * + * @param[in] monitor The monitor to query. + * @return The current gamma ramp, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The returned structure and its arrays are allocated and + * freed by GLFW. You should not free them yourself. They are valid until the + * specified monitor is disconnected, this function is called again for that + * monitor or the library is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref monitor_gamma + * + * @since Added in version 3.0. + * + * @ingroup monitor + */ +GLFWAPI const GLFWgammaramp* glfwGetGammaRamp(GLFWmonitor* monitor); + +/*! @brief Sets the current gamma ramp for the specified monitor. + * + * This function sets the current gamma ramp for the specified monitor. The + * original gamma ramp for that monitor is saved by GLFW the first time this + * function is called and is restored by @ref glfwTerminate. + * + * @param[in] monitor The monitor whose gamma ramp to set. + * @param[in] ramp The gamma ramp to use. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @remark Gamma ramp sizes other than 256 are not supported by all platforms + * or graphics hardware. + * + * @remark @win32 The gamma ramp size must be 256. + * + * @pointer_lifetime The specified gamma ramp is copied before this function + * returns. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref monitor_gamma + * + * @since Added in version 3.0. + * + * @ingroup monitor + */ +GLFWAPI void glfwSetGammaRamp(GLFWmonitor* monitor, const GLFWgammaramp* ramp); + +/*! @brief Resets all window hints to their default values. + * + * This function resets all window hints to their + * [default values](@ref window_hints_values). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_hints + * @sa glfwWindowHint + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI void glfwDefaultWindowHints(void); + +/*! @brief Sets the specified window hint to the desired value. + * + * This function sets hints for the next call to @ref glfwCreateWindow. The + * hints, once set, retain their values until changed by a call to @ref + * glfwWindowHint or @ref glfwDefaultWindowHints, or until the library is + * terminated. + * + * This function does not check whether the specified hint values are valid. + * If you set hints to invalid values this will instead be reported by the next + * call to @ref glfwCreateWindow. + * + * @param[in] hint The [window hint](@ref window_hints) to set. + * @param[in] value The new value of the window hint. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_INVALID_ENUM. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_hints + * @sa glfwDefaultWindowHints + * + * @since Added in version 3.0. Replaces `glfwOpenWindowHint`. + * + * @ingroup window + */ +GLFWAPI void glfwWindowHint(int hint, int value); + +/*! @brief Creates a window and its associated context. + * + * This function creates a window and its associated OpenGL or OpenGL ES + * context. Most of the options controlling how the window and its context + * should be created are specified with [window hints](@ref window_hints). + * + * Successful creation does not change which context is current. Before you + * can use the newly created context, you need to + * [make it current](@ref context_current). For information about the `share` + * parameter, see @ref context_sharing. + * + * The created window, framebuffer and context may differ from what you + * requested, as not all parameters and hints are + * [hard constraints](@ref window_hints_hard). This includes the size of the + * window, especially for full screen windows. To query the actual attributes + * of the created window, framebuffer and context, see @ref + * glfwGetWindowAttrib, @ref glfwGetWindowSize and @ref glfwGetFramebufferSize. + * + * To create a full screen window, you need to specify the monitor the window + * will cover. If no monitor is specified, the window will be windowed mode. + * Unless you have a way for the user to choose a specific monitor, it is + * recommended that you pick the primary monitor. For more information on how + * to query connected monitors, see @ref monitor_monitors. + * + * For full screen windows, the specified size becomes the resolution of the + * window's _desired video mode_. As long as a full screen window is not + * iconified, the supported video mode most closely matching the desired video + * mode is set for the specified monitor. For more information about full + * screen windows, including the creation of so called _windowed full screen_ + * or _borderless full screen_ windows, see @ref window_windowed_full_screen. + * + * Once you have created the window, you can switch it between windowed and + * full screen mode with @ref glfwSetWindowMonitor. If the window has an + * OpenGL or OpenGL ES context, it will be unaffected. + * + * By default, newly created windows use the placement recommended by the + * window system. To create the window at a specific position, make it + * initially invisible using the [GLFW_VISIBLE](@ref window_hints_wnd) window + * hint, set its [position](@ref window_pos) and then [show](@ref window_hide) + * it. + * + * As long as at least one full screen window is not iconified, the screensaver + * is prohibited from starting. + * + * Window systems put limits on window sizes. Very large or very small window + * dimensions may be overridden by the window system on creation. Check the + * actual [size](@ref window_size) after creation. + * + * The [swap interval](@ref buffer_swap) is not set during window creation and + * the initial value may vary depending on driver settings and defaults. + * + * @param[in] width The desired width, in screen coordinates, of the window. + * This must be greater than zero. + * @param[in] height The desired height, in screen coordinates, of the window. + * This must be greater than zero. + * @param[in] title The initial, UTF-8 encoded window title. + * @param[in] monitor The monitor to use for full screen mode, or `NULL` for + * windowed mode. + * @param[in] share The window whose context to share resources with, or `NULL` + * to not share resources. + * @return The handle of the created window, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM, @ref GLFW_INVALID_VALUE, @ref GLFW_API_UNAVAILABLE, @ref + * GLFW_VERSION_UNAVAILABLE, @ref GLFW_FORMAT_UNAVAILABLE and @ref + * GLFW_PLATFORM_ERROR. + * + * @remark @win32 Window creation will fail if the Microsoft GDI software + * OpenGL implementation is the only one available. + * + * @remark @win32 If the executable has an icon resource named `GLFW_ICON,` it + * will be set as the initial icon for the window. If no such icon is present, + * the `IDI_WINLOGO` icon will be used instead. To set a different icon, see + * @ref glfwSetWindowIcon. + * + * @remark @win32 The context to share resources with must not be current on + * any other thread. + * + * @remark @osx The GLFW window has no icon, as it is not a document + * window, but the dock icon will be the same as the application bundle's icon. + * For more information on bundles, see the + * [Bundle Programming Guide](https://developer.apple.com/library/mac/documentation/CoreFoundation/Conceptual/CFBundles/) + * in the Mac Developer Library. + * + * @remark @osx The first time a window is created the menu bar is populated + * with common commands like Hide, Quit and About. The About entry opens + * a minimal about dialog with information from the application's bundle. The + * menu bar can be disabled with a + * [compile-time option](@ref compile_options_osx). + * + * @remark @osx On OS X 10.10 and later the window frame will not be rendered + * at full resolution on Retina displays unless the `NSHighResolutionCapable` + * key is enabled in the application bundle's `Info.plist`. For more + * information, see + * [High Resolution Guidelines for OS X](https://developer.apple.com/library/mac/documentation/GraphicsAnimation/Conceptual/HighResolutionOSX/Explained/Explained.html) + * in the Mac Developer Library. The GLFW test and example programs use + * a custom `Info.plist` template for this, which can be found as + * `CMake/MacOSXBundleInfo.plist.in` in the source tree. + * + * @remark @x11 Some window managers will not respect the placement of + * initially hidden windows. + * + * @remark @x11 Due to the asynchronous nature of X11, it may take a moment for + * a window to reach its requested state. This means you may not be able to + * query the final size, position or other attributes directly after window + * creation. + * + * @reentrancy This function must not be called from a callback. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_creation + * @sa glfwDestroyWindow + * + * @since Added in version 3.0. Replaces `glfwOpenWindow`. + * + * @ingroup window + */ +GLFWAPI GLFWwindow* glfwCreateWindow(int width, int height, const char* title, GLFWmonitor* monitor, GLFWwindow* share); + +/*! @brief Destroys the specified window and its context. + * + * This function destroys the specified window and its context. On calling + * this function, no further callbacks will be called for that window. + * + * If the context of the specified window is current on the main thread, it is + * detached before being destroyed. + * + * @param[in] window The window to destroy. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @note The context of the specified window must not be current on any other + * thread when this function is called. + * + * @reentrancy This function must not be called from a callback. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_creation + * @sa glfwCreateWindow + * + * @since Added in version 3.0. Replaces `glfwCloseWindow`. + * + * @ingroup window + */ +GLFWAPI void glfwDestroyWindow(GLFWwindow* window); + +/*! @brief Checks the close flag of the specified window. + * + * This function returns the value of the close flag of the specified window. + * + * @param[in] window The window to query. + * @return The value of the close flag. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @sa @ref window_close + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI int glfwWindowShouldClose(GLFWwindow* window); + +/*! @brief Sets the close flag of the specified window. + * + * This function sets the value of the close flag of the specified window. + * This can be used to override the user's attempt to close the window, or + * to signal that it should be closed. + * + * @param[in] window The window whose flag to change. + * @param[in] value The new value. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @sa @ref window_close + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowShouldClose(GLFWwindow* window, int value); + +/*! @brief Sets the title of the specified window. + * + * This function sets the window title, encoded as UTF-8, of the specified + * window. + * + * @param[in] window The window whose title to change. + * @param[in] title The UTF-8 encoded window title. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @remark @osx The window title will not be updated until the next time you + * process events. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_title + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowTitle(GLFWwindow* window, const char* title); + +/*! @brief Sets the icon for the specified window. + * + * This function sets the icon of the specified window. If passed an array of + * candidate images, those of or closest to the sizes desired by the system are + * selected. If no images are specified, the window reverts to its default + * icon. + * + * The desired image sizes varies depending on platform and system settings. + * The selected images will be rescaled as needed. Good sizes include 16x16, + * 32x32 and 48x48. + * + * @param[in] window The window whose icon to set. + * @param[in] count The number of images in the specified array, or zero to + * revert to the default window icon. + * @param[in] images The images to create the icon from. This is ignored if + * count is zero. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The specified image data is copied before this function + * returns. + * + * @remark @osx The GLFW window has no icon, as it is not a document + * window, so this function does nothing. The dock icon will be the same as + * the application bundle's icon. For more information on bundles, see the + * [Bundle Programming Guide](https://developer.apple.com/library/mac/documentation/CoreFoundation/Conceptual/CFBundles/) + * in the Mac Developer Library. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_icon + * + * @since Added in version 3.2. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowIcon(GLFWwindow* window, int count, const GLFWimage* images); + +/*! @brief Retrieves the position of the client area of the specified window. + * + * This function retrieves the position, in screen coordinates, of the + * upper-left corner of the client area of the specified window. + * + * Any or all of the position arguments may be `NULL`. If an error occurs, all + * non-`NULL` position arguments will be set to zero. + * + * @param[in] window The window to query. + * @param[out] xpos Where to store the x-coordinate of the upper-left corner of + * the client area, or `NULL`. + * @param[out] ypos Where to store the y-coordinate of the upper-left corner of + * the client area, or `NULL`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_pos + * @sa glfwSetWindowPos + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI void glfwGetWindowPos(GLFWwindow* window, int* xpos, int* ypos); + +/*! @brief Sets the position of the client area of the specified window. + * + * This function sets the position, in screen coordinates, of the upper-left + * corner of the client area of the specified windowed mode window. If the + * window is a full screen window, this function does nothing. + * + * __Do not use this function__ to move an already visible window unless you + * have very good reasons for doing so, as it will confuse and annoy the user. + * + * The window manager may put limits on what positions are allowed. GLFW + * cannot and should not override these limits. + * + * @param[in] window The window to query. + * @param[in] xpos The x-coordinate of the upper-left corner of the client area. + * @param[in] ypos The y-coordinate of the upper-left corner of the client area. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_pos + * @sa glfwGetWindowPos + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowPos(GLFWwindow* window, int xpos, int ypos); + +/*! @brief Retrieves the size of the client area of the specified window. + * + * This function retrieves the size, in screen coordinates, of the client area + * of the specified window. If you wish to retrieve the size of the + * framebuffer of the window in pixels, see @ref glfwGetFramebufferSize. + * + * Any or all of the size arguments may be `NULL`. If an error occurs, all + * non-`NULL` size arguments will be set to zero. + * + * @param[in] window The window whose size to retrieve. + * @param[out] width Where to store the width, in screen coordinates, of the + * client area, or `NULL`. + * @param[out] height Where to store the height, in screen coordinates, of the + * client area, or `NULL`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_size + * @sa glfwSetWindowSize + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter. + * + * @ingroup window + */ +GLFWAPI void glfwGetWindowSize(GLFWwindow* window, int* width, int* height); + +/*! @brief Sets the size limits of the specified window. + * + * This function sets the size limits of the client area of the specified + * window. If the window is full screen, the size limits only take effect + * once it is made windowed. If the window is not resizable, this function + * does nothing. + * + * The size limits are applied immediately to a windowed mode window and may + * cause it to be resized. + * + * The maximum dimensions must be greater than or equal to the minimum + * dimensions and all must be greater than or equal to zero. + * + * @param[in] window The window to set limits for. + * @param[in] minwidth The minimum width, in screen coordinates, of the client + * area, or `GLFW_DONT_CARE`. + * @param[in] minheight The minimum height, in screen coordinates, of the + * client area, or `GLFW_DONT_CARE`. + * @param[in] maxwidth The maximum width, in screen coordinates, of the client + * area, or `GLFW_DONT_CARE`. + * @param[in] maxheight The maximum height, in screen coordinates, of the + * client area, or `GLFW_DONT_CARE`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_VALUE and @ref GLFW_PLATFORM_ERROR. + * + * @remark If you set size limits and an aspect ratio that conflict, the + * results are undefined. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_sizelimits + * @sa glfwSetWindowAspectRatio + * + * @since Added in version 3.2. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowSizeLimits(GLFWwindow* window, int minwidth, int minheight, int maxwidth, int maxheight); + +/*! @brief Sets the aspect ratio of the specified window. + * + * This function sets the required aspect ratio of the client area of the + * specified window. If the window is full screen, the aspect ratio only takes + * effect once it is made windowed. If the window is not resizable, this + * function does nothing. + * + * The aspect ratio is specified as a numerator and a denominator and both + * values must be greater than zero. For example, the common 16:9 aspect ratio + * is specified as 16 and 9, respectively. + * + * If the numerator and denominator is set to `GLFW_DONT_CARE` then the aspect + * ratio limit is disabled. + * + * The aspect ratio is applied immediately to a windowed mode window and may + * cause it to be resized. + * + * @param[in] window The window to set limits for. + * @param[in] numer The numerator of the desired aspect ratio, or + * `GLFW_DONT_CARE`. + * @param[in] denom The denominator of the desired aspect ratio, or + * `GLFW_DONT_CARE`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_VALUE and @ref GLFW_PLATFORM_ERROR. + * + * @remark If you set size limits and an aspect ratio that conflict, the + * results are undefined. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_sizelimits + * @sa glfwSetWindowSizeLimits + * + * @since Added in version 3.2. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowAspectRatio(GLFWwindow* window, int numer, int denom); + +/*! @brief Sets the size of the client area of the specified window. + * + * This function sets the size, in screen coordinates, of the client area of + * the specified window. + * + * For full screen windows, this function updates the resolution of its desired + * video mode and switches to the video mode closest to it, without affecting + * the window's context. As the context is unaffected, the bit depths of the + * framebuffer remain unchanged. + * + * If you wish to update the refresh rate of the desired video mode in addition + * to its resolution, see @ref glfwSetWindowMonitor. + * + * The window manager may put limits on what sizes are allowed. GLFW cannot + * and should not override these limits. + * + * @param[in] window The window to resize. + * @param[in] width The desired width, in screen coordinates, of the window + * client area. + * @param[in] height The desired height, in screen coordinates, of the window + * client area. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_size + * @sa glfwGetWindowSize + * @sa glfwSetWindowMonitor + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowSize(GLFWwindow* window, int width, int height); + +/*! @brief Retrieves the size of the framebuffer of the specified window. + * + * This function retrieves the size, in pixels, of the framebuffer of the + * specified window. If you wish to retrieve the size of the window in screen + * coordinates, see @ref glfwGetWindowSize. + * + * Any or all of the size arguments may be `NULL`. If an error occurs, all + * non-`NULL` size arguments will be set to zero. + * + * @param[in] window The window whose framebuffer to query. + * @param[out] width Where to store the width, in pixels, of the framebuffer, + * or `NULL`. + * @param[out] height Where to store the height, in pixels, of the framebuffer, + * or `NULL`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_fbsize + * @sa glfwSetFramebufferSizeCallback + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI void glfwGetFramebufferSize(GLFWwindow* window, int* width, int* height); + +/*! @brief Retrieves the size of the frame of the window. + * + * This function retrieves the size, in screen coordinates, of each edge of the + * frame of the specified window. This size includes the title bar, if the + * window has one. The size of the frame may vary depending on the + * [window-related hints](@ref window_hints_wnd) used to create it. + * + * Because this function retrieves the size of each window frame edge and not + * the offset along a particular coordinate axis, the retrieved values will + * always be zero or positive. + * + * Any or all of the size arguments may be `NULL`. If an error occurs, all + * non-`NULL` size arguments will be set to zero. + * + * @param[in] window The window whose frame size to query. + * @param[out] left Where to store the size, in screen coordinates, of the left + * edge of the window frame, or `NULL`. + * @param[out] top Where to store the size, in screen coordinates, of the top + * edge of the window frame, or `NULL`. + * @param[out] right Where to store the size, in screen coordinates, of the + * right edge of the window frame, or `NULL`. + * @param[out] bottom Where to store the size, in screen coordinates, of the + * bottom edge of the window frame, or `NULL`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_size + * + * @since Added in version 3.1. + * + * @ingroup window + */ +GLFWAPI void glfwGetWindowFrameSize(GLFWwindow* window, int* left, int* top, int* right, int* bottom); + +/*! @brief Iconifies the specified window. + * + * This function iconifies (minimizes) the specified window if it was + * previously restored. If the window is already iconified, this function does + * nothing. + * + * If the specified window is a full screen window, the original monitor + * resolution is restored until the window is restored. + * + * @param[in] window The window to iconify. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_iconify + * @sa glfwRestoreWindow + * @sa glfwMaximizeWindow + * + * @since Added in version 2.1. + * @glfw3 Added window handle parameter. + * + * @ingroup window + */ +GLFWAPI void glfwIconifyWindow(GLFWwindow* window); + +/*! @brief Restores the specified window. + * + * This function restores the specified window if it was previously iconified + * (minimized) or maximized. If the window is already restored, this function + * does nothing. + * + * If the specified window is a full screen window, the resolution chosen for + * the window is restored on the selected monitor. + * + * @param[in] window The window to restore. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_iconify + * @sa glfwIconifyWindow + * @sa glfwMaximizeWindow + * + * @since Added in version 2.1. + * @glfw3 Added window handle parameter. + * + * @ingroup window + */ +GLFWAPI void glfwRestoreWindow(GLFWwindow* window); + +/*! @brief Maximizes the specified window. + * + * This function maximizes the specified window if it was previously not + * maximized. If the window is already maximized, this function does nothing. + * + * If the specified window is a full screen window, this function does nothing. + * + * @param[in] window The window to maximize. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @par Thread Safety + * This function may only be called from the main thread. + * + * @sa @ref window_iconify + * @sa glfwIconifyWindow + * @sa glfwRestoreWindow + * + * @since Added in GLFW 3.2. + * + * @ingroup window + */ +GLFWAPI void glfwMaximizeWindow(GLFWwindow* window); + +/*! @brief Makes the specified window visible. + * + * This function makes the specified window visible if it was previously + * hidden. If the window is already visible or is in full screen mode, this + * function does nothing. + * + * @param[in] window The window to make visible. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_hide + * @sa glfwHideWindow + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI void glfwShowWindow(GLFWwindow* window); + +/*! @brief Hides the specified window. + * + * This function hides the specified window if it was previously visible. If + * the window is already hidden or is in full screen mode, this function does + * nothing. + * + * @param[in] window The window to hide. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_hide + * @sa glfwShowWindow + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI void glfwHideWindow(GLFWwindow* window); + +/*! @brief Brings the specified window to front and sets input focus. + * + * This function brings the specified window to front and sets input focus. + * The window should already be visible and not iconified. + * + * By default, both windowed and full screen mode windows are focused when + * initially created. Set the [GLFW_FOCUSED](@ref window_hints_wnd) to disable + * this behavior. + * + * __Do not use this function__ to steal focus from other applications unless + * you are certain that is what the user wants. Focus stealing can be + * extremely disruptive. + * + * @param[in] window The window to give input focus. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_focus + * + * @since Added in version 3.2. + * + * @ingroup window + */ +GLFWAPI void glfwFocusWindow(GLFWwindow* window); + +/*! @brief Returns the monitor that the window uses for full screen mode. + * + * This function returns the handle of the monitor that the specified window is + * in full screen on. + * + * @param[in] window The window to query. + * @return The monitor, or `NULL` if the window is in windowed mode or an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_monitor + * @sa glfwSetWindowMonitor + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI GLFWmonitor* glfwGetWindowMonitor(GLFWwindow* window); + +/*! @brief Sets the mode, monitor, video mode and placement of a window. + * + * This function sets the monitor that the window uses for full screen mode or, + * if the monitor is `NULL`, makes it windowed mode. + * + * When setting a monitor, this function updates the width, height and refresh + * rate of the desired video mode and switches to the video mode closest to it. + * The window position is ignored when setting a monitor. + * + * When the monitor is `NULL`, the position, width and height are used to + * place the window client area. The refresh rate is ignored when no monitor + * is specified. + * + * If you only wish to update the resolution of a full screen window or the + * size of a windowed mode window, see @ref glfwSetWindowSize. + * + * When a window transitions from full screen to windowed mode, this function + * restores any previous window settings such as whether it is decorated, + * floating, resizable, has size or aspect ratio limits, etc.. + * + * @param[in] window The window whose monitor, size or video mode to set. + * @param[in] monitor The desired monitor, or `NULL` to set windowed mode. + * @param[in] xpos The desired x-coordinate of the upper-left corner of the + * client area. + * @param[in] ypos The desired y-coordinate of the upper-left corner of the + * client area. + * @param[in] width The desired with, in screen coordinates, of the client area + * or video mode. + * @param[in] height The desired height, in screen coordinates, of the client + * area or video mode. + * @param[in] refreshRate The desired refresh rate, in Hz, of the video mode, + * or `GLFW_DONT_CARE`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_monitor + * @sa @ref window_full_screen + * @sa glfwGetWindowMonitor + * @sa glfwSetWindowSize + * + * @since Added in version 3.2. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowMonitor(GLFWwindow* window, GLFWmonitor* monitor, int xpos, int ypos, int width, int height, int refreshRate); + +/*! @brief Returns an attribute of the specified window. + * + * This function returns the value of an attribute of the specified window or + * its OpenGL or OpenGL ES context. + * + * @param[in] window The window to query. + * @param[in] attrib The [window attribute](@ref window_attribs) whose value to + * return. + * @return The value of the attribute, or zero if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. + * + * @remark Framebuffer related hints are not window attributes. See @ref + * window_attribs_fb for more information. + * + * @remark Zero is a valid value for many window and context related + * attributes so you cannot use a return value of zero as an indication of + * errors. However, this function should not fail as long as it is passed + * valid arguments and the library has been [initialized](@ref intro_init). + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_attribs + * + * @since Added in version 3.0. Replaces `glfwGetWindowParam` and + * `glfwGetGLVersion`. + * + * @ingroup window + */ +GLFWAPI int glfwGetWindowAttrib(GLFWwindow* window, int attrib); + +/*! @brief Sets the user pointer of the specified window. + * + * This function sets the user-defined pointer of the specified window. The + * current value is retained until the window is destroyed. The initial value + * is `NULL`. + * + * @param[in] window The window whose pointer to set. + * @param[in] pointer The new value. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @sa @ref window_userptr + * @sa glfwGetWindowUserPointer + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI void glfwSetWindowUserPointer(GLFWwindow* window, void* pointer); + +/*! @brief Returns the user pointer of the specified window. + * + * This function returns the current value of the user-defined pointer of the + * specified window. The initial value is `NULL`. + * + * @param[in] window The window whose pointer to return. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @sa @ref window_userptr + * @sa glfwSetWindowUserPointer + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI void* glfwGetWindowUserPointer(GLFWwindow* window); + +/*! @brief Sets the position callback for the specified window. + * + * This function sets the position callback of the specified window, which is + * called when the window is moved. The callback is provided with the screen + * position of the upper-left corner of the client area of the window. + * + * @param[in] window The window whose callback to set. + * @param[in] cbfun The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_pos + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI GLFWwindowposfun glfwSetWindowPosCallback(GLFWwindow* window, GLFWwindowposfun cbfun); + +/*! @brief Sets the size callback for the specified window. + * + * This function sets the size callback of the specified window, which is + * called when the window is resized. The callback is provided with the size, + * in screen coordinates, of the client area of the window. + * + * @param[in] window The window whose callback to set. + * @param[in] cbfun The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_size + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter and return value. + * + * @ingroup window + */ +GLFWAPI GLFWwindowsizefun glfwSetWindowSizeCallback(GLFWwindow* window, GLFWwindowsizefun cbfun); + +/*! @brief Sets the close callback for the specified window. + * + * This function sets the close callback of the specified window, which is + * called when the user attempts to close the window, for example by clicking + * the close widget in the title bar. + * + * The close flag is set before this callback is called, but you can modify it + * at any time with @ref glfwSetWindowShouldClose. + * + * The close callback is not triggered by @ref glfwDestroyWindow. + * + * @param[in] window The window whose callback to set. + * @param[in] cbfun The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @remark @osx Selecting Quit from the application menu will trigger the close + * callback for all windows. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_close + * + * @since Added in version 2.5. + * @glfw3 Added window handle parameter and return value. + * + * @ingroup window + */ +GLFWAPI GLFWwindowclosefun glfwSetWindowCloseCallback(GLFWwindow* window, GLFWwindowclosefun cbfun); + +/*! @brief Sets the refresh callback for the specified window. + * + * This function sets the refresh callback of the specified window, which is + * called when the client area of the window needs to be redrawn, for example + * if the window has been exposed after having been covered by another window. + * + * On compositing window systems such as Aero, Compiz or Aqua, where the window + * contents are saved off-screen, this callback may be called only very + * infrequently or never at all. + * + * @param[in] window The window whose callback to set. + * @param[in] cbfun The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_refresh + * + * @since Added in version 2.5. + * @glfw3 Added window handle parameter and return value. + * + * @ingroup window + */ +GLFWAPI GLFWwindowrefreshfun glfwSetWindowRefreshCallback(GLFWwindow* window, GLFWwindowrefreshfun cbfun); + +/*! @brief Sets the focus callback for the specified window. + * + * This function sets the focus callback of the specified window, which is + * called when the window gains or loses input focus. + * + * After the focus callback is called for a window that lost input focus, + * synthetic key and mouse button release events will be generated for all such + * that had been pressed. For more information, see @ref glfwSetKeyCallback + * and @ref glfwSetMouseButtonCallback. + * + * @param[in] window The window whose callback to set. + * @param[in] cbfun The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_focus + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI GLFWwindowfocusfun glfwSetWindowFocusCallback(GLFWwindow* window, GLFWwindowfocusfun cbfun); + +/*! @brief Sets the iconify callback for the specified window. + * + * This function sets the iconification callback of the specified window, which + * is called when the window is iconified or restored. + * + * @param[in] window The window whose callback to set. + * @param[in] cbfun The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_iconify + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI GLFWwindowiconifyfun glfwSetWindowIconifyCallback(GLFWwindow* window, GLFWwindowiconifyfun cbfun); + +/*! @brief Sets the framebuffer resize callback for the specified window. + * + * This function sets the framebuffer resize callback of the specified window, + * which is called when the framebuffer of the specified window is resized. + * + * @param[in] window The window whose callback to set. + * @param[in] cbfun The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref window_fbsize + * + * @since Added in version 3.0. + * + * @ingroup window + */ +GLFWAPI GLFWframebuffersizefun glfwSetFramebufferSizeCallback(GLFWwindow* window, GLFWframebuffersizefun cbfun); + +/*! @brief Processes all pending events. + * + * This function processes only those events that are already in the event + * queue and then returns immediately. Processing events will cause the window + * and input callbacks associated with those events to be called. + * + * On some platforms, a window move, resize or menu operation will cause event + * processing to block. This is due to how event processing is designed on + * those platforms. You can use the + * [window refresh callback](@ref window_refresh) to redraw the contents of + * your window when necessary during such operations. + * + * On some platforms, certain events are sent directly to the application + * without going through the event queue, causing callbacks to be called + * outside of a call to one of the event processing functions. + * + * Event processing is not required for joystick input to work. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @reentrancy This function must not be called from a callback. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref events + * @sa glfwWaitEvents + * @sa glfwWaitEventsTimeout + * + * @since Added in version 1.0. + * + * @ingroup window + */ +GLFWAPI void glfwPollEvents(void); + +/*! @brief Waits until events are queued and processes them. + * + * This function puts the calling thread to sleep until at least one event is + * available in the event queue. Once one or more events are available, + * it behaves exactly like @ref glfwPollEvents, i.e. the events in the queue + * are processed and the function then returns immediately. Processing events + * will cause the window and input callbacks associated with those events to be + * called. + * + * Since not all events are associated with callbacks, this function may return + * without a callback having been called even if you are monitoring all + * callbacks. + * + * On some platforms, a window move, resize or menu operation will cause event + * processing to block. This is due to how event processing is designed on + * those platforms. You can use the + * [window refresh callback](@ref window_refresh) to redraw the contents of + * your window when necessary during such operations. + * + * On some platforms, certain callbacks may be called outside of a call to one + * of the event processing functions. + * + * If no windows exist, this function returns immediately. For synchronization + * of threads in applications that do not create windows, use your threading + * library of choice. + * + * Event processing is not required for joystick input to work. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @reentrancy This function must not be called from a callback. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref events + * @sa glfwPollEvents + * @sa glfwWaitEventsTimeout + * + * @since Added in version 2.5. + * + * @ingroup window + */ +GLFWAPI void glfwWaitEvents(void); + +/*! @brief Waits with timeout until events are queued and processes them. + * + * This function puts the calling thread to sleep until at least one event is + * available in the event queue, or until the specified timeout is reached. If + * one or more events are available, it behaves exactly like @ref + * glfwPollEvents, i.e. the events in the queue are processed and the function + * then returns immediately. Processing events will cause the window and input + * callbacks associated with those events to be called. + * + * The timeout value must be a positive finite number. + * + * Since not all events are associated with callbacks, this function may return + * without a callback having been called even if you are monitoring all + * callbacks. + * + * On some platforms, a window move, resize or menu operation will cause event + * processing to block. This is due to how event processing is designed on + * those platforms. You can use the + * [window refresh callback](@ref window_refresh) to redraw the contents of + * your window when necessary during such operations. + * + * On some platforms, certain callbacks may be called outside of a call to one + * of the event processing functions. + * + * If no windows exist, this function returns immediately. For synchronization + * of threads in applications that do not create windows, use your threading + * library of choice. + * + * Event processing is not required for joystick input to work. + * + * @param[in] timeout The maximum amount of time, in seconds, to wait. + * + * @reentrancy This function must not be called from a callback. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref events + * @sa glfwPollEvents + * @sa glfwWaitEvents + * + * @since Added in version 3.2. + * + * @ingroup window + */ +GLFWAPI void glfwWaitEventsTimeout(double timeout); + +/*! @brief Posts an empty event to the event queue. + * + * This function posts an empty event from the current thread to the event + * queue, causing @ref glfwWaitEvents or @ref glfwWaitEventsTimeout to return. + * + * If no windows exist, this function returns immediately. For synchronization + * of threads in applications that do not create windows, use your threading + * library of choice. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref events + * @sa glfwWaitEvents + * @sa glfwWaitEventsTimeout + * + * @since Added in version 3.1. + * + * @ingroup window + */ +GLFWAPI void glfwPostEmptyEvent(void); + +/*! @brief Returns the value of an input option for the specified window. + * + * This function returns the value of an input option for the specified window. + * The mode must be one of `GLFW_CURSOR`, `GLFW_STICKY_KEYS` or + * `GLFW_STICKY_MOUSE_BUTTONS`. + * + * @param[in] window The window to query. + * @param[in] mode One of `GLFW_CURSOR`, `GLFW_STICKY_KEYS` or + * `GLFW_STICKY_MOUSE_BUTTONS`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_INVALID_ENUM. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa glfwSetInputMode + * + * @since Added in version 3.0. + * + * @ingroup input + */ +GLFWAPI int glfwGetInputMode(GLFWwindow* window, int mode); + +/*! @brief Sets an input option for the specified window. + * + * This function sets an input mode option for the specified window. The mode + * must be one of `GLFW_CURSOR`, `GLFW_STICKY_KEYS` or + * `GLFW_STICKY_MOUSE_BUTTONS`. + * + * If the mode is `GLFW_CURSOR`, the value must be one of the following cursor + * modes: + * - `GLFW_CURSOR_NORMAL` makes the cursor visible and behaving normally. + * - `GLFW_CURSOR_HIDDEN` makes the cursor invisible when it is over the client + * area of the window but does not restrict the cursor from leaving. + * - `GLFW_CURSOR_DISABLED` hides and grabs the cursor, providing virtual + * and unlimited cursor movement. This is useful for implementing for + * example 3D camera controls. + * + * If the mode is `GLFW_STICKY_KEYS`, the value must be either `GLFW_TRUE` to + * enable sticky keys, or `GLFW_FALSE` to disable it. If sticky keys are + * enabled, a key press will ensure that @ref glfwGetKey returns `GLFW_PRESS` + * the next time it is called even if the key had been released before the + * call. This is useful when you are only interested in whether keys have been + * pressed but not when or in which order. + * + * If the mode is `GLFW_STICKY_MOUSE_BUTTONS`, the value must be either + * `GLFW_TRUE` to enable sticky mouse buttons, or `GLFW_FALSE` to disable it. + * If sticky mouse buttons are enabled, a mouse button press will ensure that + * @ref glfwGetMouseButton returns `GLFW_PRESS` the next time it is called even + * if the mouse button had been released before the call. This is useful when + * you are only interested in whether mouse buttons have been pressed but not + * when or in which order. + * + * @param[in] window The window whose input mode to set. + * @param[in] mode One of `GLFW_CURSOR`, `GLFW_STICKY_KEYS` or + * `GLFW_STICKY_MOUSE_BUTTONS`. + * @param[in] value The new value of the specified input mode. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa glfwGetInputMode + * + * @since Added in version 3.0. Replaces `glfwEnable` and `glfwDisable`. + * + * @ingroup input + */ +GLFWAPI void glfwSetInputMode(GLFWwindow* window, int mode, int value); + +/*! @brief Returns the localized name of the specified printable key. + * + * This function returns the localized name of the specified printable key. + * This is intended for displaying key bindings to the user. + * + * If the key is `GLFW_KEY_UNKNOWN`, the scancode is used instead, otherwise + * the scancode is ignored. If a non-printable key or (if the key is + * `GLFW_KEY_UNKNOWN`) a scancode that maps to a non-printable key is + * specified, this function returns `NULL`. + * + * This behavior allows you to pass in the arguments passed to the + * [key callback](@ref input_key) without modification. + * + * The printable keys are: + * - `GLFW_KEY_APOSTROPHE` + * - `GLFW_KEY_COMMA` + * - `GLFW_KEY_MINUS` + * - `GLFW_KEY_PERIOD` + * - `GLFW_KEY_SLASH` + * - `GLFW_KEY_SEMICOLON` + * - `GLFW_KEY_EQUAL` + * - `GLFW_KEY_LEFT_BRACKET` + * - `GLFW_KEY_RIGHT_BRACKET` + * - `GLFW_KEY_BACKSLASH` + * - `GLFW_KEY_WORLD_1` + * - `GLFW_KEY_WORLD_2` + * - `GLFW_KEY_0` to `GLFW_KEY_9` + * - `GLFW_KEY_A` to `GLFW_KEY_Z` + * - `GLFW_KEY_KP_0` to `GLFW_KEY_KP_9` + * - `GLFW_KEY_KP_DECIMAL` + * - `GLFW_KEY_KP_DIVIDE` + * - `GLFW_KEY_KP_MULTIPLY` + * - `GLFW_KEY_KP_SUBTRACT` + * - `GLFW_KEY_KP_ADD` + * - `GLFW_KEY_KP_EQUAL` + * + * @param[in] key The key to query, or `GLFW_KEY_UNKNOWN`. + * @param[in] scancode The scancode of the key to query. + * @return The localized name of the key, or `NULL`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The returned string is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the next call to @ref + * glfwGetKeyName, or until the library is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref input_key_name + * + * @since Added in version 3.2. + * + * @ingroup input + */ +GLFWAPI const char* glfwGetKeyName(int key, int scancode); + +/*! @brief Returns the last reported state of a keyboard key for the specified + * window. + * + * This function returns the last state reported for the specified key to the + * specified window. The returned state is one of `GLFW_PRESS` or + * `GLFW_RELEASE`. The higher-level action `GLFW_REPEAT` is only reported to + * the key callback. + * + * If the `GLFW_STICKY_KEYS` input mode is enabled, this function returns + * `GLFW_PRESS` the first time you call it for a key that was pressed, even if + * that key has already been released. + * + * The key functions deal with physical keys, with [key tokens](@ref keys) + * named after their use on the standard US keyboard layout. If you want to + * input text, use the Unicode character callback instead. + * + * The [modifier key bit masks](@ref mods) are not key tokens and cannot be + * used with this function. + * + * __Do not use this function__ to implement [text input](@ref input_char). + * + * @param[in] window The desired window. + * @param[in] key The desired [keyboard key](@ref keys). `GLFW_KEY_UNKNOWN` is + * not a valid key for this function. + * @return One of `GLFW_PRESS` or `GLFW_RELEASE`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_INVALID_ENUM. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref input_key + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter. + * + * @ingroup input + */ +GLFWAPI int glfwGetKey(GLFWwindow* window, int key); + +/*! @brief Returns the last reported state of a mouse button for the specified + * window. + * + * This function returns the last state reported for the specified mouse button + * to the specified window. The returned state is one of `GLFW_PRESS` or + * `GLFW_RELEASE`. + * + * If the `GLFW_STICKY_MOUSE_BUTTONS` input mode is enabled, this function + * `GLFW_PRESS` the first time you call it for a mouse button that was pressed, + * even if that mouse button has already been released. + * + * @param[in] window The desired window. + * @param[in] button The desired [mouse button](@ref buttons). + * @return One of `GLFW_PRESS` or `GLFW_RELEASE`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_INVALID_ENUM. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref input_mouse_button + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter. + * + * @ingroup input + */ +GLFWAPI int glfwGetMouseButton(GLFWwindow* window, int button); + +/*! @brief Retrieves the position of the cursor relative to the client area of + * the window. + * + * This function returns the position of the cursor, in screen coordinates, + * relative to the upper-left corner of the client area of the specified + * window. + * + * If the cursor is disabled (with `GLFW_CURSOR_DISABLED`) then the cursor + * position is unbounded and limited only by the minimum and maximum values of + * a `double`. + * + * The coordinate can be converted to their integer equivalents with the + * `floor` function. Casting directly to an integer type works for positive + * coordinates, but fails for negative ones. + * + * Any or all of the position arguments may be `NULL`. If an error occurs, all + * non-`NULL` position arguments will be set to zero. + * + * @param[in] window The desired window. + * @param[out] xpos Where to store the cursor x-coordinate, relative to the + * left edge of the client area, or `NULL`. + * @param[out] ypos Where to store the cursor y-coordinate, relative to the to + * top edge of the client area, or `NULL`. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref cursor_pos + * @sa glfwSetCursorPos + * + * @since Added in version 3.0. Replaces `glfwGetMousePos`. + * + * @ingroup input + */ +GLFWAPI void glfwGetCursorPos(GLFWwindow* window, double* xpos, double* ypos); + +/*! @brief Sets the position of the cursor, relative to the client area of the + * window. + * + * This function sets the position, in screen coordinates, of the cursor + * relative to the upper-left corner of the client area of the specified + * window. The window must have input focus. If the window does not have + * input focus when this function is called, it fails silently. + * + * __Do not use this function__ to implement things like camera controls. GLFW + * already provides the `GLFW_CURSOR_DISABLED` cursor mode that hides the + * cursor, transparently re-centers it and provides unconstrained cursor + * motion. See @ref glfwSetInputMode for more information. + * + * If the cursor mode is `GLFW_CURSOR_DISABLED` then the cursor position is + * unconstrained and limited only by the minimum and maximum values of + * a `double`. + * + * @param[in] window The desired window. + * @param[in] xpos The desired x-coordinate, relative to the left edge of the + * client area. + * @param[in] ypos The desired y-coordinate, relative to the top edge of the + * client area. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref cursor_pos + * @sa glfwGetCursorPos + * + * @since Added in version 3.0. Replaces `glfwSetMousePos`. + * + * @ingroup input + */ +GLFWAPI void glfwSetCursorPos(GLFWwindow* window, double xpos, double ypos); + +/*! @brief Creates a custom cursor. + * + * Creates a new custom cursor image that can be set for a window with @ref + * glfwSetCursor. The cursor can be destroyed with @ref glfwDestroyCursor. + * Any remaining cursors are destroyed by @ref glfwTerminate. + * + * The pixels are 32-bit, little-endian, non-premultiplied RGBA, i.e. eight + * bits per channel. They are arranged canonically as packed sequential rows, + * starting from the top-left corner. + * + * The cursor hotspot is specified in pixels, relative to the upper-left corner + * of the cursor image. Like all other coordinate systems in GLFW, the X-axis + * points to the right and the Y-axis points down. + * + * @param[in] image The desired cursor image. + * @param[in] xhot The desired x-coordinate, in pixels, of the cursor hotspot. + * @param[in] yhot The desired y-coordinate, in pixels, of the cursor hotspot. + * @return The handle of the created cursor, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The specified image data is copied before this function + * returns. + * + * @reentrancy This function must not be called from a callback. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref cursor_object + * @sa glfwDestroyCursor + * @sa glfwCreateStandardCursor + * + * @since Added in version 3.1. + * + * @ingroup input + */ +GLFWAPI GLFWcursor* glfwCreateCursor(const GLFWimage* image, int xhot, int yhot); + +/*! @brief Creates a cursor with a standard shape. + * + * Returns a cursor with a [standard shape](@ref shapes), that can be set for + * a window with @ref glfwSetCursor. + * + * @param[in] shape One of the [standard shapes](@ref shapes). + * @return A new cursor ready to use or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. + * + * @reentrancy This function must not be called from a callback. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref cursor_object + * @sa glfwCreateCursor + * + * @since Added in version 3.1. + * + * @ingroup input + */ +GLFWAPI GLFWcursor* glfwCreateStandardCursor(int shape); + +/*! @brief Destroys a cursor. + * + * This function destroys a cursor previously created with @ref + * glfwCreateCursor. Any remaining cursors will be destroyed by @ref + * glfwTerminate. + * + * @param[in] cursor The cursor object to destroy. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @reentrancy This function must not be called from a callback. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref cursor_object + * @sa glfwCreateCursor + * + * @since Added in version 3.1. + * + * @ingroup input + */ +GLFWAPI void glfwDestroyCursor(GLFWcursor* cursor); + +/*! @brief Sets the cursor for the window. + * + * This function sets the cursor image to be used when the cursor is over the + * client area of the specified window. The set cursor will only be visible + * when the [cursor mode](@ref cursor_mode) of the window is + * `GLFW_CURSOR_NORMAL`. + * + * On some platforms, the set cursor may not be visible unless the window also + * has input focus. + * + * @param[in] window The window to set the cursor for. + * @param[in] cursor The cursor to set, or `NULL` to switch back to the default + * arrow cursor. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref cursor_object + * + * @since Added in version 3.1. + * + * @ingroup input + */ +GLFWAPI void glfwSetCursor(GLFWwindow* window, GLFWcursor* cursor); + +/*! @brief Sets the key callback. + * + * This function sets the key callback of the specified window, which is called + * when a key is pressed, repeated or released. + * + * The key functions deal with physical keys, with layout independent + * [key tokens](@ref keys) named after their values in the standard US keyboard + * layout. If you want to input text, use the + * [character callback](@ref glfwSetCharCallback) instead. + * + * When a window loses input focus, it will generate synthetic key release + * events for all pressed keys. You can tell these events from user-generated + * events by the fact that the synthetic ones are generated after the focus + * loss event has been processed, i.e. after the + * [window focus callback](@ref glfwSetWindowFocusCallback) has been called. + * + * The scancode of a key is specific to that platform or sometimes even to that + * machine. Scancodes are intended to allow users to bind keys that don't have + * a GLFW key token. Such keys have `key` set to `GLFW_KEY_UNKNOWN`, their + * state is not saved and so it cannot be queried with @ref glfwGetKey. + * + * Sometimes GLFW needs to generate synthetic key events, in which case the + * scancode may be zero. + * + * @param[in] window The window whose callback to set. + * @param[in] cbfun The new key callback, or `NULL` to remove the currently + * set callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref input_key + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter and return value. + * + * @ingroup input + */ +GLFWAPI GLFWkeyfun glfwSetKeyCallback(GLFWwindow* window, GLFWkeyfun cbfun); + +/*! @brief Sets the Unicode character callback. + * + * This function sets the character callback of the specified window, which is + * called when a Unicode character is input. + * + * The character callback is intended for Unicode text input. As it deals with + * characters, it is keyboard layout dependent, whereas the + * [key callback](@ref glfwSetKeyCallback) is not. Characters do not map 1:1 + * to physical keys, as a key may produce zero, one or more characters. If you + * want to know whether a specific physical key was pressed or released, see + * the key callback instead. + * + * The character callback behaves as system text input normally does and will + * not be called if modifier keys are held down that would prevent normal text + * input on that platform, for example a Super (Command) key on OS X or Alt key + * on Windows. There is a + * [character with modifiers callback](@ref glfwSetCharModsCallback) that + * receives these events. + * + * @param[in] window The window whose callback to set. + * @param[in] cbfun The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref input_char + * + * @since Added in version 2.4. + * @glfw3 Added window handle parameter and return value. + * + * @ingroup input + */ +GLFWAPI GLFWcharfun glfwSetCharCallback(GLFWwindow* window, GLFWcharfun cbfun); + +/*! @brief Sets the Unicode character with modifiers callback. + * + * This function sets the character with modifiers callback of the specified + * window, which is called when a Unicode character is input regardless of what + * modifier keys are used. + * + * The character with modifiers callback is intended for implementing custom + * Unicode character input. For regular Unicode text input, see the + * [character callback](@ref glfwSetCharCallback). Like the character + * callback, the character with modifiers callback deals with characters and is + * keyboard layout dependent. Characters do not map 1:1 to physical keys, as + * a key may produce zero, one or more characters. If you want to know whether + * a specific physical key was pressed or released, see the + * [key callback](@ref glfwSetKeyCallback) instead. + * + * @param[in] window The window whose callback to set. + * @param[in] cbfun The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref input_char + * + * @since Added in version 3.1. + * + * @ingroup input + */ +GLFWAPI GLFWcharmodsfun glfwSetCharModsCallback(GLFWwindow* window, GLFWcharmodsfun cbfun); + +/*! @brief Sets the mouse button callback. + * + * This function sets the mouse button callback of the specified window, which + * is called when a mouse button is pressed or released. + * + * When a window loses input focus, it will generate synthetic mouse button + * release events for all pressed mouse buttons. You can tell these events + * from user-generated events by the fact that the synthetic ones are generated + * after the focus loss event has been processed, i.e. after the + * [window focus callback](@ref glfwSetWindowFocusCallback) has been called. + * + * @param[in] window The window whose callback to set. + * @param[in] cbfun The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref input_mouse_button + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter and return value. + * + * @ingroup input + */ +GLFWAPI GLFWmousebuttonfun glfwSetMouseButtonCallback(GLFWwindow* window, GLFWmousebuttonfun cbfun); + +/*! @brief Sets the cursor position callback. + * + * This function sets the cursor position callback of the specified window, + * which is called when the cursor is moved. The callback is provided with the + * position, in screen coordinates, relative to the upper-left corner of the + * client area of the window. + * + * @param[in] window The window whose callback to set. + * @param[in] cbfun The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref cursor_pos + * + * @since Added in version 3.0. Replaces `glfwSetMousePosCallback`. + * + * @ingroup input + */ +GLFWAPI GLFWcursorposfun glfwSetCursorPosCallback(GLFWwindow* window, GLFWcursorposfun cbfun); + +/*! @brief Sets the cursor enter/exit callback. + * + * This function sets the cursor boundary crossing callback of the specified + * window, which is called when the cursor enters or leaves the client area of + * the window. + * + * @param[in] window The window whose callback to set. + * @param[in] cbfun The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref cursor_enter + * + * @since Added in version 3.0. + * + * @ingroup input + */ +GLFWAPI GLFWcursorenterfun glfwSetCursorEnterCallback(GLFWwindow* window, GLFWcursorenterfun cbfun); + +/*! @brief Sets the scroll callback. + * + * This function sets the scroll callback of the specified window, which is + * called when a scrolling device is used, such as a mouse wheel or scrolling + * area of a touchpad. + * + * The scroll callback receives all scrolling input, like that from a mouse + * wheel or a touchpad scrolling area. + * + * @param[in] window The window whose callback to set. + * @param[in] cbfun The new scroll callback, or `NULL` to remove the currently + * set callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref scrolling + * + * @since Added in version 3.0. Replaces `glfwSetMouseWheelCallback`. + * + * @ingroup input + */ +GLFWAPI GLFWscrollfun glfwSetScrollCallback(GLFWwindow* window, GLFWscrollfun cbfun); + +/*! @brief Sets the file drop callback. + * + * This function sets the file drop callback of the specified window, which is + * called when one or more dragged files are dropped on the window. + * + * Because the path array and its strings may have been generated specifically + * for that event, they are not guaranteed to be valid after the callback has + * returned. If you wish to use them after the callback returns, you need to + * make a deep copy. + * + * @param[in] window The window whose callback to set. + * @param[in] cbfun The new file drop callback, or `NULL` to remove the + * currently set callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref path_drop + * + * @since Added in version 3.1. + * + * @ingroup input + */ +GLFWAPI GLFWdropfun glfwSetDropCallback(GLFWwindow* window, GLFWdropfun cbfun); + +/*! @brief Returns whether the specified joystick is present. + * + * This function returns whether the specified joystick is present. + * + * @param[in] joy The [joystick](@ref joysticks) to query. + * @return `GLFW_TRUE` if the joystick is present, or `GLFW_FALSE` otherwise. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref joystick + * + * @since Added in version 3.0. Replaces `glfwGetJoystickParam`. + * + * @ingroup input + */ +GLFWAPI int glfwJoystickPresent(int joy); + +/*! @brief Returns the values of all axes of the specified joystick. + * + * This function returns the values of all axes of the specified joystick. + * Each element in the array is a value between -1.0 and 1.0. + * + * Querying a joystick slot with no device present is not an error, but will + * cause this function to return `NULL`. Call @ref glfwJoystickPresent to + * check device presence. + * + * @param[in] joy The [joystick](@ref joysticks) to query. + * @param[out] count Where to store the number of axis values in the returned + * array. This is set to zero if the joystick is not present or an error + * occurred. + * @return An array of axis values, or `NULL` if the joystick is not present or + * an [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The returned array is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the specified joystick is + * disconnected, this function is called again for that joystick or the library + * is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref joystick_axis + * + * @since Added in version 3.0. Replaces `glfwGetJoystickPos`. + * + * @ingroup input + */ +GLFWAPI const float* glfwGetJoystickAxes(int joy, int* count); + +/*! @brief Returns the state of all buttons of the specified joystick. + * + * This function returns the state of all buttons of the specified joystick. + * Each element in the array is either `GLFW_PRESS` or `GLFW_RELEASE`. + * + * Querying a joystick slot with no device present is not an error, but will + * cause this function to return `NULL`. Call @ref glfwJoystickPresent to + * check device presence. + * + * @param[in] joy The [joystick](@ref joysticks) to query. + * @param[out] count Where to store the number of button states in the returned + * array. This is set to zero if the joystick is not present or an error + * occurred. + * @return An array of button states, or `NULL` if the joystick is not present + * or an [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The returned array is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the specified joystick is + * disconnected, this function is called again for that joystick or the library + * is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref joystick_button + * + * @since Added in version 2.2. + * @glfw3 Changed to return a dynamic array. + * + * @ingroup input + */ +GLFWAPI const unsigned char* glfwGetJoystickButtons(int joy, int* count); + +/*! @brief Returns the name of the specified joystick. + * + * This function returns the name, encoded as UTF-8, of the specified joystick. + * The returned string is allocated and freed by GLFW. You should not free it + * yourself. + * + * Querying a joystick slot with no device present is not an error, but will + * cause this function to return `NULL`. Call @ref glfwJoystickPresent to + * check device presence. + * + * @param[in] joy The [joystick](@ref joysticks) to query. + * @return The UTF-8 encoded name of the joystick, or `NULL` if the joystick + * is not present or an [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_INVALID_ENUM and @ref GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The returned string is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the specified joystick is + * disconnected, this function is called again for that joystick or the library + * is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref joystick_name + * + * @since Added in version 3.0. + * + * @ingroup input + */ +GLFWAPI const char* glfwGetJoystickName(int joy); + +/*! @brief Sets the joystick configuration callback. + * + * This function sets the joystick configuration callback, or removes the + * currently set callback. This is called when a joystick is connected to or + * disconnected from the system. + * + * @param[in] cbfun The new callback, or `NULL` to remove the currently set + * callback. + * @return The previously set callback, or `NULL` if no callback was set or the + * library had not been [initialized](@ref intro_init). + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref joystick_event + * + * @since Added in version 3.2. + * + * @ingroup input + */ +GLFWAPI GLFWjoystickfun glfwSetJoystickCallback(GLFWjoystickfun cbfun); + +/*! @brief Sets the clipboard to the specified string. + * + * This function sets the system clipboard to the specified, UTF-8 encoded + * string. + * + * @param[in] window The window that will own the clipboard contents. + * @param[in] string A UTF-8 encoded string. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The specified string is copied before this function + * returns. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref clipboard + * @sa glfwGetClipboardString + * + * @since Added in version 3.0. + * + * @ingroup input + */ +GLFWAPI void glfwSetClipboardString(GLFWwindow* window, const char* string); + +/*! @brief Returns the contents of the clipboard as a string. + * + * This function returns the contents of the system clipboard, if it contains + * or is convertible to a UTF-8 encoded string. If the clipboard is empty or + * if its contents cannot be converted, `NULL` is returned and a @ref + * GLFW_FORMAT_UNAVAILABLE error is generated. + * + * @param[in] window The window that will request the clipboard contents. + * @return The contents of the clipboard as a UTF-8 encoded string, or `NULL` + * if an [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_PLATFORM_ERROR. + * + * @pointer_lifetime The returned string is allocated and freed by GLFW. You + * should not free it yourself. It is valid until the next call to @ref + * glfwGetClipboardString or @ref glfwSetClipboardString, or until the library + * is terminated. + * + * @thread_safety This function must only be called from the main thread. + * + * @sa @ref clipboard + * @sa glfwSetClipboardString + * + * @since Added in version 3.0. + * + * @ingroup input + */ +GLFWAPI const char* glfwGetClipboardString(GLFWwindow* window); + +/*! @brief Returns the value of the GLFW timer. + * + * This function returns the value of the GLFW timer. Unless the timer has + * been set using @ref glfwSetTime, the timer measures time elapsed since GLFW + * was initialized. + * + * The resolution of the timer is system dependent, but is usually on the order + * of a few micro- or nanoseconds. It uses the highest-resolution monotonic + * time source on each supported platform. + * + * @return The current value, in seconds, or zero if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. Reading and + * writing of the internal timer offset is not atomic, so it needs to be + * externally synchronized with calls to @ref glfwSetTime. + * + * @sa @ref time + * + * @since Added in version 1.0. + * + * @ingroup input + */ +GLFWAPI double glfwGetTime(void); + +/*! @brief Sets the GLFW timer. + * + * This function sets the value of the GLFW timer. It then continues to count + * up from that value. The value must be a positive finite number less than + * or equal to 18446744073.0, which is approximately 584.5 years. + * + * @param[in] time The new value, in seconds. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_INVALID_VALUE. + * + * @remark The upper limit of the timer is calculated as + * floor((264 - 1) / 109) and is due to implementations + * storing nanoseconds in 64 bits. The limit may be increased in the future. + * + * @thread_safety This function may be called from any thread. Reading and + * writing of the internal timer offset is not atomic, so it needs to be + * externally synchronized with calls to @ref glfwGetTime. + * + * @sa @ref time + * + * @since Added in version 2.2. + * + * @ingroup input + */ +GLFWAPI void glfwSetTime(double time); + +/*! @brief Returns the current value of the raw timer. + * + * This function returns the current value of the raw timer, measured in + * 1 / frequency seconds. To get the frequency, call @ref + * glfwGetTimerFrequency. + * + * @return The value of the timer, or zero if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref time + * @sa glfwGetTimerFrequency + * + * @since Added in version 3.2. + * + * @ingroup input + */ +GLFWAPI uint64_t glfwGetTimerValue(void); + +/*! @brief Returns the frequency, in Hz, of the raw timer. + * + * This function returns the frequency, in Hz, of the raw timer. + * + * @return The frequency of the timer, in Hz, or zero if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref time + * @sa glfwGetTimerValue + * + * @since Added in version 3.2. + * + * @ingroup input + */ +GLFWAPI uint64_t glfwGetTimerFrequency(void); + +/*! @brief Makes the context of the specified window current for the calling + * thread. + * + * This function makes the OpenGL or OpenGL ES context of the specified window + * current on the calling thread. A context can only be made current on + * a single thread at a time and each thread can have only a single current + * context at a time. + * + * By default, making a context non-current implicitly forces a pipeline flush. + * On machines that support `GL_KHR_context_flush_control`, you can control + * whether a context performs this flush by setting the + * [GLFW_CONTEXT_RELEASE_BEHAVIOR](@ref window_hints_ctx) window hint. + * + * The specified window must have an OpenGL or OpenGL ES context. Specifying + * a window without a context will generate a @ref GLFW_NO_WINDOW_CONTEXT + * error. + * + * @param[in] window The window whose context to make current, or `NULL` to + * detach the current context. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_NO_WINDOW_CONTEXT and @ref GLFW_PLATFORM_ERROR. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref context_current + * @sa glfwGetCurrentContext + * + * @since Added in version 3.0. + * + * @ingroup context + */ +GLFWAPI void glfwMakeContextCurrent(GLFWwindow* window); + +/*! @brief Returns the window whose context is current on the calling thread. + * + * This function returns the window whose OpenGL or OpenGL ES context is + * current on the calling thread. + * + * @return The window whose context is current, or `NULL` if no window's + * context is current. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref context_current + * @sa glfwMakeContextCurrent + * + * @since Added in version 3.0. + * + * @ingroup context + */ +GLFWAPI GLFWwindow* glfwGetCurrentContext(void); + +/*! @brief Swaps the front and back buffers of the specified window. + * + * This function swaps the front and back buffers of the specified window when + * rendering with OpenGL or OpenGL ES. If the swap interval is greater than + * zero, the GPU driver waits the specified number of screen updates before + * swapping the buffers. + * + * The specified window must have an OpenGL or OpenGL ES context. Specifying + * a window without a context will generate a @ref GLFW_NO_WINDOW_CONTEXT + * error. + * + * This function does not apply to Vulkan. If you are rendering with Vulkan, + * see `vkQueuePresentKHR` instead. + * + * @param[in] window The window whose buffers to swap. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_NO_WINDOW_CONTEXT and @ref GLFW_PLATFORM_ERROR. + * + * @remark __EGL:__ The context of the specified window must be current on the + * calling thread. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref buffer_swap + * @sa glfwSwapInterval + * + * @since Added in version 1.0. + * @glfw3 Added window handle parameter. + * + * @ingroup window + */ +GLFWAPI void glfwSwapBuffers(GLFWwindow* window); + +/*! @brief Sets the swap interval for the current context. + * + * This function sets the swap interval for the current OpenGL or OpenGL ES + * context, i.e. the number of screen updates to wait from the time @ref + * glfwSwapBuffers was called before swapping the buffers and returning. This + * is sometimes called _vertical synchronization_, _vertical retrace + * synchronization_ or just _vsync_. + * + * Contexts that support either of the `WGL_EXT_swap_control_tear` and + * `GLX_EXT_swap_control_tear` extensions also accept negative swap intervals, + * which allow the driver to swap even if a frame arrives a little bit late. + * You can check for the presence of these extensions using @ref + * glfwExtensionSupported. For more information about swap tearing, see the + * extension specifications. + * + * A context must be current on the calling thread. Calling this function + * without a current context will cause a @ref GLFW_NO_CURRENT_CONTEXT error. + * + * This function does not apply to Vulkan. If you are rendering with Vulkan, + * see the present mode of your swapchain instead. + * + * @param[in] interval The minimum number of screen updates to wait for + * until the buffers are swapped by @ref glfwSwapBuffers. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_NO_CURRENT_CONTEXT and @ref GLFW_PLATFORM_ERROR. + * + * @remark This function is not called during context creation, leaving the + * swap interval set to whatever is the default on that platform. This is done + * because some swap interval extensions used by GLFW do not allow the swap + * interval to be reset to zero once it has been set to a non-zero value. + * + * @remark Some GPU drivers do not honor the requested swap interval, either + * because of a user setting that overrides the application's request or due to + * bugs in the driver. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref buffer_swap + * @sa glfwSwapBuffers + * + * @since Added in version 1.0. + * + * @ingroup context + */ +GLFWAPI void glfwSwapInterval(int interval); + +/*! @brief Returns whether the specified extension is available. + * + * This function returns whether the specified + * [API extension](@ref context_glext) is supported by the current OpenGL or + * OpenGL ES context. It searches both for client API extension and context + * creation API extensions. + * + * A context must be current on the calling thread. Calling this function + * without a current context will cause a @ref GLFW_NO_CURRENT_CONTEXT error. + * + * As this functions retrieves and searches one or more extension strings each + * call, it is recommended that you cache its results if it is going to be used + * frequently. The extension strings will not change during the lifetime of + * a context, so there is no danger in doing this. + * + * This function does not apply to Vulkan. If you are using Vulkan, see @ref + * glfwGetRequiredInstanceExtensions, `vkEnumerateInstanceExtensionProperties` + * and `vkEnumerateDeviceExtensionProperties` instead. + * + * @param[in] extension The ASCII encoded name of the extension. + * @return `GLFW_TRUE` if the extension is available, or `GLFW_FALSE` + * otherwise. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_NO_CURRENT_CONTEXT, @ref GLFW_INVALID_VALUE and @ref + * GLFW_PLATFORM_ERROR. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref context_glext + * @sa glfwGetProcAddress + * + * @since Added in version 1.0. + * + * @ingroup context + */ +GLFWAPI int glfwExtensionSupported(const char* extension); + +/*! @brief Returns the address of the specified function for the current + * context. + * + * This function returns the address of the specified OpenGL or OpenGL ES + * [core or extension function](@ref context_glext), if it is supported + * by the current context. + * + * A context must be current on the calling thread. Calling this function + * without a current context will cause a @ref GLFW_NO_CURRENT_CONTEXT error. + * + * This function does not apply to Vulkan. If you are rendering with Vulkan, + * see @ref glfwGetInstanceProcAddress, `vkGetInstanceProcAddr` and + * `vkGetDeviceProcAddr` instead. + * + * @param[in] procname The ASCII encoded name of the function. + * @return The address of the function, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_NO_CURRENT_CONTEXT and @ref GLFW_PLATFORM_ERROR. + * + * @remark The address of a given function is not guaranteed to be the same + * between contexts. + * + * @remark This function may return a non-`NULL` address despite the + * associated version or extension not being available. Always check the + * context version or extension string first. + * + * @pointer_lifetime The returned function pointer is valid until the context + * is destroyed or the library is terminated. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref context_glext + * @sa glfwExtensionSupported + * + * @since Added in version 1.0. + * + * @ingroup context + */ +GLFWAPI GLFWglproc glfwGetProcAddress(const char* procname); + +/*! @brief Returns whether the Vulkan loader has been found. + * + * This function returns whether the Vulkan loader has been found. This check + * is performed by @ref glfwInit. + * + * The availability of a Vulkan loader does not by itself guarantee that window + * surface creation or even device creation is possible. Call @ref + * glfwGetRequiredInstanceExtensions to check whether the extensions necessary + * for Vulkan surface creation are available and @ref + * glfwGetPhysicalDevicePresentationSupport to check whether a queue family of + * a physical device supports image presentation. + * + * @return `GLFW_TRUE` if Vulkan is available, or `GLFW_FALSE` otherwise. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref vulkan_support + * + * @since Added in version 3.2. + * + * @ingroup vulkan + */ +GLFWAPI int glfwVulkanSupported(void); + +/*! @brief Returns the Vulkan instance extensions required by GLFW. + * + * This function returns an array of names of Vulkan instance extensions required + * by GLFW for creating Vulkan surfaces for GLFW windows. If successful, the + * list will always contains `VK_KHR_surface`, so if you don't require any + * additional extensions you can pass this list directly to the + * `VkInstanceCreateInfo` struct. + * + * If Vulkan is not available on the machine, this function returns `NULL` and + * generates a @ref GLFW_API_UNAVAILABLE error. Call @ref glfwVulkanSupported + * to check whether Vulkan is available. + * + * If Vulkan is available but no set of extensions allowing window surface + * creation was found, this function returns `NULL`. You may still use Vulkan + * for off-screen rendering and compute work. + * + * @param[out] count Where to store the number of extensions in the returned + * array. This is set to zero if an error occurred. + * @return An array of ASCII encoded extension names, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_API_UNAVAILABLE. + * + * @remarks Additional extensions may be required by future versions of GLFW. + * You should check if any extensions you wish to enable are already in the + * returned array, as it is an error to specify an extension more than once in + * the `VkInstanceCreateInfo` struct. + * + * @pointer_lifetime The returned array is allocated and freed by GLFW. You + * should not free it yourself. It is guaranteed to be valid only until the + * library is terminated. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref vulkan_ext + * @sa glfwCreateWindowSurface + * + * @since Added in version 3.2. + * + * @ingroup vulkan + */ +GLFWAPI const char** glfwGetRequiredInstanceExtensions(uint32_t* count); + +#if defined(VK_VERSION_1_0) + +/*! @brief Returns the address of the specified Vulkan instance function. + * + * This function returns the address of the specified Vulkan core or extension + * function for the specified instance. If instance is set to `NULL` it can + * return any function exported from the Vulkan loader, including at least the + * following functions: + * + * - `vkEnumerateInstanceExtensionProperties` + * - `vkEnumerateInstanceLayerProperties` + * - `vkCreateInstance` + * - `vkGetInstanceProcAddr` + * + * If Vulkan is not available on the machine, this function returns `NULL` and + * generates a @ref GLFW_API_UNAVAILABLE error. Call @ref glfwVulkanSupported + * to check whether Vulkan is available. + * + * This function is equivalent to calling `vkGetInstanceProcAddr` with + * a platform-specific query of the Vulkan loader as a fallback. + * + * @param[in] instance The Vulkan instance to query, or `NULL` to retrieve + * functions related to instance creation. + * @param[in] procname The ASCII encoded name of the function. + * @return The address of the function, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED and @ref + * GLFW_API_UNAVAILABLE. + * + * @pointer_lifetime The returned function pointer is valid until the library + * is terminated. + * + * @thread_safety This function may be called from any thread. + * + * @sa @ref vulkan_proc + * + * @since Added in version 3.2. + * + * @ingroup vulkan + */ +GLFWAPI GLFWvkproc glfwGetInstanceProcAddress(VkInstance instance, const char* procname); + +/*! @brief Returns whether the specified queue family can present images. + * + * This function returns whether the specified queue family of the specified + * physical device supports presentation to the platform GLFW was built for. + * + * If Vulkan or the required window surface creation instance extensions are + * not available on the machine, or if the specified instance was not created + * with the required extensions, this function returns `GLFW_FALSE` and + * generates a @ref GLFW_API_UNAVAILABLE error. Call @ref glfwVulkanSupported + * to check whether Vulkan is available and @ref + * glfwGetRequiredInstanceExtensions to check what instance extensions are + * required. + * + * @param[in] instance The instance that the physical device belongs to. + * @param[in] device The physical device that the queue family belongs to. + * @param[in] queuefamily The index of the queue family to query. + * @return `GLFW_TRUE` if the queue family supports presentation, or + * `GLFW_FALSE` otherwise. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_API_UNAVAILABLE and @ref GLFW_PLATFORM_ERROR. + * + * @thread_safety This function may be called from any thread. For + * synchronization details of Vulkan objects, see the Vulkan specification. + * + * @sa @ref vulkan_present + * + * @since Added in version 3.2. + * + * @ingroup vulkan + */ +GLFWAPI int glfwGetPhysicalDevicePresentationSupport(VkInstance instance, VkPhysicalDevice device, uint32_t queuefamily); + +/*! @brief Creates a Vulkan surface for the specified window. + * + * This function creates a Vulkan surface for the specified window. + * + * If the Vulkan loader was not found at initialization, this function returns + * `VK_ERROR_INITIALIZATION_FAILED` and generates a @ref GLFW_API_UNAVAILABLE + * error. Call @ref glfwVulkanSupported to check whether the Vulkan loader was + * found. + * + * If the required window surface creation instance extensions are not + * available or if the specified instance was not created with these extensions + * enabled, this function returns `VK_ERROR_EXTENSION_NOT_PRESENT` and + * generates a @ref GLFW_API_UNAVAILABLE error. Call @ref + * glfwGetRequiredInstanceExtensions to check what instance extensions are + * required. + * + * The window surface must be destroyed before the specified Vulkan instance. + * It is the responsibility of the caller to destroy the window surface. GLFW + * does not destroy it for you. Call `vkDestroySurfaceKHR` to destroy the + * surface. + * + * @param[in] instance The Vulkan instance to create the surface in. + * @param[in] window The window to create the surface for. + * @param[in] allocator The allocator to use, or `NULL` to use the default + * allocator. + * @param[out] surface Where to store the handle of the surface. This is set + * to `VK_NULL_HANDLE` if an error occurred. + * @return `VK_SUCCESS` if successful, or a Vulkan error code if an + * [error](@ref error_handling) occurred. + * + * @errors Possible errors include @ref GLFW_NOT_INITIALIZED, @ref + * GLFW_API_UNAVAILABLE and @ref GLFW_PLATFORM_ERROR. + * + * @remarks If an error occurs before the creation call is made, GLFW returns + * the Vulkan error code most appropriate for the error. Appropriate use of + * @ref glfwVulkanSupported and @ref glfwGetRequiredInstanceExtensions should + * eliminate almost all occurrences of these errors. + * + * @thread_safety This function may be called from any thread. For + * synchronization details of Vulkan objects, see the Vulkan specification. + * + * @sa @ref vulkan_surface + * @sa glfwGetRequiredInstanceExtensions + * + * @since Added in version 3.2. + * + * @ingroup vulkan + */ +GLFWAPI VkResult glfwCreateWindowSurface(VkInstance instance, GLFWwindow* window, const VkAllocationCallbacks* allocator, VkSurfaceKHR* surface); + +#endif /*VK_VERSION_1_0*/ + + +/************************************************************************* + * Global definition cleanup + *************************************************************************/ + +/* ------------------- BEGIN SYSTEM/COMPILER SPECIFIC -------------------- */ + +#ifdef GLFW_WINGDIAPI_DEFINED + #undef WINGDIAPI + #undef GLFW_WINGDIAPI_DEFINED +#endif + +#ifdef GLFW_CALLBACK_DEFINED + #undef CALLBACK + #undef GLFW_CALLBACK_DEFINED +#endif + +/* -------------------- END SYSTEM/COMPILER SPECIFIC --------------------- */ + + +#ifdef __cplusplus +} +#endif + +#endif /* _glfw3_h_ */ + diff --git a/engine/inc/GLFW/glfw3native.h b/engine/inc/GLFW/glfw3native.h new file mode 100644 index 00000000..30e1a570 --- /dev/null +++ b/engine/inc/GLFW/glfw3native.h @@ -0,0 +1,456 @@ +/************************************************************************* + * GLFW 3.2 - www.glfw.org + * A library for OpenGL, window and input + *------------------------------------------------------------------------ + * Copyright (c) 2002-2006 Marcus Geelnard + * Copyright (c) 2006-2016 Camilla Berglund + * + * This software is provided 'as-is', without any express or implied + * warranty. In no event will the authors be held liable for any damages + * arising from the use of this software. + * + * Permission is granted to anyone to use this software for any purpose, + * including commercial applications, and to alter it and redistribute it + * freely, subject to the following restrictions: + * + * 1. The origin of this software must not be misrepresented; you must not + * claim that you wrote the original software. If you use this software + * in a product, an acknowledgment in the product documentation would + * be appreciated but is not required. + * + * 2. Altered source versions must be plainly marked as such, and must not + * be misrepresented as being the original software. + * + * 3. This notice may not be removed or altered from any source + * distribution. + * + *************************************************************************/ + +#ifndef _glfw3_native_h_ +#define _glfw3_native_h_ + +#ifdef __cplusplus +extern "C" { +#endif + + +/************************************************************************* + * Doxygen documentation + *************************************************************************/ + +/*! @file glfw3native.h + * @brief The header of the native access functions. + * + * This is the header file of the native access functions. See @ref native for + * more information. + */ +/*! @defgroup native Native access + * + * **By using the native access functions you assert that you know what you're + * doing and how to fix problems caused by using them. If you don't, you + * shouldn't be using them.** + * + * Before the inclusion of @ref glfw3native.h, you may define exactly one + * window system API macro and zero or more context creation API macros. + * + * The chosen backends must match those the library was compiled for. Failure + * to do this will cause a link-time error. + * + * The available window API macros are: + * * `GLFW_EXPOSE_NATIVE_WIN32` + * * `GLFW_EXPOSE_NATIVE_COCOA` + * * `GLFW_EXPOSE_NATIVE_X11` + * * `GLFW_EXPOSE_NATIVE_WAYLAND` + * * `GLFW_EXPOSE_NATIVE_MIR` + * + * The available context API macros are: + * * `GLFW_EXPOSE_NATIVE_WGL` + * * `GLFW_EXPOSE_NATIVE_NSGL` + * * `GLFW_EXPOSE_NATIVE_GLX` + * * `GLFW_EXPOSE_NATIVE_EGL` + * + * These macros select which of the native access functions that are declared + * and which platform-specific headers to include. It is then up your (by + * definition platform-specific) code to handle which of these should be + * defined. + */ + + +/************************************************************************* + * System headers and types + *************************************************************************/ + +#if defined(GLFW_EXPOSE_NATIVE_WIN32) + // This is a workaround for the fact that glfw3.h needs to export APIENTRY (for + // example to allow applications to correctly declare a GL_ARB_debug_output + // callback) but windows.h assumes no one will define APIENTRY before it does + #undef APIENTRY + #include +#elif defined(GLFW_EXPOSE_NATIVE_COCOA) + #include + #if defined(__OBJC__) + #import + #else + typedef void* id; + #endif +#elif defined(GLFW_EXPOSE_NATIVE_X11) + #include + #include +#elif defined(GLFW_EXPOSE_NATIVE_WAYLAND) + #include +#elif defined(GLFW_EXPOSE_NATIVE_MIR) + #include +#endif + +#if defined(GLFW_EXPOSE_NATIVE_WGL) + /* WGL is declared by windows.h */ +#endif +#if defined(GLFW_EXPOSE_NATIVE_NSGL) + /* NSGL is declared by Cocoa.h */ +#endif +#if defined(GLFW_EXPOSE_NATIVE_GLX) + #include +#endif +#if defined(GLFW_EXPOSE_NATIVE_EGL) + #include +#endif + + +/************************************************************************* + * Functions + *************************************************************************/ + +#if defined(GLFW_EXPOSE_NATIVE_WIN32) +/*! @brief Returns the adapter device name of the specified monitor. + * + * @return The UTF-8 encoded adapter device name (for example `\\.\DISPLAY1`) + * of the specified monitor, or `NULL` if an [error](@ref error_handling) + * occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.1. + * + * @ingroup native + */ +GLFWAPI const char* glfwGetWin32Adapter(GLFWmonitor* monitor); + +/*! @brief Returns the display device name of the specified monitor. + * + * @return The UTF-8 encoded display device name (for example + * `\\.\DISPLAY1\Monitor0`) of the specified monitor, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.1. + * + * @ingroup native + */ +GLFWAPI const char* glfwGetWin32Monitor(GLFWmonitor* monitor); + +/*! @brief Returns the `HWND` of the specified window. + * + * @return The `HWND` of the specified window, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.0. + * + * @ingroup native + */ +GLFWAPI HWND glfwGetWin32Window(GLFWwindow* window); +#endif + +#if defined(GLFW_EXPOSE_NATIVE_WGL) +/*! @brief Returns the `HGLRC` of the specified window. + * + * @return The `HGLRC` of the specified window, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.0. + * + * @ingroup native + */ +GLFWAPI HGLRC glfwGetWGLContext(GLFWwindow* window); +#endif + +#if defined(GLFW_EXPOSE_NATIVE_COCOA) +/*! @brief Returns the `CGDirectDisplayID` of the specified monitor. + * + * @return The `CGDirectDisplayID` of the specified monitor, or + * `kCGNullDirectDisplay` if an [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.1. + * + * @ingroup native + */ +GLFWAPI CGDirectDisplayID glfwGetCocoaMonitor(GLFWmonitor* monitor); + +/*! @brief Returns the `NSWindow` of the specified window. + * + * @return The `NSWindow` of the specified window, or `nil` if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.0. + * + * @ingroup native + */ +GLFWAPI id glfwGetCocoaWindow(GLFWwindow* window); +#endif + +#if defined(GLFW_EXPOSE_NATIVE_NSGL) +/*! @brief Returns the `NSOpenGLContext` of the specified window. + * + * @return The `NSOpenGLContext` of the specified window, or `nil` if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.0. + * + * @ingroup native + */ +GLFWAPI id glfwGetNSGLContext(GLFWwindow* window); +#endif + +#if defined(GLFW_EXPOSE_NATIVE_X11) +/*! @brief Returns the `Display` used by GLFW. + * + * @return The `Display` used by GLFW, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.0. + * + * @ingroup native + */ +GLFWAPI Display* glfwGetX11Display(void); + +/*! @brief Returns the `RRCrtc` of the specified monitor. + * + * @return The `RRCrtc` of the specified monitor, or `None` if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.1. + * + * @ingroup native + */ +GLFWAPI RRCrtc glfwGetX11Adapter(GLFWmonitor* monitor); + +/*! @brief Returns the `RROutput` of the specified monitor. + * + * @return The `RROutput` of the specified monitor, or `None` if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.1. + * + * @ingroup native + */ +GLFWAPI RROutput glfwGetX11Monitor(GLFWmonitor* monitor); + +/*! @brief Returns the `Window` of the specified window. + * + * @return The `Window` of the specified window, or `None` if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.0. + * + * @ingroup native + */ +GLFWAPI Window glfwGetX11Window(GLFWwindow* window); +#endif + +#if defined(GLFW_EXPOSE_NATIVE_GLX) +/*! @brief Returns the `GLXContext` of the specified window. + * + * @return The `GLXContext` of the specified window, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.0. + * + * @ingroup native + */ +GLFWAPI GLXContext glfwGetGLXContext(GLFWwindow* window); + +/*! @brief Returns the `GLXWindow` of the specified window. + * + * @return The `GLXWindow` of the specified window, or `None` if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.2. + * + * @ingroup native + */ +GLFWAPI GLXWindow glfwGetGLXWindow(GLFWwindow* window); +#endif + +#if defined(GLFW_EXPOSE_NATIVE_WAYLAND) +/*! @brief Returns the `struct wl_display*` used by GLFW. + * + * @return The `struct wl_display*` used by GLFW, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.2. + * + * @ingroup native + */ +GLFWAPI struct wl_display* glfwGetWaylandDisplay(void); + +/*! @brief Returns the `struct wl_output*` of the specified monitor. + * + * @return The `struct wl_output*` of the specified monitor, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.2. + * + * @ingroup native + */ +GLFWAPI struct wl_output* glfwGetWaylandMonitor(GLFWmonitor* monitor); + +/*! @brief Returns the main `struct wl_surface*` of the specified window. + * + * @return The main `struct wl_surface*` of the specified window, or `NULL` if + * an [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.2. + * + * @ingroup native + */ +GLFWAPI struct wl_surface* glfwGetWaylandWindow(GLFWwindow* window); +#endif + +#if defined(GLFW_EXPOSE_NATIVE_MIR) +/*! @brief Returns the `MirConnection*` used by GLFW. + * + * @return The `MirConnection*` used by GLFW, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.2. + * + * @ingroup native + */ +GLFWAPI MirConnection* glfwGetMirDisplay(void); + +/*! @brief Returns the Mir output ID of the specified monitor. + * + * @return The Mir output ID of the specified monitor, or zero if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.2. + * + * @ingroup native + */ +GLFWAPI int glfwGetMirMonitor(GLFWmonitor* monitor); + +/*! @brief Returns the `MirSurface*` of the specified window. + * + * @return The `MirSurface*` of the specified window, or `NULL` if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.2. + * + * @ingroup native + */ +GLFWAPI MirSurface* glfwGetMirWindow(GLFWwindow* window); +#endif + +#if defined(GLFW_EXPOSE_NATIVE_EGL) +/*! @brief Returns the `EGLDisplay` used by GLFW. + * + * @return The `EGLDisplay` used by GLFW, or `EGL_NO_DISPLAY` if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.0. + * + * @ingroup native + */ +GLFWAPI EGLDisplay glfwGetEGLDisplay(void); + +/*! @brief Returns the `EGLContext` of the specified window. + * + * @return The `EGLContext` of the specified window, or `EGL_NO_CONTEXT` if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.0. + * + * @ingroup native + */ +GLFWAPI EGLContext glfwGetEGLContext(GLFWwindow* window); + +/*! @brief Returns the `EGLSurface` of the specified window. + * + * @return The `EGLSurface` of the specified window, or `EGL_NO_SURFACE` if an + * [error](@ref error_handling) occurred. + * + * @thread_safety This function may be called from any thread. Access is not + * synchronized. + * + * @since Added in version 3.0. + * + * @ingroup native + */ +GLFWAPI EGLSurface glfwGetEGLSurface(GLFWwindow* window); +#endif + +#ifdef __cplusplus +} +#endif + +#endif /* _glfw3_native_h_ */ + diff --git a/engine/inc/Host.h b/engine/inc/Host.h new file mode 100644 index 00000000..47de25c4 --- /dev/null +++ b/engine/inc/Host.h @@ -0,0 +1,254 @@ +/*---------------------------------------------------------------------------*/ +/* */ +/* Host.h - Basic header file to provide cross-platform solutions via */ +/* macros, conditional compilation, etc. */ +/* */ +/* Author : Mark Carrier (mark@carrierlabs.com) */ +/* */ +/*---------------------------------------------------------------------------*/ +/* Copyright (c) 2007 CarrierLabs, LLC. All rights reserved. + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions + * are met: + * + * 1. Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * + * 2. Redistributions in binary form must reproduce the above copyright + * notice, this list of conditions and the following disclaimer in + * the documentation and/or other materials provided with the + * distribution. + * + * 3. The name of the author may not be used to endorse or promote products + * derived from this software without specific prior written permission. + * + * 4. The name "CarrierLabs" must not be used to + * endorse or promote products derived from this software without + * prior written permission. For written permission, please contact + * mark@carrierlabs.com. + * + * THIS SOFTWARE IS PROVIDED BY MARK CARRIER ``AS IS'' AND ANY + * EXPRESSED OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE + * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR + * PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL MARK CARRIER OR + * ITS CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, + * SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT + * NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; + * LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) + * HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, + * STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) + * ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED + * OF THE POSSIBILITY OF SUCH DAMAGE. + *----------------------------------------------------------------------------*/ +#ifndef __HOST_H__ +#define __HOST_H__ + +#include + +#ifdef __cplusplus +extern "C" +{ +#endif + +/*---------------------------------------------------------------------------*/ +/* */ +/* Type Definition Macros */ +/* */ +/*---------------------------------------------------------------------------*/ +#ifndef __WORDSIZE +/* Assume 32 */ +#define __WORDSIZE 32 +#endif + +#if defined(_LINUX) || defined(_DARWIN) || defined(_BSD) + typedef unsigned char uint8; + typedef char int8; + typedef unsigned short uint16; + typedef short int16; + typedef unsigned int uint32; + typedef int int32; + typedef int SOCKET; +#endif + +#ifdef WIN32 + struct iovec + { + void *iov_base; + size_t iov_len; + }; + + typedef unsigned char uint8; + typedef char int8; + typedef unsigned short uint16; + typedef short int16; + typedef unsigned int uint32; + typedef int int32; +#endif + +#ifdef WIN32 + typedef int socklen_t; +#endif + +#if defined(WIN32) + typedef unsigned long long int uint64; + typedef long long int int64; +#elif (__WORDSIZE == 32) +__extension__ typedef long long int int64; +__extension__ typedef unsigned long long int uint64; +#elif (__WORDSIZE == 64) +typedef unsigned long int uint64; +typedef long int int64; +#endif + +#ifdef WIN32 + +#ifndef UINT8_MAX +#define UINT8_MAX (UCHAR_MAX) +#endif +#ifndef UINT16_MAX +#define UINT16_MAX (USHRT_MAX) +#endif +#ifndef UINT32_MAX +#define UINT32_MAX (ULONG_MAX) +#endif + +#if __WORDSIZE == 64 +#define SIZE_MAX (18446744073709551615UL) +#else +#ifndef SIZE_MAX +#define SIZE_MAX (4294967295U) +#endif +#endif +#endif + +#if defined(WIN32) +#define ssize_t size_t +#endif + +#ifndef TRUE +#define TRUE 1 +#endif + +#ifndef FALSE +#define FALSE 0 +#endif + +#ifndef htonll +#ifdef _BIG_ENDIAN +#define htonll(x) (x) +#define ntohll(x) (x) +#else +#define htonll(x) ((((uint64)htonl(x)) << 32) + htonl(x >> 32)) +#define ntohll(x) ((((uint64)ntohl(x)) << 32) + ntohl(x >> 32)) +#endif +#endif + +/*---------------------------------------------------------------------------*/ +/* */ +/* Socket Macros */ +/* */ +/*---------------------------------------------------------------------------*/ +#ifdef WIN32 +#define SHUT_RD 0 +#define SHUT_WR 1 +#define SHUT_RDWR 2 +#define ACCEPT(a, b, c) accept(a, b, c) +#define CONNECT(a, b, c) connect(a, b, c) +#define CLOSE(a) closesocket(a) +#define READ(a, b, c) read(a, b, c) +#define RECV(a, b, c, d) recv(a, (char *)b, c, d) +#define RECVFROM(a, b, c, d, e, f) recvfrom(a, (char *)b, c, d, (sockaddr *)e, (int *)f) +#define RECV_FLAGS MSG_WAITALL +#define SELECT(a, b, c, d, e) select((int32)a, b, c, d, e) +#define SEND(a, b, c, d) send(a, (const char *)b, (int)c, d) +#define SENDTO(a, b, c, d, e, f) sendto(a, (const char *)b, (int)c, d, e, f) +#define SEND_FLAGS 0 +#define SENDFILE(a, b, c, d) sendfile(a, b, c, d) +#define SET_SOCKET_ERROR(x, y) errno = y +#define SOCKET_ERROR_INTERUPT EINTR +#define SOCKET_ERROR_TIMEDOUT EAGAIN +#define WRITE(a, b, c) write(a, b, c) +#define WRITEV(a, b, c) Writev(b, c) +#define GETSOCKOPT(a, b, c, d, e) getsockopt(a, b, c, (char *)d, (int *)e) +#define SETSOCKOPT(a, b, c, d, e) setsockopt(a, b, c, (char *)d, (int)e) +#define GETHOSTBYNAME(a) gethostbyname(a) +#endif + +#if defined(_LINUX) || defined(_DARWIN) || defined(_BSD) +#define ACCEPT(a, b, c) accept(a, b, c) +#define CONNECT(a, b, c) connect(a, b, c) +#define CLOSE(a) close(a) +#define READ(a, b, c) read(a, b, c) +#define RECV(a, b, c, d) recv(a, (void *)b, c, d) +#define RECVFROM(a, b, c, d, e, f) recvfrom(a, (char *)b, c, d, (sockaddr *)e, f) +#define RECV_FLAGS MSG_WAITALL +#define SELECT(a, b, c, d, e) select(a, b, c, d, e) +#define SEND(a, b, c, d) send(a, (const int8 *)b, c, d) +#define SENDTO(a, b, c, d, e, f) sendto(a, (const int8 *)b, c, d, e, f) +#define SEND_FLAGS 0 +#define SENDFILE(a, b, c, d) sendfile(a, b, c, d) +#define SET_SOCKET_ERROR(x, y) errno = y +#define SOCKET_ERROR_INTERUPT EINTR +#define SOCKET_ERROR_TIMEDOUT EAGAIN +#define WRITE(a, b, c) write(a, b, c) +#define WRITEV(a, b, c) writev(a, b, c) +#define GETSOCKOPT(a, b, c, d, e) getsockopt((int)a, (int)b, (int)c, (void *)d, (socklen_t *)e) +#define SETSOCKOPT(a, b, c, d, e) setsockopt((int)a, (int)b, (int)c, (const void *)d, (int)e) +#define GETHOSTBYNAME(a) gethostbyname(a) +#endif + +/*---------------------------------------------------------------------------*/ +/* */ +/* File Macros */ +/* */ +/*---------------------------------------------------------------------------*/ +#define STRUCT_STAT struct stat +#define LSTAT(x, y) lstat(x, y) +#define FILE_HANDLE FILE * +#define CLEARERR(x) clearerr(x) +#define FCLOSE(x) fclose(x) +#define FEOF(x) feof(x) +#define FERROR(x) ferror(x) +#define FFLUSH(x) fflush(x) +#define FILENO(s) fileno(s) +#define FOPEN(x, y) fopen(x, y) + //#define FREAD(a,b,c,d) fread(a, b, c, d) +#define FSTAT(s, st) fstat(FILENO(s), st) + //#define FWRITE(a,b,c,d) fwrite(a, b, c, d) +#define STAT_BLK_SIZE(x) ((x).st_blksize) + +/*---------------------------------------------------------------------------*/ +/* */ +/* Misc Macros */ +/* */ +/*---------------------------------------------------------------------------*/ +#if defined(WIN32) +#define GET_CLOCK_COUNT(x) QueryPerformanceCounter((LARGE_INTEGER *)x) +#else +#define GET_CLOCK_COUNT(x) gettimeofday(x, NULL) +#endif + +#if defined(WIN32) +#define STRTOULL(x) _atoi64(x) +#else +#define STRTOULL(x) strtoull(x, NULL, 10) +#endif + +#if defined(WIN32) +#define SNPRINTF _snprintf +#define PRINTF printf +#define VPRINTF vprintf +#define FPRINTF fprintf +#else +#define SNPRINTF snprintf +#define PRINTF printf +#define VPRINTF vprintf +#define FPRINTF fprintf +#endif + +#ifdef __cplusplus +} +#endif + +#endif /* __HOST_H__ */ diff --git a/engine/inc/JavaScriptCore/JSBase.h b/engine/inc/JavaScriptCore/JSBase.h new file mode 100644 index 00000000..7a354dec --- /dev/null +++ b/engine/inc/JavaScriptCore/JSBase.h @@ -0,0 +1,155 @@ +/* + * Copyright (C) 2006 Apple Inc. All rights reserved. + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions + * are met: + * 1. Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * 2. Redistributions in binary form must reproduce the above copyright + * notice, this list of conditions and the following disclaimer in the + * documentation and/or other materials provided with the distribution. + * + * THIS SOFTWARE IS PROVIDED BY APPLE INC. ``AS IS'' AND ANY + * EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE + * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR + * PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL APPLE INC. OR + * CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, + * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, + * PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR + * PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY + * OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT + * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE + * OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + */ + +#ifndef JSBase_h +#define JSBase_h + +#ifndef __cplusplus +#include +#endif + +#ifdef __OBJC__ +#import +#endif + +/* JavaScript engine interface */ + +/*! @typedef JSContextGroupRef A group that associates JavaScript contexts with one another. Contexts in the same group may share and exchange JavaScript objects. */ +typedef const struct OpaqueJSContextGroup* JSContextGroupRef; + +/*! @typedef JSContextRef A JavaScript execution context. Holds the global object and other execution state. */ +typedef const struct OpaqueJSContext* JSContextRef; + +/*! @typedef JSGlobalContextRef A global JavaScript execution context. A JSGlobalContext is a JSContext. */ +typedef struct OpaqueJSContext* JSGlobalContextRef; + +/*! @typedef JSStringRef A UTF16 character buffer. The fundamental string representation in JavaScript. */ +typedef struct OpaqueJSString* JSStringRef; + +/*! @typedef JSClassRef A JavaScript class. Used with JSObjectMake to construct objects with custom behavior. */ +typedef struct OpaqueJSClass* JSClassRef; + +/*! @typedef JSPropertyNameArrayRef An array of JavaScript property names. */ +typedef struct OpaqueJSPropertyNameArray* JSPropertyNameArrayRef; + +/*! @typedef JSPropertyNameAccumulatorRef An ordered set used to collect the names of a JavaScript object's properties. */ +typedef struct OpaqueJSPropertyNameAccumulator* JSPropertyNameAccumulatorRef; + +/*! @typedef JSTypedArrayBytesDeallocator A function used to deallocate bytes passed to a Typed Array constructor. The function should take two arguments. The first is a pointer to the bytes that were originally passed to the Typed Array constructor. The second is a pointer to additional information desired at the time the bytes are to be freed. */ +typedef void (*JSTypedArrayBytesDeallocator)(void* bytes, void* deallocatorContext); + +/* JavaScript data types */ + +/*! @typedef JSValueRef A JavaScript value. The base type for all JavaScript values, and polymorphic functions on them. */ +typedef const struct OpaqueJSValue* JSValueRef; + +/*! @typedef JSObjectRef A JavaScript object. A JSObject is a JSValue. */ +typedef struct OpaqueJSValue* JSObjectRef; + +/* Clang's __has_declspec_attribute emulation */ +/* https://clang.llvm.org/docs/LanguageExtensions.html#has-declspec-attribute */ + +#ifndef __has_declspec_attribute +#define __has_declspec_attribute(x) 0 +#endif + +/* JavaScript symbol exports */ +/* These rules should stay the same as in WebKit/Shared/API/c/WKDeclarationSpecifiers.h */ + +#undef JS_EXPORT +#if defined(JS_NO_EXPORT) +#define JS_EXPORT +#elif defined(WIN32) || defined(_WIN32) || defined(__CC_ARM) || defined(__ARMCC__) || (__has_declspec_attribute(dllimport) && __has_declspec_attribute(dllexport)) +#if defined(BUILDING_JavaScriptCore) || defined(STATICALLY_LINKED_WITH_JavaScriptCore) +#define JS_EXPORT __declspec(dllexport) +#else +#define JS_EXPORT __declspec(dllimport) +#endif +#elif defined(__GNUC__) +#define JS_EXPORT __attribute__((visibility("default"))) +#else /* !defined(JS_NO_EXPORT) */ +#define JS_EXPORT +#endif /* defined(JS_NO_EXPORT) */ + +#ifdef __cplusplus +extern "C" { +#endif + +/* Script Evaluation */ + +/*! +@function JSEvaluateScript +@abstract Evaluates a string of JavaScript. +@param ctx The execution context to use. +@param script A JSString containing the script to evaluate. +@param thisObject The object to use as "this," or NULL to use the global object as "this." +@param sourceURL A JSString containing a URL for the script's source file. This is used by debuggers and when reporting exceptions. Pass NULL if you do not care to include source file information. +@param startingLineNumber An integer value specifying the script's starting line number in the file located at sourceURL. This is only used when reporting exceptions. The value is one-based, so the first line is line 1 and invalid values are clamped to 1. +@param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. +@result The JSValue that results from evaluating script, or NULL if an exception is thrown. +*/ +JS_EXPORT JSValueRef JSEvaluateScript(JSContextRef ctx, JSStringRef script, JSObjectRef thisObject, JSStringRef sourceURL, int startingLineNumber, JSValueRef* exception); + +/*! +@function JSCheckScriptSyntax +@abstract Checks for syntax errors in a string of JavaScript. +@param ctx The execution context to use. +@param script A JSString containing the script to check for syntax errors. +@param sourceURL A JSString containing a URL for the script's source file. This is only used when reporting exceptions. Pass NULL if you do not care to include source file information in exceptions. +@param startingLineNumber An integer value specifying the script's starting line number in the file located at sourceURL. This is only used when reporting exceptions. The value is one-based, so the first line is line 1 and invalid values are clamped to 1. +@param exception A pointer to a JSValueRef in which to store a syntax error exception, if any. Pass NULL if you do not care to store a syntax error exception. +@result true if the script is syntactically correct, otherwise false. +*/ +JS_EXPORT bool JSCheckScriptSyntax(JSContextRef ctx, JSStringRef script, JSStringRef sourceURL, int startingLineNumber, JSValueRef* exception); + +/*! +@function JSGarbageCollect +@abstract Performs a JavaScript garbage collection. +@param ctx The execution context to use. +@discussion JavaScript values that are on the machine stack, in a register, + protected by JSValueProtect, set as the global object of an execution context, + or reachable from any such value will not be collected. + + During JavaScript execution, you are not required to call this function; the + JavaScript engine will garbage collect as needed. JavaScript values created + within a context group are automatically destroyed when the last reference + to the context group is released. +*/ +JS_EXPORT void JSGarbageCollect(JSContextRef ctx); + +#ifdef __cplusplus +} +#endif + +/* Enable the Objective-C API for platforms with a modern runtime. NOTE: This is duplicated in VM.h. */ +#if !defined(JSC_OBJC_API_ENABLED) +#if (defined(__clang__) && defined(__APPLE__) && ((defined(__MAC_OS_X_VERSION_MIN_REQUIRED) && !defined(__i386__)) || (defined(TARGET_OS_IPHONE) && TARGET_OS_IPHONE))) +#define JSC_OBJC_API_ENABLED 1 +#else +#define JSC_OBJC_API_ENABLED 0 +#endif +#endif + +#endif /* JSBase_h */ diff --git a/engine/inc/JavaScriptCore/JSContextRef.h b/engine/inc/JavaScriptCore/JSContextRef.h new file mode 100644 index 00000000..36a41314 --- /dev/null +++ b/engine/inc/JavaScriptCore/JSContextRef.h @@ -0,0 +1,163 @@ +/* + * Copyright (C) 2006 Apple Inc. All rights reserved. + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions + * are met: + * 1. Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * 2. Redistributions in binary form must reproduce the above copyright + * notice, this list of conditions and the following disclaimer in the + * documentation and/or other materials provided with the distribution. + * + * THIS SOFTWARE IS PROVIDED BY APPLE INC. ``AS IS'' AND ANY + * EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE + * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR + * PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL APPLE INC. OR + * CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, + * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, + * PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR + * PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY + * OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT + * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE + * OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + */ + +#ifndef JSContextRef_h +#define JSContextRef_h + +#include +#include +#include + +#ifndef __cplusplus +#include +#endif + +#ifdef __cplusplus +extern "C" { +#endif + +/*! +@function +@abstract Creates a JavaScript context group. +@discussion A JSContextGroup associates JavaScript contexts with one another. + Contexts in the same group may share and exchange JavaScript objects. Sharing and/or exchanging + JavaScript objects between contexts in different groups will produce undefined behavior. + When objects from the same context group are used in multiple threads, explicit + synchronization is required. + + A JSContextGroup may need to run deferred tasks on a run loop, such as garbage collection + or resolving WebAssembly compilations. By default, calling JSContextGroupCreate will use + the run loop of the thread it was called on. Currently, there is no API to change a + JSContextGroup's run loop once it has been created. +@result The created JSContextGroup. +*/ +JS_EXPORT JSContextGroupRef JSContextGroupCreate(void) JSC_API_AVAILABLE(macos(10.6), ios(7.0)); + +/*! +@function +@abstract Retains a JavaScript context group. +@param group The JSContextGroup to retain. +@result A JSContextGroup that is the same as group. +*/ +JS_EXPORT JSContextGroupRef JSContextGroupRetain(JSContextGroupRef group) JSC_API_AVAILABLE(macos(10.6), ios(7.0)); + +/*! +@function +@abstract Releases a JavaScript context group. +@param group The JSContextGroup to release. +*/ +JS_EXPORT void JSContextGroupRelease(JSContextGroupRef group) JSC_API_AVAILABLE(macos(10.6), ios(7.0)); + +/*! +@function +@abstract Creates a global JavaScript execution context. +@discussion JSGlobalContextCreate allocates a global object and populates it with all the + built-in JavaScript objects, such as Object, Function, String, and Array. + + In WebKit version 4.0 and later, the context is created in a unique context group. + Therefore, scripts may execute in it concurrently with scripts executing in other contexts. + However, you may not use values created in the context in other contexts. +@param globalObjectClass The class to use when creating the global object. Pass + NULL to use the default object class. +@result A JSGlobalContext with a global object of class globalObjectClass. +*/ +JS_EXPORT JSGlobalContextRef JSGlobalContextCreate(JSClassRef globalObjectClass) JSC_API_AVAILABLE(macos(10.5), ios(7.0)); + +/*! +@function +@abstract Creates a global JavaScript execution context in the context group provided. +@discussion JSGlobalContextCreateInGroup allocates a global object and populates it with + all the built-in JavaScript objects, such as Object, Function, String, and Array. +@param globalObjectClass The class to use when creating the global object. Pass + NULL to use the default object class. +@param group The context group to use. The created global context retains the group. + Pass NULL to create a unique group for the context. +@result A JSGlobalContext with a global object of class globalObjectClass and a context + group equal to group. +*/ +JS_EXPORT JSGlobalContextRef JSGlobalContextCreateInGroup(JSContextGroupRef group, JSClassRef globalObjectClass) JSC_API_AVAILABLE(macos(10.6), ios(7.0)); + +/*! +@function +@abstract Retains a global JavaScript execution context. +@param ctx The JSGlobalContext to retain. +@result A JSGlobalContext that is the same as ctx. +*/ +JS_EXPORT JSGlobalContextRef JSGlobalContextRetain(JSGlobalContextRef ctx); + +/*! +@function +@abstract Releases a global JavaScript execution context. +@param ctx The JSGlobalContext to release. +*/ +JS_EXPORT void JSGlobalContextRelease(JSGlobalContextRef ctx); + +/*! +@function +@abstract Gets the global object of a JavaScript execution context. +@param ctx The JSContext whose global object you want to get. +@result ctx's global object. +*/ +JS_EXPORT JSObjectRef JSContextGetGlobalObject(JSContextRef ctx); + +/*! +@function +@abstract Gets the context group to which a JavaScript execution context belongs. +@param ctx The JSContext whose group you want to get. +@result ctx's group. +*/ +JS_EXPORT JSContextGroupRef JSContextGetGroup(JSContextRef ctx) JSC_API_AVAILABLE(macos(10.6), ios(7.0)); + +/*! +@function +@abstract Gets the global context of a JavaScript execution context. +@param ctx The JSContext whose global context you want to get. +@result ctx's global context. +*/ +JS_EXPORT JSGlobalContextRef JSContextGetGlobalContext(JSContextRef ctx) JSC_API_AVAILABLE(macos(10.7), ios(7.0)); + +/*! +@function +@abstract Gets a copy of the name of a context. +@param ctx The JSGlobalContext whose name you want to get. +@result The name for ctx. +@discussion A JSGlobalContext's name is exposed for remote debugging to make it +easier to identify the context you would like to attach to. +*/ +JS_EXPORT JSStringRef JSGlobalContextCopyName(JSGlobalContextRef ctx) JSC_API_AVAILABLE(macos(10.10), ios(8.0)); + +/*! +@function +@abstract Sets the remote debugging name for a context. +@param ctx The JSGlobalContext that you want to name. +@param name The remote debugging name to set on ctx. +*/ +JS_EXPORT void JSGlobalContextSetName(JSGlobalContextRef ctx, JSStringRef name) JSC_API_AVAILABLE(macos(10.10), ios(8.0)); + +#ifdef __cplusplus +} +#endif + +#endif /* JSContextRef_h */ diff --git a/engine/inc/JavaScriptCore/JSObjectRef.h b/engine/inc/JavaScriptCore/JSObjectRef.h new file mode 100644 index 00000000..a3e3ffa3 --- /dev/null +++ b/engine/inc/JavaScriptCore/JSObjectRef.h @@ -0,0 +1,856 @@ +/* + * Copyright (C) 2006-2019 Apple Inc. All rights reserved. + * Copyright (C) 2008 Kelvin W Sherlock (ksherlock@gmail.com) + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions + * are met: + * 1. Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * 2. Redistributions in binary form must reproduce the above copyright + * notice, this list of conditions and the following disclaimer in the + * documentation and/or other materials provided with the distribution. + * + * THIS SOFTWARE IS PROVIDED BY APPLE INC. ``AS IS'' AND ANY + * EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE + * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR + * PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL APPLE INC. OR + * CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, + * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, + * PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR + * PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY + * OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT + * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE + * OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + */ + +#ifndef JSObjectRef_h +#define JSObjectRef_h + +#include +#include +#include + +#ifndef __cplusplus +#include +#endif +#include /* for size_t */ + +#ifdef __cplusplus +extern "C" { +#endif + +/*! +@enum JSPropertyAttribute +@constant kJSPropertyAttributeNone Specifies that a property has no special attributes. +@constant kJSPropertyAttributeReadOnly Specifies that a property is read-only. +@constant kJSPropertyAttributeDontEnum Specifies that a property should not be enumerated by JSPropertyEnumerators and JavaScript for...in loops. +@constant kJSPropertyAttributeDontDelete Specifies that the delete operation should fail on a property. +*/ +enum { + kJSPropertyAttributeNone = 0, + kJSPropertyAttributeReadOnly = 1 << 1, + kJSPropertyAttributeDontEnum = 1 << 2, + kJSPropertyAttributeDontDelete = 1 << 3 +}; + +/*! +@typedef JSPropertyAttributes +@abstract A set of JSPropertyAttributes. Combine multiple attributes by logically ORing them together. +*/ +typedef unsigned JSPropertyAttributes; + +/*! +@enum JSClassAttribute +@constant kJSClassAttributeNone Specifies that a class has no special attributes. +@constant kJSClassAttributeNoAutomaticPrototype Specifies that a class should not automatically generate a shared prototype for its instance objects. Use kJSClassAttributeNoAutomaticPrototype in combination with JSObjectSetPrototype to manage prototypes manually. +*/ +enum { + kJSClassAttributeNone = 0, + kJSClassAttributeNoAutomaticPrototype = 1 << 1 +}; + +/*! +@typedef JSClassAttributes +@abstract A set of JSClassAttributes. Combine multiple attributes by logically ORing them together. +*/ +typedef unsigned JSClassAttributes; + +/*! +@typedef JSObjectInitializeCallback +@abstract The callback invoked when an object is first created. +@param ctx The execution context to use. +@param object The JSObject being created. +@discussion If you named your function Initialize, you would declare it like this: + +void Initialize(JSContextRef ctx, JSObjectRef object); + +Unlike the other object callbacks, the initialize callback is called on the least +derived class (the parent class) first, and the most derived class last. +*/ +typedef void +(*JSObjectInitializeCallback) (JSContextRef ctx, JSObjectRef object); + +/* Extension of the above callback with the class that the method is being invoked for. */ +typedef void +(*JSObjectInitializeCallbackEx) (JSContextRef ctx, JSClassRef jsClass, JSObjectRef object); + +/*! +@typedef JSObjectFinalizeCallback +@abstract The callback invoked when an object is finalized (prepared for garbage collection). An object may be finalized on any thread. +@param object The JSObject being finalized. +@discussion If you named your function Finalize, you would declare it like this: + +void Finalize(JSObjectRef object); + +The finalize callback is called on the most derived class first, and the least +derived class (the parent class) last. + +You must not call any function that may cause a garbage collection or an allocation +of a garbage collected object from within a JSObjectFinalizeCallback. This includes +all functions that have a JSContextRef parameter. +*/ +typedef void +(*JSObjectFinalizeCallback) (JSObjectRef object); + +/* Extension of the above callback with the class that the method is being invoked for. */ +typedef void +(*JSObjectFinalizeCallbackEx) (JSClassRef jsClass, JSObjectRef object); + +/*! +@typedef JSObjectHasPropertyCallback +@abstract The callback invoked when determining whether an object has a property. +@param ctx The execution context to use. +@param object The JSObject to search for the property. +@param propertyName A JSString containing the name of the property look up. +@result true if object has the property, otherwise false. +@discussion If you named your function HasProperty, you would declare it like this: + +bool HasProperty(JSContextRef ctx, JSObjectRef object, JSStringRef propertyName); + +If this function returns false, the hasProperty request forwards to object's statically declared properties, then its parent class chain (which includes the default object class), then its prototype chain. + +This callback enables optimization in cases where only a property's existence needs to be known, not its value, and computing its value would be expensive. + +If this callback is NULL, the getProperty callback will be used to service hasProperty requests. +*/ +typedef bool +(*JSObjectHasPropertyCallback) (JSContextRef ctx, JSObjectRef object, JSStringRef propertyName); + +/* Extension of the above callback with the class that the method is being invoked for. */ +typedef bool +(*JSObjectHasPropertyCallbackEx) (JSContextRef ctx, JSClassRef jsClass, JSObjectRef object, JSStringRef propertyName); + +/*! +@typedef JSObjectGetPropertyCallback +@abstract The callback invoked when getting a property's value. +@param ctx The execution context to use. +@param object The JSObject to search for the property. +@param propertyName A JSString containing the name of the property to get. +@param exception A pointer to a JSValueRef in which to return an exception, if any. +@result The property's value if object has the property, otherwise NULL. +@discussion If you named your function GetProperty, you would declare it like this: + +JSValueRef GetProperty(JSContextRef ctx, JSObjectRef object, JSStringRef propertyName, JSValueRef* exception); + +If this function returns NULL, the get request forwards to object's statically declared properties, then its parent class chain (which includes the default object class), then its prototype chain. +*/ +typedef JSValueRef +(*JSObjectGetPropertyCallback) (JSContextRef ctx, JSObjectRef object, JSStringRef propertyName, JSValueRef* exception); + +/* Extension of the above callback with the class that the method is being invoked for. */ +typedef JSValueRef +(*JSObjectGetPropertyCallbackEx) (JSContextRef ctx, JSClassRef jsClass, JSObjectRef object, JSStringRef propertyName, JSValueRef* exception); + +/*! +@typedef JSObjectSetPropertyCallback +@abstract The callback invoked when setting a property's value. +@param ctx The execution context to use. +@param object The JSObject on which to set the property's value. +@param propertyName A JSString containing the name of the property to set. +@param value A JSValue to use as the property's value. +@param exception A pointer to a JSValueRef in which to return an exception, if any. +@result true if the property was set, otherwise false. +@discussion If you named your function SetProperty, you would declare it like this: + +bool SetProperty(JSContextRef ctx, JSObjectRef object, JSStringRef propertyName, JSValueRef value, JSValueRef* exception); + +If this function returns false, the set request forwards to object's statically declared properties, then its parent class chain (which includes the default object class). +*/ +typedef bool +(*JSObjectSetPropertyCallback) (JSContextRef ctx, JSObjectRef object, JSStringRef propertyName, JSValueRef value, JSValueRef* exception); + +/* Extension of the above callback with the class that the method is being invoked for. */ +typedef bool +(*JSObjectSetPropertyCallbackEx) (JSContextRef ctx, JSClassRef jsClass, JSObjectRef object, JSStringRef propertyName, JSValueRef value, JSValueRef* exception); + +/*! +@typedef JSObjectDeletePropertyCallback +@abstract The callback invoked when deleting a property. +@param ctx The execution context to use. +@param object The JSObject in which to delete the property. +@param propertyName A JSString containing the name of the property to delete. +@param exception A pointer to a JSValueRef in which to return an exception, if any. +@result true if propertyName was successfully deleted, otherwise false. +@discussion If you named your function DeleteProperty, you would declare it like this: + +bool DeleteProperty(JSContextRef ctx, JSObjectRef object, JSStringRef propertyName, JSValueRef* exception); + +If this function returns false, the delete request forwards to object's statically declared properties, then its parent class chain (which includes the default object class). +*/ +typedef bool +(*JSObjectDeletePropertyCallback) (JSContextRef ctx, JSObjectRef object, JSStringRef propertyName, JSValueRef* exception); + +/* Extension of the above callback with the class that the method is being invoked for. */ +typedef bool +(*JSObjectDeletePropertyCallbackEx) (JSContextRef ctx, JSClassRef jsClass, JSObjectRef object, JSStringRef propertyName, JSValueRef* exception); + +/*! +@typedef JSObjectGetPropertyNamesCallback +@abstract The callback invoked when collecting the names of an object's properties. +@param ctx The execution context to use. +@param object The JSObject whose property names are being collected. +@param propertyNames A JavaScript property name accumulator in which to accumulate the names of object's properties. +@discussion If you named your function GetPropertyNames, you would declare it like this: + +void GetPropertyNames(JSContextRef ctx, JSObjectRef object, JSPropertyNameAccumulatorRef propertyNames); + +Property name accumulators are used by JSObjectCopyPropertyNames and JavaScript for...in loops. + +Use JSPropertyNameAccumulatorAddName to add property names to accumulator. A class's getPropertyNames callback only needs to provide the names of properties that the class vends through a custom getProperty or setProperty callback. Other properties, including statically declared properties, properties vended by other classes, and properties belonging to object's prototype, are added independently. +*/ +typedef void +(*JSObjectGetPropertyNamesCallback) (JSContextRef ctx, JSObjectRef object, JSPropertyNameAccumulatorRef propertyNames); + +/* Extension of the above callback with the class that the method is being invoked for. */ +typedef void +(*JSObjectGetPropertyNamesCallbackEx) (JSContextRef ctx, JSClassRef jsClass, JSObjectRef object, JSPropertyNameAccumulatorRef propertyNames); + +/*! +@typedef JSObjectCallAsFunctionCallback +@abstract The callback invoked when an object is called as a function. +@param ctx The execution context to use. +@param function A JSObject that is the function being called. +@param thisObject A JSObject that is the 'this' variable in the function's scope. +@param argumentCount An integer count of the number of arguments in arguments. +@param arguments A JSValue array of the arguments passed to the function. +@param exception A pointer to a JSValueRef in which to return an exception, if any. +@result A JSValue that is the function's return value. +@discussion If you named your function CallAsFunction, you would declare it like this: + +JSValueRef CallAsFunction(JSContextRef ctx, JSObjectRef function, JSObjectRef thisObject, size_t argumentCount, const JSValueRef arguments[], JSValueRef* exception); + +If your callback were invoked by the JavaScript expression 'myObject.myFunction()', function would be set to myFunction, and thisObject would be set to myObject. + +If this callback is NULL, calling your object as a function will throw an exception. +*/ +typedef JSValueRef +(*JSObjectCallAsFunctionCallback) (JSContextRef ctx, JSObjectRef function, JSObjectRef thisObject, size_t argumentCount, const JSValueRef arguments[], JSValueRef* exception); + +/* Extension of the above callback with the class and class name of the object being called as a function. +@discussion If this is a JSStaticFunctionEx, className will actually be the name of the function. +*/ +typedef JSValueRef +(*JSObjectCallAsFunctionCallbackEx) (JSContextRef ctx, JSClassRef jsClass, JSStringRef className, JSObjectRef function, JSObjectRef thisObject, size_t argumentCount, const JSValueRef arguments[], JSValueRef* exception); + +/*! +@typedef JSObjectCallAsConstructorCallback +@abstract The callback invoked when an object is used as a constructor in a 'new' expression. +@param ctx The execution context to use. +@param constructor A JSObject that is the constructor being called. +@param argumentCount An integer count of the number of arguments in arguments. +@param arguments A JSValue array of the arguments passed to the function. +@param exception A pointer to a JSValueRef in which to return an exception, if any. +@result A JSObject that is the constructor's return value. +@discussion If you named your function CallAsConstructor, you would declare it like this: + +JSObjectRef CallAsConstructor(JSContextRef ctx, JSObjectRef constructor, size_t argumentCount, const JSValueRef arguments[], JSValueRef* exception); + +If your callback were invoked by the JavaScript expression 'new myConstructor()', constructor would be set to myConstructor. + +If this callback is NULL, using your object as a constructor in a 'new' expression will throw an exception. +*/ +typedef JSObjectRef +(*JSObjectCallAsConstructorCallback) (JSContextRef ctx, JSObjectRef constructor, size_t argumentCount, const JSValueRef arguments[], JSValueRef* exception); + +/* Extension of the above callback with the class that the method is being invoked for. */ +typedef JSObjectRef +(*JSObjectCallAsConstructorCallbackEx) (JSContextRef ctx, JSClassRef jsClass, JSObjectRef constructor, size_t argumentCount, const JSValueRef arguments[], JSValueRef* exception); + +/*! +@typedef JSObjectHasInstanceCallback +@abstract hasInstance The callback invoked when an object is used as the target of an 'instanceof' expression. +@param ctx The execution context to use. +@param constructor The JSObject that is the target of the 'instanceof' expression. +@param possibleInstance The JSValue being tested to determine if it is an instance of constructor. +@param exception A pointer to a JSValueRef in which to return an exception, if any. +@result true if possibleInstance is an instance of constructor, otherwise false. +@discussion If you named your function HasInstance, you would declare it like this: + +bool HasInstance(JSContextRef ctx, JSObjectRef constructor, JSValueRef possibleInstance, JSValueRef* exception); + +If your callback were invoked by the JavaScript expression 'someValue instanceof myObject', constructor would be set to myObject and possibleInstance would be set to someValue. + +If this callback is NULL, 'instanceof' expressions that target your object will return false. + +Standard JavaScript practice calls for objects that implement the callAsConstructor callback to implement the hasInstance callback as well. +*/ +typedef bool +(*JSObjectHasInstanceCallback) (JSContextRef ctx, JSObjectRef constructor, JSValueRef possibleInstance, JSValueRef* exception); + +/* Extension of the above callback with the class that the method is being invoked for. */ +typedef bool +(*JSObjectHasInstanceCallbackEx) (JSContextRef ctx, JSClassRef jsClass, JSObjectRef constructor, JSValueRef possibleInstance, JSValueRef* exception); + +/*! +@typedef JSObjectConvertToTypeCallback +@abstract The callback invoked when converting an object to a particular JavaScript type. +@param ctx The execution context to use. +@param object The JSObject to convert. +@param type A JSType specifying the JavaScript type to convert to. +@param exception A pointer to a JSValueRef in which to return an exception, if any. +@result The objects's converted value, or NULL if the object was not converted. +@discussion If you named your function ConvertToType, you would declare it like this: + +JSValueRef ConvertToType(JSContextRef ctx, JSObjectRef object, JSType type, JSValueRef* exception); + +If this function returns false, the conversion request forwards to object's parent class chain (which includes the default object class). + +This function is only invoked when converting an object to number or string. An object converted to boolean is 'true.' An object converted to object is itself. +*/ +typedef JSValueRef +(*JSObjectConvertToTypeCallback) (JSContextRef ctx, JSObjectRef object, JSType type, JSValueRef* exception); + +/* Extension of the above callback with the class that the method is being invoked for. */ +typedef JSValueRef +(*JSObjectConvertToTypeCallbackEx) (JSContextRef ctx, JSClassRef jsClass, JSObjectRef object, JSType type, JSValueRef* exception); + +/*! +@struct JSStaticValue +@abstract This structure describes a statically declared value property. +@field name A null-terminated UTF8 string containing the property's name. +@field getProperty A JSObjectGetPropertyCallback to invoke when getting the property's value. +@field setProperty A JSObjectSetPropertyCallback to invoke when setting the property's value. May be NULL if the ReadOnly attribute is set. +@field attributes A logically ORed set of JSPropertyAttributes to give to the property. +*/ +typedef struct { + const char* name; + JSObjectGetPropertyCallback getProperty; + JSObjectSetPropertyCallback setProperty; + JSPropertyAttributes attributes; +} JSStaticValue; + +/* Extension of the above structure for use with class version 1000 */ +typedef struct { + const char* name; + JSObjectGetPropertyCallbackEx getPropertyEx; + JSObjectSetPropertyCallbackEx setPropertyEx; + JSPropertyAttributes attributes; +} JSStaticValueEx; + +/*! +@struct JSStaticFunction +@abstract This structure describes a statically declared function property. +@field name A null-terminated UTF8 string containing the property's name. +@field callAsFunction A JSObjectCallAsFunctionCallback to invoke when the property is called as a function. +@field attributes A logically ORed set of JSPropertyAttributes to give to the property. +*/ +typedef struct { + const char* name; + JSObjectCallAsFunctionCallback callAsFunction; + JSPropertyAttributes attributes; +} JSStaticFunction; + +/* Extension of the above structure for use with class version 1000 */ +typedef struct { + const char* name; + JSObjectCallAsFunctionCallbackEx callAsFunctionEx; + JSPropertyAttributes attributes; +} JSStaticFunctionEx; + +/*! +@struct JSClassDefinition +@abstract This structure contains properties and callbacks that define a type of object. All fields other than the version field are optional. Any pointer may be NULL. +@field version The version number of this structure. The current version is 0. +@field attributes A logically ORed set of JSClassAttributes to give to the class. +@field className A null-terminated UTF8 string containing the class's name. +@field parentClass A JSClass to set as the class's parent class. Pass NULL use the default object class. +@field staticValues A JSStaticValue array containing the class's statically declared value properties. Pass NULL to specify no statically declared value properties. The array must be terminated by a JSStaticValue whose name field is NULL. +@field staticFunctions A JSStaticFunction array containing the class's statically declared function properties. Pass NULL to specify no statically declared function properties. The array must be terminated by a JSStaticFunction whose name field is NULL. +@field initialize The callback invoked when an object is first created. Use this callback to initialize the object. +@field finalize The callback invoked when an object is finalized (prepared for garbage collection). Use this callback to release resources allocated for the object, and perform other cleanup. +@field hasProperty The callback invoked when determining whether an object has a property. If this field is NULL, getProperty is called instead. The hasProperty callback enables optimization in cases where only a property's existence needs to be known, not its value, and computing its value is expensive. +@field getProperty The callback invoked when getting a property's value. +@field setProperty The callback invoked when setting a property's value. +@field deleteProperty The callback invoked when deleting a property. +@field getPropertyNames The callback invoked when collecting the names of an object's properties. +@field callAsFunction The callback invoked when an object is called as a function. +@field hasInstance The callback invoked when an object is used as the target of an 'instanceof' expression. +@field callAsConstructor The callback invoked when an object is used as a constructor in a 'new' expression. +@field convertToType The callback invoked when converting an object to a particular JavaScript type. +@discussion The staticValues and staticFunctions arrays are the simplest and most efficient means for vending custom properties. Statically declared properties autmatically service requests like getProperty, setProperty, and getPropertyNames. Property access callbacks are required only to implement unusual properties, like array indexes, whose names are not known at compile-time. + +If you named your getter function "GetX" and your setter function "SetX", you would declare a JSStaticValue array containing "X" like this: + +JSStaticValue StaticValueArray[] = { + { "X", GetX, SetX, kJSPropertyAttributeNone }, + { 0, 0, 0, 0 } +}; + +Standard JavaScript practice calls for storing function objects in prototypes, so they can be shared. The default JSClass created by JSClassCreate follows this idiom, instantiating objects with a shared, automatically generating prototype containing the class's function objects. The kJSClassAttributeNoAutomaticPrototype attribute specifies that a JSClass should not automatically generate such a prototype. The resulting JSClass instantiates objects with the default object prototype, and gives each instance object its own copy of the class's function objects. + +A NULL callback specifies that the default object callback should substitute, except in the case of hasProperty, where it specifies that getProperty should substitute. +*/ +typedef struct { + int version; /* default version is 0, use version 1000 for callbacks with extended class information */ + JSClassAttributes attributes; + + const char* className; + JSClassRef parentClass; + + union { + /* version 0 */ + struct { + const JSStaticValue* staticValues; + const JSStaticFunction* staticFunctions; + JSObjectInitializeCallback initialize; + JSObjectFinalizeCallback finalize; + JSObjectHasPropertyCallback hasProperty; + JSObjectGetPropertyCallback getProperty; + JSObjectSetPropertyCallback setProperty; + JSObjectDeletePropertyCallback deleteProperty; + JSObjectGetPropertyNamesCallback getPropertyNames; + JSObjectCallAsFunctionCallback callAsFunction; + JSObjectCallAsConstructorCallback callAsConstructor; + JSObjectHasInstanceCallback hasInstance; + JSObjectConvertToTypeCallback convertToType; + }; + + /* version 1000 */ + struct { + const JSStaticValueEx* staticValuesEx; + const JSStaticFunctionEx* staticFunctionsEx; + JSObjectInitializeCallbackEx initializeEx; + JSObjectFinalizeCallbackEx finalizeEx; + JSObjectHasPropertyCallbackEx hasPropertyEx; + JSObjectGetPropertyCallbackEx getPropertyEx; + JSObjectSetPropertyCallbackEx setPropertyEx; + JSObjectDeletePropertyCallbackEx deletePropertyEx; + JSObjectGetPropertyNamesCallbackEx getPropertyNamesEx; + JSObjectCallAsFunctionCallbackEx callAsFunctionEx; + JSObjectCallAsConstructorCallbackEx callAsConstructorEx; + JSObjectHasInstanceCallbackEx hasInstanceEx; + JSObjectConvertToTypeCallbackEx convertToTypeEx; + }; + }; + + void* privateData; /* version 1000 only */ +} JSClassDefinition; + +/*! +@const kJSClassDefinitionEmpty +@abstract A JSClassDefinition structure of the current version, filled with NULL pointers and having no attributes. +@discussion Use this constant as a convenience when creating class definitions. For example, to create a class definition with only a finalize method: + +JSClassDefinition definition = kJSClassDefinitionEmpty; +definition.finalize = Finalize; +*/ +JS_EXPORT extern const JSClassDefinition kJSClassDefinitionEmpty; + +/*! +@function +@abstract Creates a JavaScript class suitable for use with JSObjectMake. +@param definition A JSClassDefinition that defines the class. +@result A JSClass with the given definition. Ownership follows the Create Rule. +*/ +JS_EXPORT JSClassRef JSClassCreate(const JSClassDefinition* definition); + +/*! +@function +@abstract Retains a JavaScript class. +@param jsClass The JSClass to retain. +@result A JSClass that is the same as jsClass. +*/ +JS_EXPORT JSClassRef JSClassRetain(JSClassRef jsClass); + +/*! +@function +@abstract Releases a JavaScript class. +@param jsClass The JSClass to release. +*/ +JS_EXPORT void JSClassRelease(JSClassRef jsClass); + +/*! +@function +@abstract Retrieves the private data from a class reference, only possible with classes created with version 1000 (extended callbacks). +@param jsClass The class to get the data from +@result The private data on the class, or NULL, if not set +@discussion Only classes with version 1000 (extended callbacks) can store private data, for other classes always NULL will always be returned. +*/ +JS_EXPORT void* JSClassGetPrivate(JSClassRef jsClass); + +/*! +@function +@abstract Sets the private data on a class, only possible with classes created with version 1000 (extended callbacks). +@param jsClass The class to set the data on +@param data A void* to set as the private data for the class +@result true if the data has been set on the class, false if the class has not been created with version 1000 (extended callbacks) +@discussion Only classes with version 1000 (extended callbacks) can store private data, for other classes the function always fails. The set pointer is not touched by the engine. +*/ +JS_EXPORT bool JSClassSetPrivate(JSClassRef jsClass, void* data); + +/*! +@function +@abstract Creates a JavaScript object. +@param ctx The execution context to use. +@param jsClass The JSClass to assign to the object. Pass NULL to use the default object class. +@param data A void* to set as the object's private data. Pass NULL to specify no private data. +@result A JSObject with the given class and private data. +@discussion The default object class does not allocate storage for private data, so you must provide a non-NULL jsClass to JSObjectMake if you want your object to be able to store private data. + +data is set on the created object before the intialize methods in its class chain are called. This enables the initialize methods to retrieve and manipulate data through JSObjectGetPrivate. +*/ +JS_EXPORT JSObjectRef JSObjectMake(JSContextRef ctx, JSClassRef jsClass, void* data); + +/*! +@function +@abstract Convenience method for creating a JavaScript function with a given callback as its implementation. +@param ctx The execution context to use. +@param name A JSString containing the function's name. This will be used when converting the function to string. Pass NULL to create an anonymous function. +@param callAsFunction The JSObjectCallAsFunctionCallback to invoke when the function is called. +@result A JSObject that is a function. The object's prototype will be the default function prototype. +*/ +JS_EXPORT JSObjectRef JSObjectMakeFunctionWithCallback(JSContextRef ctx, JSStringRef name, JSObjectCallAsFunctionCallback callAsFunction); + +/*! +@function +@abstract Convenience method for creating a JavaScript constructor. +@param ctx The execution context to use. +@param jsClass A JSClass that is the class your constructor will assign to the objects its constructs. jsClass will be used to set the constructor's .prototype property, and to evaluate 'instanceof' expressions. Pass NULL to use the default object class. +@param callAsConstructor A JSObjectCallAsConstructorCallback to invoke when your constructor is used in a 'new' expression. Pass NULL to use the default object constructor. +@result A JSObject that is a constructor. The object's prototype will be the default object prototype. +@discussion The default object constructor takes no arguments and constructs an object of class jsClass with no private data. +*/ +JS_EXPORT JSObjectRef JSObjectMakeConstructor(JSContextRef ctx, JSClassRef jsClass, JSObjectCallAsConstructorCallback callAsConstructor); + +/*! + @function + @abstract Creates a JavaScript Array object. + @param ctx The execution context to use. + @param argumentCount An integer count of the number of arguments in arguments. + @param arguments A JSValue array of data to populate the Array with. Pass NULL if argumentCount is 0. + @param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. + @result A JSObject that is an Array. + @discussion The behavior of this function does not exactly match the behavior of the built-in Array constructor. Specifically, if one argument + is supplied, this function returns an array with one element. + */ +JS_EXPORT JSObjectRef JSObjectMakeArray(JSContextRef ctx, size_t argumentCount, const JSValueRef arguments[], JSValueRef* exception) JSC_API_AVAILABLE(macos(10.6), ios(7.0)); + +/*! + @function + @abstract Creates a JavaScript Date object, as if by invoking the built-in Date constructor. + @param ctx The execution context to use. + @param argumentCount An integer count of the number of arguments in arguments. + @param arguments A JSValue array of arguments to pass to the Date Constructor. Pass NULL if argumentCount is 0. + @param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. + @result A JSObject that is a Date. + */ +JS_EXPORT JSObjectRef JSObjectMakeDate(JSContextRef ctx, size_t argumentCount, const JSValueRef arguments[], JSValueRef* exception) JSC_API_AVAILABLE(macos(10.6), ios(7.0)); + +/*! + @function + @abstract Creates a JavaScript Error object, as if by invoking the built-in Error constructor. + @param ctx The execution context to use. + @param argumentCount An integer count of the number of arguments in arguments. + @param arguments A JSValue array of arguments to pass to the Error Constructor. Pass NULL if argumentCount is 0. + @param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. + @result A JSObject that is a Error. + */ +JS_EXPORT JSObjectRef JSObjectMakeError(JSContextRef ctx, size_t argumentCount, const JSValueRef arguments[], JSValueRef* exception) JSC_API_AVAILABLE(macos(10.6), ios(7.0)); + +/*! + @function + @abstract Creates a JavaScript RegExp object, as if by invoking the built-in RegExp constructor. + @param ctx The execution context to use. + @param argumentCount An integer count of the number of arguments in arguments. + @param arguments A JSValue array of arguments to pass to the RegExp Constructor. Pass NULL if argumentCount is 0. + @param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. + @result A JSObject that is a RegExp. + */ +JS_EXPORT JSObjectRef JSObjectMakeRegExp(JSContextRef ctx, size_t argumentCount, const JSValueRef arguments[], JSValueRef* exception) JSC_API_AVAILABLE(macos(10.6), ios(7.0)); + +/*! + @function + @abstract Creates a JavaScript promise object by invoking the provided executor. + @param ctx The execution context to use. + @param resolve A pointer to a JSObjectRef in which to store the resolve function for the new promise. Pass NULL if you do not care to store the resolve callback. + @param reject A pointer to a JSObjectRef in which to store the reject function for the new promise. Pass NULL if you do not care to store the reject callback. + @param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. + @result A JSObject that is a promise or NULL if an exception occurred. + */ +JS_EXPORT JSObjectRef JSObjectMakeDeferredPromise(JSContextRef ctx, JSObjectRef* resolve, JSObjectRef* reject, JSValueRef* exception) JSC_API_AVAILABLE(macos(10.15), ios(13.0)); + +/*! +@function +@abstract Creates a function with a given script as its body. +@param ctx The execution context to use. +@param name A JSString containing the function's name. This will be used when converting the function to string. Pass NULL to create an anonymous function. +@param parameterCount An integer count of the number of parameter names in parameterNames. +@param parameterNames A JSString array containing the names of the function's parameters. Pass NULL if parameterCount is 0. +@param body A JSString containing the script to use as the function's body. +@param sourceURL A JSString containing a URL for the script's source file. This is only used when reporting exceptions. Pass NULL if you do not care to include source file information in exceptions. +@param startingLineNumber An integer value specifying the script's starting line number in the file located at sourceURL. This is only used when reporting exceptions. The value is one-based, so the first line is line 1 and invalid values are clamped to 1. +@param exception A pointer to a JSValueRef in which to store a syntax error exception, if any. Pass NULL if you do not care to store a syntax error exception. +@result A JSObject that is a function, or NULL if either body or parameterNames contains a syntax error. The object's prototype will be the default function prototype. +@discussion Use this method when you want to execute a script repeatedly, to avoid the cost of re-parsing the script before each execution. +*/ +JS_EXPORT JSObjectRef JSObjectMakeFunction(JSContextRef ctx, JSStringRef name, unsigned parameterCount, const JSStringRef parameterNames[], JSStringRef body, JSStringRef sourceURL, int startingLineNumber, JSValueRef* exception); + +/*! +@function +@abstract Gets an object's prototype. +@param ctx The execution context to use. +@param object A JSObject whose prototype you want to get. +@result A JSValue that is the object's prototype. +*/ +JS_EXPORT JSValueRef JSObjectGetPrototype(JSContextRef ctx, JSObjectRef object); + +/*! +@function +@abstract Sets an object's prototype. +@param ctx The execution context to use. +@param object The JSObject whose prototype you want to set. +@param value A JSValue to set as the object's prototype. +*/ +JS_EXPORT void JSObjectSetPrototype(JSContextRef ctx, JSObjectRef object, JSValueRef value); + +/*! +@function +@abstract Tests whether an object has a given property. +@param object The JSObject to test. +@param propertyName A JSString containing the property's name. +@result true if the object has a property whose name matches propertyName, otherwise false. +*/ +JS_EXPORT bool JSObjectHasProperty(JSContextRef ctx, JSObjectRef object, JSStringRef propertyName); + +/*! +@function +@abstract Gets a property from an object. +@param ctx The execution context to use. +@param object The JSObject whose property you want to get. +@param propertyName A JSString containing the property's name. +@param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. +@result The property's value if object has the property, otherwise the undefined value. +*/ +JS_EXPORT JSValueRef JSObjectGetProperty(JSContextRef ctx, JSObjectRef object, JSStringRef propertyName, JSValueRef* exception); + +/*! +@function +@abstract Sets a property on an object. +@param ctx The execution context to use. +@param object The JSObject whose property you want to set. +@param propertyName A JSString containing the property's name. +@param value A JSValueRef to use as the property's value. +@param attributes A logically ORed set of JSPropertyAttributes to give to the property. +@param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. +*/ +JS_EXPORT void JSObjectSetProperty(JSContextRef ctx, JSObjectRef object, JSStringRef propertyName, JSValueRef value, JSPropertyAttributes attributes, JSValueRef* exception); + +/*! +@function +@abstract Deletes a property from an object. +@param ctx The execution context to use. +@param object The JSObject whose property you want to delete. +@param propertyName A JSString containing the property's name. +@param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. +@result true if the delete operation succeeds, otherwise false (for example, if the property has the kJSPropertyAttributeDontDelete attribute set). +*/ +JS_EXPORT bool JSObjectDeleteProperty(JSContextRef ctx, JSObjectRef object, JSStringRef propertyName, JSValueRef* exception); + +/*! + @function + @abstract Tests whether an object has a given property using a JSValueRef as the property key. + @param object The JSObject to test. + @param propertyKey A JSValueRef containing the property key to use when looking up the property. + @param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. + @result true if the object has a property whose name matches propertyKey, otherwise false. + @discussion This function is the same as performing "propertyKey in object" from JavaScript. + */ +JS_EXPORT bool JSObjectHasPropertyForKey(JSContextRef ctx, JSObjectRef object, JSValueRef propertyKey, JSValueRef* exception) JSC_API_AVAILABLE(macos(10.15), ios(13.0)); + +/*! + @function + @abstract Gets a property from an object using a JSValueRef as the property key. + @param ctx The execution context to use. + @param object The JSObject whose property you want to get. + @param propertyKey A JSValueRef containing the property key to use when looking up the property. + @param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. + @result The property's value if object has the property key, otherwise the undefined value. + @discussion This function is the same as performing "object[propertyKey]" from JavaScript. + */ +JS_EXPORT JSValueRef JSObjectGetPropertyForKey(JSContextRef ctx, JSObjectRef object, JSValueRef propertyKey, JSValueRef* exception) JSC_API_AVAILABLE(macos(10.15), ios(13.0)); + +/*! + @function + @abstract Sets a property on an object using a JSValueRef as the property key. + @param ctx The execution context to use. + @param object The JSObject whose property you want to set. + @param propertyKey A JSValueRef containing the property key to use when looking up the property. + @param value A JSValueRef to use as the property's value. + @param attributes A logically ORed set of JSPropertyAttributes to give to the property. + @param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. + @discussion This function is the same as performing "object[propertyKey] = value" from JavaScript. + */ +JS_EXPORT void JSObjectSetPropertyForKey(JSContextRef ctx, JSObjectRef object, JSValueRef propertyKey, JSValueRef value, JSPropertyAttributes attributes, JSValueRef* exception) JSC_API_AVAILABLE(macos(10.15), ios(13.0)); + +/*! + @function + @abstract Deletes a property from an object using a JSValueRef as the property key. + @param ctx The execution context to use. + @param object The JSObject whose property you want to delete. + @param propertyKey A JSValueRef containing the property key to use when looking up the property. + @param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. + @result true if the delete operation succeeds, otherwise false (for example, if the property has the kJSPropertyAttributeDontDelete attribute set). + @discussion This function is the same as performing "delete object[propertyKey]" from JavaScript. + */ +JS_EXPORT bool JSObjectDeletePropertyForKey(JSContextRef ctx, JSObjectRef object, JSValueRef propertyKey, JSValueRef* exception) JSC_API_AVAILABLE(macos(10.15), ios(13.0)); + +/*! +@function +@abstract Gets a property from an object by numeric index. +@param ctx The execution context to use. +@param object The JSObject whose property you want to get. +@param propertyIndex An integer value that is the property's name. +@param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. +@result The property's value if object has the property, otherwise the undefined value. +@discussion Calling JSObjectGetPropertyAtIndex is equivalent to calling JSObjectGetProperty with a string containing propertyIndex, but JSObjectGetPropertyAtIndex provides optimized access to numeric properties. +*/ +JS_EXPORT JSValueRef JSObjectGetPropertyAtIndex(JSContextRef ctx, JSObjectRef object, unsigned propertyIndex, JSValueRef* exception); + +/*! +@function +@abstract Sets a property on an object by numeric index. +@param ctx The execution context to use. +@param object The JSObject whose property you want to set. +@param propertyIndex The property's name as a number. +@param value A JSValue to use as the property's value. +@param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. +@discussion Calling JSObjectSetPropertyAtIndex is equivalent to calling JSObjectSetProperty with a string containing propertyIndex, but JSObjectSetPropertyAtIndex provides optimized access to numeric properties. +*/ +JS_EXPORT void JSObjectSetPropertyAtIndex(JSContextRef ctx, JSObjectRef object, unsigned propertyIndex, JSValueRef value, JSValueRef* exception); + +/*! +@function +@abstract Gets an object's private data. +@param object A JSObject whose private data you want to get. +@result A void* that is the object's private data, if the object has private data, otherwise NULL. +*/ +JS_EXPORT void* JSObjectGetPrivate(JSObjectRef object); + +/*! +@function +@abstract Sets a pointer to private data on an object. +@param object The JSObject whose private data you want to set. +@param data A void* to set as the object's private data. +@result true if object can store private data, otherwise false. +@discussion The default object class does not allocate storage for private data. Only objects created with a non-NULL JSClass can store private data. +*/ +JS_EXPORT bool JSObjectSetPrivate(JSObjectRef object, void* data); + +/*! +@function +@abstract Tests whether an object can be called as a function. +@param ctx The execution context to use. +@param object The JSObject to test. +@result true if the object can be called as a function, otherwise false. +*/ +JS_EXPORT bool JSObjectIsFunction(JSContextRef ctx, JSObjectRef object); + +/*! +@function +@abstract Calls an object as a function. +@param ctx The execution context to use. +@param object The JSObject to call as a function. +@param thisObject The object to use as "this," or NULL to use the global object as "this." +@param argumentCount An integer count of the number of arguments in arguments. +@param arguments A JSValue array of arguments to pass to the function. Pass NULL if argumentCount is 0. +@param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. +@result The JSValue that results from calling object as a function, or NULL if an exception is thrown or object is not a function. +*/ +JS_EXPORT JSValueRef JSObjectCallAsFunction(JSContextRef ctx, JSObjectRef object, JSObjectRef thisObject, size_t argumentCount, const JSValueRef arguments[], JSValueRef* exception); + +/*! +@function +@abstract Tests whether an object can be called as a constructor. +@param ctx The execution context to use. +@param object The JSObject to test. +@result true if the object can be called as a constructor, otherwise false. +*/ +JS_EXPORT bool JSObjectIsConstructor(JSContextRef ctx, JSObjectRef object); + +/*! +@function +@abstract Calls an object as a constructor. +@param ctx The execution context to use. +@param object The JSObject to call as a constructor. +@param argumentCount An integer count of the number of arguments in arguments. +@param arguments A JSValue array of arguments to pass to the constructor. Pass NULL if argumentCount is 0. +@param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. +@result The JSObject that results from calling object as a constructor, or NULL if an exception is thrown or object is not a constructor. +*/ +JS_EXPORT JSObjectRef JSObjectCallAsConstructor(JSContextRef ctx, JSObjectRef object, size_t argumentCount, const JSValueRef arguments[], JSValueRef* exception); + +/*! +@function +@abstract Gets the names of an object's enumerable properties. +@param ctx The execution context to use. +@param object The object whose property names you want to get. +@result A JSPropertyNameArray containing the names object's enumerable properties. Ownership follows the Create Rule. +*/ +JS_EXPORT JSPropertyNameArrayRef JSObjectCopyPropertyNames(JSContextRef ctx, JSObjectRef object); + +/*! +@function +@abstract Retains a JavaScript property name array. +@param array The JSPropertyNameArray to retain. +@result A JSPropertyNameArray that is the same as array. +*/ +JS_EXPORT JSPropertyNameArrayRef JSPropertyNameArrayRetain(JSPropertyNameArrayRef array); + +/*! +@function +@abstract Releases a JavaScript property name array. +@param array The JSPropetyNameArray to release. +*/ +JS_EXPORT void JSPropertyNameArrayRelease(JSPropertyNameArrayRef array); + +/*! +@function +@abstract Gets a count of the number of items in a JavaScript property name array. +@param array The array from which to retrieve the count. +@result An integer count of the number of names in array. +*/ +JS_EXPORT size_t JSPropertyNameArrayGetCount(JSPropertyNameArrayRef array); + +/*! +@function +@abstract Gets a property name at a given index in a JavaScript property name array. +@param array The array from which to retrieve the property name. +@param index The index of the property name to retrieve. +@result A JSStringRef containing the property name. +*/ +JS_EXPORT JSStringRef JSPropertyNameArrayGetNameAtIndex(JSPropertyNameArrayRef array, size_t index); + +/*! +@function +@abstract Adds a property name to a JavaScript property name accumulator. +@param accumulator The accumulator object to which to add the property name. +@param propertyName The property name to add. +*/ +JS_EXPORT void JSPropertyNameAccumulatorAddName(JSPropertyNameAccumulatorRef accumulator, JSStringRef propertyName); + +#ifdef __cplusplus +} +#endif + +#endif /* JSObjectRef_h */ diff --git a/engine/inc/JavaScriptCore/JSObjectRefPrivate.h b/engine/inc/JavaScriptCore/JSObjectRefPrivate.h new file mode 100644 index 00000000..080af870 --- /dev/null +++ b/engine/inc/JavaScriptCore/JSObjectRefPrivate.h @@ -0,0 +1,78 @@ +/* + * Copyright (C) 2010-2019 Apple Inc. All rights reserved. + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions + * are met: + * 1. Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * 2. Redistributions in binary form must reproduce the above copyright + * notice, this list of conditions and the following disclaimer in the + * documentation and/or other materials provided with the distribution. + * + * THIS SOFTWARE IS PROVIDED BY APPLE INC. AND ITS CONTRIBUTORS ``AS IS'' + * AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, + * THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR + * PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL APPLE INC. OR ITS CONTRIBUTORS + * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR + * CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF + * SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS + * INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN + * CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) + * ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF + * THE POSSIBILITY OF SUCH DAMAGE. + */ + +#ifndef JSObjectRefPrivate_h +#define JSObjectRefPrivate_h + +#include + +#ifdef __cplusplus +extern "C" { +#endif + +/*! + @function + @abstract Sets a private property on an object. This private property cannot be accessed from within JavaScript. + @param ctx The execution context to use. + @param object The JSObject whose private property you want to set. + @param propertyName A JSString containing the property's name. + @param value A JSValue to use as the property's value. This may be NULL. + @result true if object can store private data, otherwise false. + @discussion This API allows you to store JS values directly an object in a way that will be ensure that they are kept alive without exposing them to JavaScript code and without introducing the reference cycles that may occur when using JSValueProtect. + + The default object class does not allocate storage for private data. Only objects created with a non-NULL JSClass can store private properties. + */ +JS_EXPORT bool JSObjectSetPrivateProperty(JSContextRef ctx, JSObjectRef object, JSStringRef propertyName, JSValueRef value); + +/*! + @function + @abstract Gets a private property from an object. + @param ctx The execution context to use. + @param object The JSObject whose private property you want to get. + @param propertyName A JSString containing the property's name. + @result The property's value if object has the property, otherwise NULL. + */ +JS_EXPORT JSValueRef JSObjectGetPrivateProperty(JSContextRef ctx, JSObjectRef object, JSStringRef propertyName); + +/*! + @function + @abstract Deletes a private property from an object. + @param ctx The execution context to use. + @param object The JSObject whose private property you want to delete. + @param propertyName A JSString containing the property's name. + @result true if object can store private data, otherwise false. + @discussion The default object class does not allocate storage for private data. Only objects created with a non-NULL JSClass can store private data. + */ +JS_EXPORT bool JSObjectDeletePrivateProperty(JSContextRef ctx, JSObjectRef object, JSStringRef propertyName); + +JS_EXPORT JSObjectRef JSObjectGetProxyTarget(JSObjectRef); + +JS_EXPORT JSGlobalContextRef JSObjectGetGlobalContext(JSObjectRef object); + +#ifdef __cplusplus +} +#endif + +#endif // JSObjectRefPrivate_h diff --git a/engine/inc/JavaScriptCore/JSRetainPtr.h b/engine/inc/JavaScriptCore/JSRetainPtr.h new file mode 100644 index 00000000..fdab802d --- /dev/null +++ b/engine/inc/JavaScriptCore/JSRetainPtr.h @@ -0,0 +1,187 @@ +/* + * Copyright (C) 2005-2018 Apple Inc. All rights reserved. + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions + * are met: + * + * 1. Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * 2. Redistributions in binary form must reproduce the above copyright + * notice, this list of conditions and the following disclaimer in the + * documentation and/or other materials provided with the distribution. + * 3. Neither the name of Apple Inc. ("Apple") nor the names of + * its contributors may be used to endorse or promote products derived + * from this software without specific prior written permission. + * + * THIS SOFTWARE IS PROVIDED BY APPLE AND ITS CONTRIBUTORS "AS IS" AND ANY + * EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED + * WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE + * DISCLAIMED. IN NO EVENT SHALL APPLE OR ITS CONTRIBUTORS BE LIABLE FOR ANY + * DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES + * (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; + * LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND + * ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT + * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF + * THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + */ + +#pragma once + +#include +#include +#include + +#if !defined(WARN_UNUSED_RETURN) +#define WARN_UNUSED_RETURN +#endif + +inline void JSRetain(JSStringRef string) { JSStringRetain(string); } +inline void JSRelease(JSStringRef string) { JSStringRelease(string); } +inline void JSRetain(JSGlobalContextRef context) { JSGlobalContextRetain(context); } +inline void JSRelease(JSGlobalContextRef context) { JSGlobalContextRelease(context); } + +enum AdoptTag { Adopt }; + +template class JSRetainPtr { +public: + JSRetainPtr() = default; + JSRetainPtr(T ptr) : m_ptr(ptr) { if (ptr) JSRetain(ptr); } + JSRetainPtr(const JSRetainPtr&); + JSRetainPtr(JSRetainPtr&&); + ~JSRetainPtr(); + + T get() const { return m_ptr; } + + void clear(); + T leakRef() WARN_UNUSED_RETURN; + + T operator->() const { return m_ptr; } + + bool operator!() const { return !m_ptr; } + explicit operator bool() const { return m_ptr; } + + JSRetainPtr& operator=(const JSRetainPtr&); + JSRetainPtr& operator=(JSRetainPtr&&); + JSRetainPtr& operator=(T); + + void swap(JSRetainPtr&); + + friend JSRetainPtr adopt(JSStringRef); + friend JSRetainPtr adopt(JSGlobalContextRef); + + // FIXME: Make this private once Apple's internal code is updated to not rely on it. + // https://bugs.webkit.org/show_bug.cgi?id=189644 + JSRetainPtr(AdoptTag, T); + +private: + T m_ptr { nullptr }; +}; + +JSRetainPtr adopt(JSStringRef); +JSRetainPtr adopt(JSGlobalContextRef); + +template inline JSRetainPtr::JSRetainPtr(AdoptTag, T ptr) + : m_ptr(ptr) +{ +} + +inline JSRetainPtr adopt(JSStringRef o) +{ + return JSRetainPtr(Adopt, o); +} + +inline JSRetainPtr adopt(JSGlobalContextRef o) +{ + return JSRetainPtr(Adopt, o); +} + +template inline JSRetainPtr::JSRetainPtr(const JSRetainPtr& o) + : m_ptr(o.m_ptr) +{ + if (m_ptr) + JSRetain(m_ptr); +} + +template inline JSRetainPtr::JSRetainPtr(JSRetainPtr&& o) + : m_ptr(o.leakRef()) +{ +} + +template inline JSRetainPtr::~JSRetainPtr() +{ + if (m_ptr) + JSRelease(m_ptr); +} + +template inline void JSRetainPtr::clear() +{ + if (T ptr = leakRef()) + JSRelease(ptr); +} + +template inline T JSRetainPtr::leakRef() +{ + return std::exchange(m_ptr, nullptr); +} + +template inline JSRetainPtr& JSRetainPtr::operator=(const JSRetainPtr& o) +{ + return operator=(o.get()); +} + +template inline JSRetainPtr& JSRetainPtr::operator=(JSRetainPtr&& o) +{ + if (T ptr = std::exchange(m_ptr, o.leakRef())) + JSRelease(ptr); + return *this; +} + +template inline JSRetainPtr& JSRetainPtr::operator=(T optr) +{ + if (optr) + JSRetain(optr); + if (T ptr = std::exchange(m_ptr, optr)) + JSRelease(ptr); + return *this; +} + +template inline void JSRetainPtr::swap(JSRetainPtr& o) +{ + std::swap(m_ptr, o.m_ptr); +} + +template inline void swap(JSRetainPtr& a, JSRetainPtr& b) +{ + a.swap(b); +} + +template inline bool operator==(const JSRetainPtr& a, const JSRetainPtr& b) +{ + return a.get() == b.get(); +} + +template inline bool operator==(const JSRetainPtr& a, U* b) +{ + return a.get() == b; +} + +template inline bool operator==(T* a, const JSRetainPtr& b) +{ + return a == b.get(); +} + +template inline bool operator!=(const JSRetainPtr& a, const JSRetainPtr& b) +{ + return a.get() != b.get(); +} + +template inline bool operator!=(const JSRetainPtr& a, U* b) +{ + return a.get() != b; +} + +template inline bool operator!=(T* a, const JSRetainPtr& b) +{ + return a != b.get(); +} diff --git a/engine/inc/JavaScriptCore/JSStringRef.h b/engine/inc/JavaScriptCore/JSStringRef.h new file mode 100644 index 00000000..9236f05d --- /dev/null +++ b/engine/inc/JavaScriptCore/JSStringRef.h @@ -0,0 +1,148 @@ +/* + * Copyright (C) 2006 Apple Inc. All rights reserved. + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions + * are met: + * 1. Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * 2. Redistributions in binary form must reproduce the above copyright + * notice, this list of conditions and the following disclaimer in the + * documentation and/or other materials provided with the distribution. + * + * THIS SOFTWARE IS PROVIDED BY APPLE INC. ``AS IS'' AND ANY + * EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE + * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR + * PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL APPLE INC. OR + * CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, + * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, + * PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR + * PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY + * OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT + * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE + * OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + */ + +#ifndef JSStringRef_h +#define JSStringRef_h + +#include + +#ifndef __cplusplus +#include +#endif +#include /* for size_t */ + +#ifdef __cplusplus +extern "C" { +#endif + +#if !defined(_NATIVE_WCHAR_T_DEFINED) /* MSVC */ \ + && (!defined(__WCHAR_MAX__) || (__WCHAR_MAX__ > 0xffffU)) /* ISO C/C++ */ \ + && (!defined(WCHAR_MAX) || (WCHAR_MAX > 0xffffU)) /* RVCT */ +/*! +@typedef JSChar +@abstract A UTF-16 code unit. One, or a sequence of two, can encode any Unicode + character. As with all scalar types, endianness depends on the underlying + architecture. +*/ + typedef unsigned short JSChar; +#else + typedef wchar_t JSChar; +#endif + +/*! +@function +@abstract Creates a JavaScript string from a buffer of Unicode characters. +@param chars The buffer of Unicode characters to copy into the new JSString. +@param numChars The number of characters to copy from the buffer pointed to by chars. +@result A JSString containing chars. Ownership follows the Create Rule. +*/ +JS_EXPORT JSStringRef JSStringCreateWithCharacters(const JSChar* chars, size_t numChars); +/*! +@function +@abstract Creates a JavaScript string from a null-terminated UTF8 string. +@param string The null-terminated UTF8 string to copy into the new JSString. +@result A JSString containing string. Ownership follows the Create Rule. +*/ +JS_EXPORT JSStringRef JSStringCreateWithUTF8CString(const char* string); + +/*! +@function +@abstract Retains a JavaScript string. +@param string The JSString to retain. +@result A JSString that is the same as string. +*/ +JS_EXPORT JSStringRef JSStringRetain(JSStringRef string); +/*! +@function +@abstract Releases a JavaScript string. +@param string The JSString to release. +*/ +JS_EXPORT void JSStringRelease(JSStringRef string); + +/*! +@function +@abstract Returns the number of Unicode characters in a JavaScript string. +@param string The JSString whose length (in Unicode characters) you want to know. +@result The number of Unicode characters stored in string. +*/ +JS_EXPORT size_t JSStringGetLength(JSStringRef string); +/*! +@function +@abstract Returns a pointer to the Unicode character buffer that + serves as the backing store for a JavaScript string. +@param string The JSString whose backing store you want to access. +@result A pointer to the Unicode character buffer that serves as string's + backing store, which will be deallocated when string is deallocated. +*/ +JS_EXPORT const JSChar* JSStringGetCharactersPtr(JSStringRef string); + +/*! +@function +@abstract Returns the maximum number of bytes a JavaScript string will + take up if converted into a null-terminated UTF8 string. +@param string The JSString whose maximum converted size (in bytes) you + want to know. +@result The maximum number of bytes that could be required to convert string into a + null-terminated UTF8 string. The number of bytes that the conversion actually ends + up requiring could be less than this, but never more. +*/ +JS_EXPORT size_t JSStringGetMaximumUTF8CStringSize(JSStringRef string); +/*! +@function +@abstract Converts a JavaScript string into a null-terminated UTF8 string, + and copies the result into an external byte buffer. +@param string The source JSString. +@param buffer The destination byte buffer into which to copy a null-terminated + UTF8 representation of string. On return, buffer contains a UTF8 string + representation of string. If bufferSize is too small, buffer will contain only + partial results. If buffer is not at least bufferSize bytes in size, + behavior is undefined. +@param bufferSize The size of the external buffer in bytes. +@result The number of bytes written into buffer (including the null-terminator byte). +*/ +JS_EXPORT size_t JSStringGetUTF8CString(JSStringRef string, char* buffer, size_t bufferSize); + +/*! +@function +@abstract Tests whether two JavaScript strings match. +@param a The first JSString to test. +@param b The second JSString to test. +@result true if the two strings match, otherwise false. +*/ +JS_EXPORT bool JSStringIsEqual(JSStringRef a, JSStringRef b); +/*! +@function +@abstract Tests whether a JavaScript string matches a null-terminated UTF8 string. +@param a The JSString to test. +@param b The null-terminated UTF8 string to test. +@result true if the two strings match, otherwise false. +*/ +JS_EXPORT bool JSStringIsEqualToUTF8CString(JSStringRef a, const char* b); + +#ifdef __cplusplus +} +#endif + +#endif /* JSStringRef_h */ diff --git a/engine/inc/JavaScriptCore/JSTypedArray.h b/engine/inc/JavaScriptCore/JSTypedArray.h new file mode 100644 index 00000000..aa643ba1 --- /dev/null +++ b/engine/inc/JavaScriptCore/JSTypedArray.h @@ -0,0 +1,180 @@ +/* + * Copyright (C) 2015 Dominic Szablewski (dominic@phoboslab.org) + * Copyright (C) 2015-2016 Apple Inc. All rights reserved. + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions + * are met: + * 1. Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * 2. Redistributions in binary form must reproduce the above copyright + * notice, this list of conditions and the following disclaimer in the + * documentation and/or other materials provided with the distribution. + * + * THIS SOFTWARE IS PROVIDED BY APPLE COMPUTER, INC. ``AS IS'' AND ANY + * EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE + * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR + * PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL APPLE COMPUTER, INC. OR + * CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, + * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, + * PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR + * PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY + * OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT + * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE + * OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + */ + +#ifndef JSTypedArray_h +#define JSTypedArray_h + +#include +#include + +#ifdef __cplusplus +extern "C" { +#endif + +// ------------- Typed Array functions -------------- + +/*! + @function + @abstract Creates a JavaScript Typed Array object with the given number of elements. + @param ctx The execution context to use. + @param arrayType A value identifying the type of array to create. If arrayType is kJSTypedArrayTypeNone or kJSTypedArrayTypeArrayBuffer then NULL will be returned. + @param length The number of elements to be in the new Typed Array. + @param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. + @result A JSObjectRef that is a Typed Array with all elements set to zero or NULL if there was an error. + */ +JS_EXPORT JSObjectRef JSObjectMakeTypedArray(JSContextRef ctx, JSTypedArrayType arrayType, size_t length, JSValueRef* exception) JSC_API_AVAILABLE(macos(10.12), ios(10.0)); + +/*! + @function + @abstract Creates a JavaScript Typed Array object from an existing pointer. + @param ctx The execution context to use. + @param arrayType A value identifying the type of array to create. If arrayType is kJSTypedArrayTypeNone or kJSTypedArrayTypeArrayBuffer then NULL will be returned. + @param bytes A pointer to the byte buffer to be used as the backing store of the Typed Array object. + @param byteLength The number of bytes pointed to by the parameter bytes. + @param bytesDeallocator The allocator to use to deallocate the external buffer when the JSTypedArrayData object is deallocated. + @param deallocatorContext A pointer to pass back to the deallocator. + @param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. + @result A JSObjectRef Typed Array whose backing store is the same as the one pointed to by bytes or NULL if there was an error. + @discussion If an exception is thrown during this function the bytesDeallocator will always be called. + */ +JS_EXPORT JSObjectRef JSObjectMakeTypedArrayWithBytesNoCopy(JSContextRef ctx, JSTypedArrayType arrayType, void* bytes, size_t byteLength, JSTypedArrayBytesDeallocator bytesDeallocator, void* deallocatorContext, JSValueRef* exception) JSC_API_AVAILABLE(macos(10.12), ios(10.0)); + +/*! + @function + @abstract Creates a JavaScript Typed Array object from an existing JavaScript Array Buffer object. + @param ctx The execution context to use. + @param arrayType A value identifying the type of array to create. If arrayType is kJSTypedArrayTypeNone or kJSTypedArrayTypeArrayBuffer then NULL will be returned. + @param buffer An Array Buffer object that should be used as the backing store for the created JavaScript Typed Array object. + @param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. + @result A JSObjectRef that is a Typed Array or NULL if there was an error. The backing store of the Typed Array will be buffer. + */ +JS_EXPORT JSObjectRef JSObjectMakeTypedArrayWithArrayBuffer(JSContextRef ctx, JSTypedArrayType arrayType, JSObjectRef buffer, JSValueRef* exception) JSC_API_AVAILABLE(macos(10.12), ios(10.0)); + +/*! + @function + @abstract Creates a JavaScript Typed Array object from an existing JavaScript Array Buffer object with the given offset and length. + @param ctx The execution context to use. + @param arrayType A value identifying the type of array to create. If arrayType is kJSTypedArrayTypeNone or kJSTypedArrayTypeArrayBuffer then NULL will be returned. + @param buffer An Array Buffer object that should be used as the backing store for the created JavaScript Typed Array object. + @param byteOffset The byte offset for the created Typed Array. byteOffset should aligned with the element size of arrayType. + @param length The number of elements to include in the Typed Array. + @param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. + @result A JSObjectRef that is a Typed Array or NULL if there was an error. The backing store of the Typed Array will be buffer. + */ +JS_EXPORT JSObjectRef JSObjectMakeTypedArrayWithArrayBufferAndOffset(JSContextRef ctx, JSTypedArrayType arrayType, JSObjectRef buffer, size_t byteOffset, size_t length, JSValueRef* exception) JSC_API_AVAILABLE(macos(10.12), ios(10.0)); + +/*! + @function + @abstract Returns a temporary pointer to the backing store of a JavaScript Typed Array object. + @param ctx The execution context to use. + @param object The Typed Array object whose backing store pointer to return. + @param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. + @result A pointer to the raw data buffer that serves as object's backing store or NULL if object is not a Typed Array object. + @discussion The pointer returned by this function is temporary and is not guaranteed to remain valid across JavaScriptCore API calls. + */ +JS_EXPORT void* JSObjectGetTypedArrayBytesPtr(JSContextRef ctx, JSObjectRef object, JSValueRef* exception) JSC_API_AVAILABLE(macos(10.12), ios(10.0)); + +/*! + @function + @abstract Returns the length of a JavaScript Typed Array object. + @param ctx The execution context to use. + @param object The Typed Array object whose length to return. + @param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. + @result The length of the Typed Array object or 0 if the object is not a Typed Array object. + */ +JS_EXPORT size_t JSObjectGetTypedArrayLength(JSContextRef ctx, JSObjectRef object, JSValueRef* exception) JSC_API_AVAILABLE(macos(10.12), ios(10.0)); + +/*! + @function + @abstract Returns the byte length of a JavaScript Typed Array object. + @param ctx The execution context to use. + @param object The Typed Array object whose byte length to return. + @param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. + @result The byte length of the Typed Array object or 0 if the object is not a Typed Array object. + */ +JS_EXPORT size_t JSObjectGetTypedArrayByteLength(JSContextRef ctx, JSObjectRef object, JSValueRef* exception) JSC_API_AVAILABLE(macos(10.12), ios(10.0)); + +/*! + @function + @abstract Returns the byte offset of a JavaScript Typed Array object. + @param ctx The execution context to use. + @param object The Typed Array object whose byte offset to return. + @param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. + @result The byte offset of the Typed Array object or 0 if the object is not a Typed Array object. + */ +JS_EXPORT size_t JSObjectGetTypedArrayByteOffset(JSContextRef ctx, JSObjectRef object, JSValueRef* exception) JSC_API_AVAILABLE(macos(10.12), ios(10.0)); + +/*! + @function + @abstract Returns the JavaScript Array Buffer object that is used as the backing of a JavaScript Typed Array object. + @param ctx The execution context to use. + @param object The JSObjectRef whose Typed Array type data pointer to obtain. + @param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. + @result A JSObjectRef with a JSTypedArrayType of kJSTypedArrayTypeArrayBuffer or NULL if object is not a Typed Array. + */ +JS_EXPORT JSObjectRef JSObjectGetTypedArrayBuffer(JSContextRef ctx, JSObjectRef object, JSValueRef* exception) JSC_API_AVAILABLE(macos(10.12), ios(10.0)); + +// ------------- Array Buffer functions ------------- + +/*! + @function + @abstract Creates a JavaScript Array Buffer object from an existing pointer. + @param ctx The execution context to use. + @param bytes A pointer to the byte buffer to be used as the backing store of the Typed Array object. + @param byteLength The number of bytes pointed to by the parameter bytes. + @param bytesDeallocator The allocator to use to deallocate the external buffer when the Typed Array data object is deallocated. + @param deallocatorContext A pointer to pass back to the deallocator. + @param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. + @result A JSObjectRef Array Buffer whose backing store is the same as the one pointed to by bytes or NULL if there was an error. + @discussion If an exception is thrown during this function the bytesDeallocator will always be called. + */ +JS_EXPORT JSObjectRef JSObjectMakeArrayBufferWithBytesNoCopy(JSContextRef ctx, void* bytes, size_t byteLength, JSTypedArrayBytesDeallocator bytesDeallocator, void* deallocatorContext, JSValueRef* exception) JSC_API_AVAILABLE(macos(10.12), ios(10.0)); + +/*! + @function + @abstract Returns a pointer to the data buffer that serves as the backing store for a JavaScript Typed Array object. + @param object The Array Buffer object whose internal backing store pointer to return. + @param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. + @result A pointer to the raw data buffer that serves as object's backing store or NULL if object is not an Array Buffer object. + @discussion The pointer returned by this function is temporary and is not guaranteed to remain valid across JavaScriptCore API calls. + */ +JS_EXPORT void* JSObjectGetArrayBufferBytesPtr(JSContextRef ctx, JSObjectRef object, JSValueRef* exception) JSC_API_AVAILABLE(macos(10.12), ios(10.0)); + +/*! + @function + @abstract Returns the number of bytes in a JavaScript data object. + @param ctx The execution context to use. + @param object The JS Arary Buffer object whose length in bytes to return. + @param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. + @result The number of bytes stored in the data object. + */ +JS_EXPORT size_t JSObjectGetArrayBufferByteLength(JSContextRef ctx, JSObjectRef object, JSValueRef* exception) JSC_API_AVAILABLE(macos(10.12), ios(10.0)); + +#ifdef __cplusplus +} +#endif + +#endif /* JSTypedArray_h */ diff --git a/engine/inc/JavaScriptCore/JSValueRef.h b/engine/inc/JavaScriptCore/JSValueRef.h new file mode 100644 index 00000000..852a6fa2 --- /dev/null +++ b/engine/inc/JavaScriptCore/JSValueRef.h @@ -0,0 +1,380 @@ +/* + * Copyright (C) 2006-2019 Apple Inc. All rights reserved. + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions + * are met: + * 1. Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * 2. Redistributions in binary form must reproduce the above copyright + * notice, this list of conditions and the following disclaimer in the + * documentation and/or other materials provided with the distribution. + * + * THIS SOFTWARE IS PROVIDED BY APPLE INC. ``AS IS'' AND ANY + * EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE + * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR + * PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL APPLE INC. OR + * CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, + * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, + * PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR + * PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY + * OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT + * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE + * OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + */ + +#ifndef JSValueRef_h +#define JSValueRef_h + +#include +#include + +#ifndef __cplusplus +#include +#endif + +/*! +@enum JSType +@abstract A constant identifying the type of a JSValue. +@constant kJSTypeUndefined The unique undefined value. +@constant kJSTypeNull The unique null value. +@constant kJSTypeBoolean A primitive boolean value, one of true or false. +@constant kJSTypeNumber A primitive number value. +@constant kJSTypeString A primitive string value. +@constant kJSTypeObject An object value (meaning that this JSValueRef is a JSObjectRef). +@constant kJSTypeSymbol A primitive symbol value. +*/ +typedef enum { + kJSTypeUndefined, + kJSTypeNull, + kJSTypeBoolean, + kJSTypeNumber, + kJSTypeString, + kJSTypeObject, + kJSTypeSymbol JSC_API_AVAILABLE(macos(10.15), ios(13.0)) +} JSType; + +/*! + @enum JSTypedArrayType + @abstract A constant identifying the Typed Array type of a JSObjectRef. + @constant kJSTypedArrayTypeInt8Array Int8Array + @constant kJSTypedArrayTypeInt16Array Int16Array + @constant kJSTypedArrayTypeInt32Array Int32Array + @constant kJSTypedArrayTypeUint8Array Uint8Array + @constant kJSTypedArrayTypeUint8ClampedArray Uint8ClampedArray + @constant kJSTypedArrayTypeUint16Array Uint16Array + @constant kJSTypedArrayTypeUint32Array Uint32Array + @constant kJSTypedArrayTypeFloat32Array Float32Array + @constant kJSTypedArrayTypeFloat64Array Float64Array + @constant kJSTypedArrayTypeArrayBuffer ArrayBuffer + @constant kJSTypedArrayTypeNone Not a Typed Array + + */ +typedef enum { + kJSTypedArrayTypeInt8Array, + kJSTypedArrayTypeInt16Array, + kJSTypedArrayTypeInt32Array, + kJSTypedArrayTypeUint8Array, + kJSTypedArrayTypeUint8ClampedArray, + kJSTypedArrayTypeUint16Array, + kJSTypedArrayTypeUint32Array, + kJSTypedArrayTypeFloat32Array, + kJSTypedArrayTypeFloat64Array, + kJSTypedArrayTypeArrayBuffer, + kJSTypedArrayTypeNone, +} JSTypedArrayType JSC_API_AVAILABLE(macos(10.12), ios(10.0)); + +#ifdef __cplusplus +extern "C" { +#endif + +/*! +@function +@abstract Returns a JavaScript value's type. +@param ctx The execution context to use. +@param value The JSValue whose type you want to obtain. +@result A value of type JSType that identifies value's type. +*/ +JS_EXPORT JSType JSValueGetType(JSContextRef ctx, JSValueRef value); + +/*! +@function +@abstract Tests whether a JavaScript value's type is the undefined type. +@param ctx The execution context to use. +@param value The JSValue to test. +@result true if value's type is the undefined type, otherwise false. +*/ +JS_EXPORT bool JSValueIsUndefined(JSContextRef ctx, JSValueRef value); + +/*! +@function +@abstract Tests whether a JavaScript value's type is the null type. +@param ctx The execution context to use. +@param value The JSValue to test. +@result true if value's type is the null type, otherwise false. +*/ +JS_EXPORT bool JSValueIsNull(JSContextRef ctx, JSValueRef value); + +/*! +@function +@abstract Tests whether a JavaScript value's type is the boolean type. +@param ctx The execution context to use. +@param value The JSValue to test. +@result true if value's type is the boolean type, otherwise false. +*/ +JS_EXPORT bool JSValueIsBoolean(JSContextRef ctx, JSValueRef value); + +/*! +@function +@abstract Tests whether a JavaScript value's type is the number type. +@param ctx The execution context to use. +@param value The JSValue to test. +@result true if value's type is the number type, otherwise false. +*/ +JS_EXPORT bool JSValueIsNumber(JSContextRef ctx, JSValueRef value); + +/*! +@function +@abstract Tests whether a JavaScript value's type is the string type. +@param ctx The execution context to use. +@param value The JSValue to test. +@result true if value's type is the string type, otherwise false. +*/ +JS_EXPORT bool JSValueIsString(JSContextRef ctx, JSValueRef value); + +/*! +@function +@abstract Tests whether a JavaScript value's type is the symbol type. +@param ctx The execution context to use. +@param value The JSValue to test. +@result true if value's type is the symbol type, otherwise false. +*/ +JS_EXPORT bool JSValueIsSymbol(JSContextRef ctx, JSValueRef value) JSC_API_AVAILABLE(macos(10.15), ios(13.0)); + +/*! +@function +@abstract Tests whether a JavaScript value's type is the object type. +@param ctx The execution context to use. +@param value The JSValue to test. +@result true if value's type is the object type, otherwise false. +*/ +JS_EXPORT bool JSValueIsObject(JSContextRef ctx, JSValueRef value); + + +/*! +@function +@abstract Tests whether a JavaScript value is an object with a given class in its class chain. +@param ctx The execution context to use. +@param value The JSValue to test. +@param jsClass The JSClass to test against. +@result true if value is an object and has jsClass in its class chain, otherwise false. +*/ +JS_EXPORT bool JSValueIsObjectOfClass(JSContextRef ctx, JSValueRef value, JSClassRef jsClass); + +/*! +@function +@abstract Tests whether a JavaScript value is an array. +@param ctx The execution context to use. +@param value The JSValue to test. +@result true if value is an array, otherwise false. +*/ +JS_EXPORT bool JSValueIsArray(JSContextRef ctx, JSValueRef value) JSC_API_AVAILABLE(macos(10.11), ios(9.0)); + +/*! +@function +@abstract Tests whether a JavaScript value is a date. +@param ctx The execution context to use. +@param value The JSValue to test. +@result true if value is a date, otherwise false. +*/ +JS_EXPORT bool JSValueIsDate(JSContextRef ctx, JSValueRef value) JSC_API_AVAILABLE(macos(10.11), ios(9.0)); + +/*! +@function +@abstract Returns a JavaScript value's Typed Array type. +@param ctx The execution context to use. +@param value The JSValue whose Typed Array type to return. +@param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. +@result A value of type JSTypedArrayType that identifies value's Typed Array type, or kJSTypedArrayTypeNone if the value is not a Typed Array object. + */ +JS_EXPORT JSTypedArrayType JSValueGetTypedArrayType(JSContextRef ctx, JSValueRef value, JSValueRef* exception) JSC_API_AVAILABLE(macos(10.12), ios(10.0)); + +/* Comparing values */ + +/*! +@function +@abstract Tests whether two JavaScript values are equal, as compared by the JS == operator. +@param ctx The execution context to use. +@param a The first value to test. +@param b The second value to test. +@param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. +@result true if the two values are equal, false if they are not equal or an exception is thrown. +*/ +JS_EXPORT bool JSValueIsEqual(JSContextRef ctx, JSValueRef a, JSValueRef b, JSValueRef* exception); + +/*! +@function +@abstract Tests whether two JavaScript values are strict equal, as compared by the JS === operator. +@param ctx The execution context to use. +@param a The first value to test. +@param b The second value to test. +@result true if the two values are strict equal, otherwise false. +*/ +JS_EXPORT bool JSValueIsStrictEqual(JSContextRef ctx, JSValueRef a, JSValueRef b); + +/*! +@function +@abstract Tests whether a JavaScript value is an object constructed by a given constructor, as compared by the JS instanceof operator. +@param ctx The execution context to use. +@param value The JSValue to test. +@param constructor The constructor to test against. +@param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. +@result true if value is an object constructed by constructor, as compared by the JS instanceof operator, otherwise false. +*/ +JS_EXPORT bool JSValueIsInstanceOfConstructor(JSContextRef ctx, JSValueRef value, JSObjectRef constructor, JSValueRef* exception); + +/* Creating values */ + +/*! +@function +@abstract Creates a JavaScript value of the undefined type. +@param ctx The execution context to use. +@result The unique undefined value. +*/ +JS_EXPORT JSValueRef JSValueMakeUndefined(JSContextRef ctx); + +/*! +@function +@abstract Creates a JavaScript value of the null type. +@param ctx The execution context to use. +@result The unique null value. +*/ +JS_EXPORT JSValueRef JSValueMakeNull(JSContextRef ctx); + +/*! +@function +@abstract Creates a JavaScript value of the boolean type. +@param ctx The execution context to use. +@param boolean The bool to assign to the newly created JSValue. +@result A JSValue of the boolean type, representing the value of boolean. +*/ +JS_EXPORT JSValueRef JSValueMakeBoolean(JSContextRef ctx, bool boolean); + +/*! +@function +@abstract Creates a JavaScript value of the number type. +@param ctx The execution context to use. +@param number The double to assign to the newly created JSValue. +@result A JSValue of the number type, representing the value of number. +*/ +JS_EXPORT JSValueRef JSValueMakeNumber(JSContextRef ctx, double number); + +/*! +@function +@abstract Creates a JavaScript value of the string type. +@param ctx The execution context to use. +@param string The JSString to assign to the newly created JSValue. The + newly created JSValue retains string, and releases it upon garbage collection. +@result A JSValue of the string type, representing the value of string. +*/ +JS_EXPORT JSValueRef JSValueMakeString(JSContextRef ctx, JSStringRef string); + +/*! + @function + @abstract Creates a JavaScript value of the symbol type. + @param ctx The execution context to use. + @param description A description of the newly created symbol value. + @result A unique JSValue of the symbol type, whose description matches the one provided. + */ +JS_EXPORT JSValueRef JSValueMakeSymbol(JSContextRef ctx, JSStringRef description) JSC_API_AVAILABLE(macos(10.15), ios(13.0)); + +/* Converting to and from JSON formatted strings */ + +/*! + @function + @abstract Creates a JavaScript value from a JSON formatted string. + @param ctx The execution context to use. + @param string The JSString containing the JSON string to be parsed. + @result A JSValue containing the parsed value, or NULL if the input is invalid. + */ +JS_EXPORT JSValueRef JSValueMakeFromJSONString(JSContextRef ctx, JSStringRef string) JSC_API_AVAILABLE(macos(10.7), ios(7.0)); + +/*! + @function + @abstract Creates a JavaScript string containing the JSON serialized representation of a JS value. + @param ctx The execution context to use. + @param value The value to serialize. + @param indent The number of spaces to indent when nesting. If 0, the resulting JSON will not contains newlines. The size of the indent is clamped to 10 spaces. + @param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. + @result A JSString with the result of serialization, or NULL if an exception is thrown. + */ +JS_EXPORT JSStringRef JSValueCreateJSONString(JSContextRef ctx, JSValueRef value, unsigned indent, JSValueRef* exception) JSC_API_AVAILABLE(macos(10.7), ios(7.0)); + +/* Converting to primitive values */ + +/*! +@function +@abstract Converts a JavaScript value to boolean and returns the resulting boolean. +@param ctx The execution context to use. +@param value The JSValue to convert. +@result The boolean result of conversion. +*/ +JS_EXPORT bool JSValueToBoolean(JSContextRef ctx, JSValueRef value); + +/*! +@function +@abstract Converts a JavaScript value to number and returns the resulting number. +@param ctx The execution context to use. +@param value The JSValue to convert. +@param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. +@result The numeric result of conversion, or NaN if an exception is thrown. +*/ +JS_EXPORT double JSValueToNumber(JSContextRef ctx, JSValueRef value, JSValueRef* exception); + +/*! +@function +@abstract Converts a JavaScript value to string and copies the result into a JavaScript string. +@param ctx The execution context to use. +@param value The JSValue to convert. +@param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. +@result A JSString with the result of conversion, or NULL if an exception is thrown. Ownership follows the Create Rule. +*/ +JS_EXPORT JSStringRef JSValueToStringCopy(JSContextRef ctx, JSValueRef value, JSValueRef* exception); + +/*! +@function +@abstract Converts a JavaScript value to object and returns the resulting object. +@param ctx The execution context to use. +@param value The JSValue to convert. +@param exception A pointer to a JSValueRef in which to store an exception, if any. Pass NULL if you do not care to store an exception. +@result The JSObject result of conversion, or NULL if an exception is thrown. +*/ +JS_EXPORT JSObjectRef JSValueToObject(JSContextRef ctx, JSValueRef value, JSValueRef* exception); + +/* Garbage collection */ +/*! +@function +@abstract Protects a JavaScript value from garbage collection. +@param ctx The execution context to use. +@param value The JSValue to protect. +@discussion Use this method when you want to store a JSValue in a global or on the heap, where the garbage collector will not be able to discover your reference to it. + +A value may be protected multiple times and must be unprotected an equal number of times before becoming eligible for garbage collection. +*/ +JS_EXPORT void JSValueProtect(JSContextRef ctx, JSValueRef value); + +/*! +@function +@abstract Unprotects a JavaScript value from garbage collection. +@param ctx The execution context to use. +@param value The JSValue to unprotect. +@discussion A value may be protected multiple times and must be unprotected an + equal number of times before becoming eligible for garbage collection. +*/ +JS_EXPORT void JSValueUnprotect(JSContextRef ctx, JSValueRef value); + +#ifdef __cplusplus +} +#endif + +#endif /* JSValueRef_h */ diff --git a/engine/inc/JavaScriptCore/JavaScript.h b/engine/inc/JavaScriptCore/JavaScript.h new file mode 100644 index 00000000..76c52d6e --- /dev/null +++ b/engine/inc/JavaScriptCore/JavaScript.h @@ -0,0 +1,37 @@ +/* + * Copyright (C) 2006 Apple Inc. All rights reserved. + * Copyright (C) 2008 Alp Toker + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions + * are met: + * 1. Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * 2. Redistributions in binary form must reproduce the above copyright + * notice, this list of conditions and the following disclaimer in the + * documentation and/or other materials provided with the distribution. + * + * THIS SOFTWARE IS PROVIDED BY APPLE INC. ``AS IS'' AND ANY + * EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE + * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR + * PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL APPLE INC. OR + * CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, + * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, + * PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR + * PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY + * OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT + * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE + * OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + */ + +#ifndef JavaScript_h +#define JavaScript_h + +#include +#include +#include +#include +#include +#include + +#endif /* JavaScript_h */ diff --git a/engine/inc/JavaScriptCore/WebKitAvailability.h b/engine/inc/JavaScriptCore/WebKitAvailability.h new file mode 100644 index 00000000..9d39648e --- /dev/null +++ b/engine/inc/JavaScriptCore/WebKitAvailability.h @@ -0,0 +1,80 @@ +/* + * Copyright (C) 2008, 2009, 2010, 2014 Apple Inc. All Rights Reserved. + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions + * are met: + * 1. Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * 2. Redistributions in binary form must reproduce the above copyright + * notice, this list of conditions and the following disclaimer in the + * documentation and/or other materials provided with the distribution. + * + * THIS SOFTWARE IS PROVIDED BY APPLE INC. ``AS IS'' AND ANY + * EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE + * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR + * PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL APPLE INC. OR + * CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, + * EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, + * PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR + * PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY + * OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT + * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE + * OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + */ + +#ifndef __WebKitAvailability__ +#define __WebKitAvailability__ + +#if defined(__APPLE__) && defined(DEFINE_AVAILABILITY_MACROS) + +#include +#include + +#if !TARGET_OS_IPHONE && __MAC_OS_X_VERSION_MIN_REQUIRED < 101100 +/* To support availability macros that mention newer OS X versions when building on older OS X versions, + we provide our own definitions of the underlying macros that the availability macros expand to. We're + free to expand the macros as no-ops since frameworks built on older OS X versions only ship bundled with + an application rather than as part of the system. +*/ + +#ifndef __NSi_10_10 // Building from trunk rather than SDK. +#define __NSi_10_10 introduced=10.0 // Use 10.0 to indicate that everything is available. +#endif + +#ifndef __NSi_10_11 // Building from trunk rather than SDK. +#define __NSi_10_11 introduced=10.0 // Use 10.0 to indicate that everything is available. +#endif + +#ifndef __NSi_10_12 // Building from trunk rather than SDK. +#define __NSi_10_12 introduced=10.0 // Use 10.0 to indicate that everything is available. +#endif + +#ifndef __AVAILABILITY_INTERNAL__MAC_10_9 +#define __AVAILABILITY_INTERNAL__MAC_10_9 +#endif + +#ifndef __AVAILABILITY_INTERNAL__MAC_10_10 +#define __AVAILABILITY_INTERNAL__MAC_10_10 +#endif + +#ifndef AVAILABLE_MAC_OS_X_VERSION_10_9_AND_LATER +#define AVAILABLE_MAC_OS_X_VERSION_10_9_AND_LATER +#endif + +#ifndef AVAILABLE_MAC_OS_X_VERSION_10_10_AND_LATER +#define AVAILABLE_MAC_OS_X_VERSION_10_10_AND_LATER +#endif + +#endif /* !TARGET_OS_IPHONE && __MAC_OS_X_VERSION_MIN_REQUIRED < 101100 */ + +#if defined(BUILDING_GTK__) +#undef JSC_API_AVAILABLE +#define JSC_API_AVAILABLE(...) +#endif + +#else +#define JSC_API_AVAILABLE(...) +#endif + +#endif /* __WebKitAvailability__ */ diff --git a/engine/inc/PassiveSocket.h b/engine/inc/PassiveSocket.h new file mode 100644 index 00000000..0dbf069b --- /dev/null +++ b/engine/inc/PassiveSocket.h @@ -0,0 +1,120 @@ +/*---------------------------------------------------------------------------*/ +/* */ +/* Socket.h - Passive Socket Decleration. */ +/* */ +/* Author : Mark Carrier (mark@carrierlabs.com) */ +/* */ +/*---------------------------------------------------------------------------*/ +/* Copyright (c) 2007-2009 CarrierLabs, LLC. All rights reserved. + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions + * are met: + * + * 1. Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * + * 2. Redistributions in binary form must reproduce the above copyright + * notice, this list of conditions and the following disclaimer in + * the documentation and/or other materials provided with the + * distribution. + * + * 3. The name of the author may not be used to endorse or promote products + * derived from this software without specific prior written permission. + * + * 4. The name "CarrierLabs" must not be used to + * endorse or promote products derived from this software without + * prior written permission. For written permission, please contact + * mark@carrierlabs.com. + * + * THIS SOFTWARE IS PROVIDED BY MARK CARRIER ``AS IS'' AND ANY + * EXPRESSED OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE + * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR + * PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL MARK CARRIER OR + * ITS CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, + * SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT + * NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; + * LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) + * HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, + * STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) + * ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED + * OF THE POSSIBILITY OF SUCH DAMAGE. + *----------------------------------------------------------------------------*/ +#ifndef __PASSIVESOCKET_H__ +#define __PASSIVESOCKET_H__ +#include "ActiveSocket.h" + +/// Provides a platform independent class to create a passive socket. +/// A passive socket is used to create a "listening" socket. This type +/// of object would be used when an application needs to wait for +/// inbound connections. Support for CSimpleSocket::SocketTypeTcp, +/// CSimpleSocket::SocketTypeUdp, and CSimpleSocket::SocketTypeRaw is handled +/// in a similar fashion. The big difference is that the method +/// CPassiveSocket::Accept should not be called on the latter two socket +/// types. +class CPassiveSocket : public CSimpleSocket +{ +public: + CPassiveSocket(CSocketType type = SocketTypeTcp); + virtual ~CPassiveSocket() + { + Close(); + }; + + /// Extracts the first connection request on the queue of pending + /// connections and creates a newly connected socket. Used with + /// CSocketType CSimpleSocket::SocketTypeTcp. It is the responsibility of + /// the caller to delete the returned object when finished. + /// @return if successful a pointer to a newly created CActiveSocket object + /// will be returned and the internal error condition of the CPassiveSocket + /// object will be CPassiveSocket::SocketSuccess. If an error condition was encountered + /// the NULL will be returned and one of the following error conditions will be set: + /// CPassiveSocket::SocketEwouldblock, CPassiveSocket::SocketInvalidSocket, + /// CPassiveSocket::SocketConnectionAborted, CPassiveSocket::SocketInterrupted + /// CPassiveSocket::SocketProtocolError, CPassiveSocket::SocketFirewallError + virtual CActiveSocket *Accept(void); + + /// Bind to a multicast group on a specified interface, multicast group, and port + /// + /// @param pInterface - interface on which to bind. + /// @param pGroup - multicast group address to bind. + /// @param nPort - port on which multicast + /// @return true if able to bind to interface and multicast group. + /// If not successful, the false is returned and one of the following error + /// condiitions will be set: CPassiveSocket::SocketAddressInUse, CPassiveSocket::SocketProtocolError, + /// CPassiveSocket::SocketInvalidSocket. The following socket errors are for Linux/Unix + /// derived systems only: CPassiveSocket::SocketInvalidSocketBuffer + bool BindMulticast(const char *pInterface, const char *pGroup, uint16 nPort); + + /// Create a listening socket at local ip address 'x.x.x.x' or 'localhost' + /// if pAddr is NULL on port nPort. + /// + /// @param pAddr specifies the IP address on which to listen. + /// @param nPort specifies the port on which to listen. + /// @param nConnectionBacklog specifies connection queue backlog (default 30,000) + /// @return true if a listening socket was created. + /// If not successful, the false is returned and one of the following error + /// conditions will be set: CPassiveSocket::SocketAddressInUse, CPassiveSocket::SocketProtocolError, + /// CPassiveSocket::SocketInvalidSocket. The following socket errors are for Linux/Unix + /// derived systems only: CPassiveSocket::SocketInvalidSocketBuffer + virtual bool Listen(const char *pAddr, uint16 nPort, int32 nConnectionBacklog = 30000); + + /// Attempts to send a block of data on an established connection. + /// @param pBuf block of data to be sent. + /// @param bytesToSend size of data block to be sent. + /// @return number of bytes actually sent, return of zero means the + /// connection has been shutdown on the other side, and a return of -1 + /// means that an error has occurred. If an error was signaled then one + /// of the following error codes will be set: CPassiveSocket::SocketInvalidSocket, + /// CPassiveSocket::SocketEwouldblock, SimpleSocket::SocketConnectionReset, + /// CPassiveSocket::SocketInvalidSocketBuffer, CPassiveSocket::SocketInterrupted, + /// CPassiveSocket::SocketProtocolError, CPassiveSocket::SocketNotconnected + ///
\b Note: This function is used only for a socket of type + /// CSimpleSocket::SocketTypeUdp + virtual int32 Send(const uint8 *pBuf, size_t bytesToSend); + +private: + struct ip_mreq m_stMulticastRequest; /// group address for multicast +}; + +#endif // __PASSIVESOCKET_H__ diff --git a/engine/inc/SimpleSocket.h b/engine/inc/SimpleSocket.h new file mode 100644 index 00000000..99cd2e1b --- /dev/null +++ b/engine/inc/SimpleSocket.h @@ -0,0 +1,617 @@ +/*---------------------------------------------------------------------------*/ +/* */ +/* SimpleSocket.h - Simple Socket base class decleration. */ +/* */ +/* Author : Mark Carrier (mark@carrierlabs.com) */ +/* */ +/*---------------------------------------------------------------------------*/ +/* Copyright (c) 2007-2009 CarrierLabs, LLC. All rights reserved. + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions + * are met: + * + * 1. Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * + * 2. Redistributions in binary form must reproduce the above copyright + * notice, this list of conditions and the following disclaimer in + * the documentation and/or other materials provided with the + * distribution. + * + * 3. The name of the author may not be used to endorse or promote products + * derived from this software without specific prior written permission. + * + * 4. The name "CarrierLabs" must not be used to + * endorse or promote products derived from this software without + * prior written permission. For written permission, please contact + * mark@carrierlabs.com. + * + * THIS SOFTWARE IS PROVIDED BY MARK CARRIER ``AS IS'' AND ANY + * EXPRESSED OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE + * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR + * PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL MARK CARRIER OR + * ITS CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, + * SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT + * NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; + * LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) + * HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, + * STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) + * ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED + * OF THE POSSIBILITY OF SUCH DAMAGE. + *----------------------------------------------------------------------------*/ +#ifndef __SOCKET_H__ +#define __SOCKET_H__ + +#include +#include +#include +#include +#include + +#if defined(_LINUX) || defined(_DARWIN) || defined(_BSD) +#include +#include +#include +#include +#include +#include +#endif +#ifdef _LINUX +#include +#include +#include +#include +#endif +#ifdef _DARWIN +#include +#endif +#if defined(_LINUX) || defined(_DARWIN) || defined(_BSD) +#include +#include +#include +#include +#endif + +#ifdef _WIN32 +#include +#include +#include + +#define IPTOS_LOWDELAY 0x10 + +#endif +#include "Host.h" +#include "StatTimer.h" + +//----------------------------------------------------------------------------- +// General class macro definitions and typedefs +//----------------------------------------------------------------------------- +#ifndef INVALID_SOCKET +#define INVALID_SOCKET ~(0) +#endif + +#define SOCKET_SENDFILE_BLOCKSIZE 8192 + +/// Provides a platform independent class to for socket development. +/// This class is designed to abstract socket communication development in a +/// platform independent manner. +/// - Socket types +/// -# CActiveSocket Class +/// -# CPassiveSocket Class +class CSimpleSocket +{ +public: + /// Defines the three possible states for shuting down a socket. + typedef enum + { + Receives = SHUT_RD, ///< Shutdown passive socket. + Sends = SHUT_WR, ///< Shutdown active socket. + Both = SHUT_RDWR ///< Shutdown both active and passive sockets. + } CShutdownMode; + + /// Defines the socket types defined by CSimpleSocket class. + typedef enum + { + SocketTypeInvalid, ///< Invalid socket type. + SocketTypeTcp, ///< Defines socket as TCP socket. + SocketTypeUdp, ///< Defines socket as UDP socket. + SocketTypeTcp6, ///< Defines socket as IPv6 TCP socket. + SocketTypeUdp6, ///< Defines socket as IPv6 UDP socket. + SocketTypeRaw ///< Provides raw network protocol access. + } CSocketType; + + /// Defines all error codes handled by the CSimpleSocket class. + typedef enum + { + SocketError = -1, ///< Generic socket error translates to error below. + SocketSuccess = 0, ///< No socket error. + SocketInvalidSocket, ///< Invalid socket handle. + SocketInvalidAddress, ///< Invalid destination address specified. + SocketInvalidPort, ///< Invalid destination port specified. + SocketConnectionRefused, ///< No server is listening at remote address. + SocketTimedout, ///< Timed out while attempting operation. + SocketEwouldblock, ///< Operation would block if socket were blocking. + SocketNotconnected, ///< Currently not connected. + SocketEinprogress, ///< Socket is non-blocking and the connection cannot be completed immediately + SocketInterrupted, ///< Call was interrupted by a signal that was caught before a valid connection arrived. + SocketConnectionAborted, ///< The connection has been aborted. + SocketProtocolError, ///< Invalid protocol for operation. + SocketFirewallError, ///< Firewall rules forbid connection. + SocketInvalidSocketBuffer, ///< The receive buffer point outside the process's address space. + SocketConnectionReset, ///< Connection was forcibly closed by the remote host. + SocketAddressInUse, ///< Address already in use. + SocketInvalidPointer, ///< Pointer type supplied as argument is invalid. + SocketEunknown ///< Unknown error please report to mark@carrierlabs.com + } CSocketError; + +public: + CSimpleSocket(CSocketType type = SocketTypeTcp); + CSimpleSocket(CSimpleSocket &socket); + + virtual ~CSimpleSocket() + { + if (m_pBuffer != NULL) + { + delete[] m_pBuffer; + m_pBuffer = NULL; + } + }; + + /// Initialize instance of CSocket. This method MUST be called before an + /// object can be used. Errors : CSocket::SocketProtocolError, + /// CSocket::SocketInvalidSocket, + /// @return true if properly initialized. + virtual bool Initialize(void); + + /// Close socket + /// @return true if successfully closed otherwise returns false. + virtual bool Close(void); + + /// Shutdown shut down socket send and receive operations + /// CShutdownMode::Receives - Disables further receive operations. + /// CShutdownMode::Sends - Disables further send operations. + /// CShutdownBoth:: - Disables further send and receive operations. + /// @param nShutdown specifies the type of shutdown. + /// @return true if successfully shutdown otherwise returns false. + virtual bool Shutdown(CShutdownMode nShutdown); + + /// Examine the socket descriptor sets currently owned by the instance of + /// the socket class (the readfds, writefds, and errorfds parameters) to + /// see whether some of their descriptors are ready for reading, are ready + /// for writing, or have an exceptional condition pending, respectively. + /// Block until an event happens on the specified file descriptors. + /// @return true if socket has data ready, or false if not ready or timed out. + virtual bool Select(void) + { + return Select(0, 0); + }; + + /// Examine the socket descriptor sets currently owned by the instance of + /// the socket class (the readfds, writefds, and errorfds parameters) to + /// see whether some of their descriptors are ready for reading, are ready + /// for writing, or have an exceptional condition pending, respectively. + /// @param nTimeoutSec timeout in seconds for select. + /// @param nTimeoutUSec timeout in micro seconds for select. + /// @return true if socket has data ready, or false if not ready or timed out. + virtual bool Select(int32 nTimeoutSec, int32 nTimeoutUSec); + + /// Does the current instance of the socket object contain a valid socket + /// descriptor. + /// @return true if the socket object contains a valid socket descriptor. + virtual bool IsSocketValid(void) + { + return (m_socket != SocketError); + }; + + /// Provides a standard error code for cross platform development by + /// mapping the operating system error to an error defined by the CSocket + /// class. + void TranslateSocketError(void); + + /// Returns a human-readable description of the given error code + /// or the last error code of a socket + static const char *DescribeError(CSocketError err); + inline const char *DescribeError() + { + return DescribeError(m_socketErrno); + }; + + /// Attempts to receive a block of data on an established connection. + /// @param nMaxBytes maximum number of bytes to receive. + /// @param pBuffer, memory where to receive the data, + /// NULL receives to internal buffer returned with GetData() + /// Non-NULL receives directly there, but GetData() will return WRONG ptr! + /// @return number of bytes actually received. + /// @return of zero means the connection has been shutdown on the other side. + /// @return of -1 means that an error has occurred. + virtual int32 Receive(int32 nMaxBytes = 1, uint8 *pBuffer = 0); + + /// Attempts to send a block of data on an established connection. + /// @param pBuf block of data to be sent. + /// @param bytesToSend size of data block to be sent. + /// @return number of bytes actually sent. + /// @return of zero means the connection has been shutdown on the other side. + /// @return of -1 means that an error has occurred. + virtual int32 Send(const uint8 *pBuf, size_t bytesToSend); + + /// Attempts to send at most nNumItem blocks described by sendVector + /// to the socket descriptor associated with the socket object. + /// @param sendVector pointer to an array of iovec structures + /// @param nNumItems number of items in the vector to process + ///
\b NOTE: Buffers are processed in the order specified. + /// @return number of bytes actually sent, return of zero means the + /// connection has been shutdown on the other side, and a return of -1 + /// means that an error has occurred. + virtual int32 Send(const struct iovec *sendVector, int32 nNumItems); + + /// Copies data between one file descriptor and another. + /// On some systems this copying is done within the kernel, and thus is + /// more efficient than the combination of CSimpleSocket::Send and + /// CSimpleSocket::Receive, which would require transferring data to and + /// from user space. + ///
\b Note: This is available on all implementations, but the kernel + /// implementation is only available on Unix type systems. + /// @param nOutFd descriptor opened for writing. + /// @param nInFd descriptor opened for reading. + /// @param pOffset from which to start reading data from input file. + /// @param nCount number of bytes to copy between file descriptors. + /// @return number of bytes written to the out socket descriptor. + virtual int32 SendFile(int32 nOutFd, int32 nInFd, off_t *pOffset, int32 nCount); + + /// Returns blocking/non-blocking state of socket. + /// @return true if the socket is non-blocking, else return false. + bool IsNonblocking(void) + { + return (m_bIsBlocking == false); + }; + + /// Set the socket to blocking. + /// @return true if successful set to blocking, else return false; + bool SetBlocking(void); + + /// Set the socket as non-blocking. + /// @return true if successful set to non-blocking, else return false; + bool SetNonblocking(void); + + /// Get a pointer to internal receive buffer. The user MUST not free this + /// pointer when finished. This memory is managed internally by the CSocket + /// class. + /// @return pointer to data if valid, else returns NULL. + uint8 *GetData(void) + { + return m_pBuffer; + }; + + /// Returns the number of bytes received on the last call to + /// CSocket::Receive(). + /// @return number of bytes received. + int32 GetBytesReceived(void) + { + return m_nBytesReceived; + }; + + /// Returns the number of bytes sent on the last call to + /// CSocket::Send(). + /// @return number of bytes sent. + int32 GetBytesSent(void) + { + return m_nBytesSent; + }; + + /// Controls the actions taken when CSimpleSocket::Close is executed on a + /// socket object that has unsent data. The default value for this option + /// is \b off. + /// - Following are the three possible scenarios. + /// -# \b bEnable is false, CSimpleSocket::Close returns immediately, but + /// any unset data is transmitted (after CSimpleSocket::Close returns) + /// -# \b bEnable is true and \b nTime is zero, CSimpleSocket::Close return + /// immediately and any unsent data is discarded. + /// -# \b bEnable is true and \b nTime is nonzero, CSimpleSocket::Close does + /// not return until all unsent data is transmitted (or the connection is + /// Closed by the remote system). + ///

+ /// @param bEnable true to enable option false to disable option. + /// @param nTime time in seconds to linger. + /// @return true if option successfully set + bool SetOptionLinger(bool bEnable, uint16 nTime); + + /// Tells the kernel that even if this port is busy (in the TIME_WAIT state), + /// go ahead and reuse it anyway. If it is busy, but with another state, + /// you will still get an address already in use error. + /// @return true if option successfully set + bool SetOptionReuseAddr(); + + /// Gets the timeout value that specifies the maximum number of seconds a + /// call to CSimpleSocket::Open waits until it completes. + /// @return the length of time in seconds + int32 GetConnectTimeoutSec(void) + { + return m_stConnectTimeout.tv_sec; + }; + + /// Gets the timeout value that specifies the maximum number of microseconds + /// a call to CSimpleSocket::Open waits until it completes. + /// @return the length of time in microseconds + int32 GetConnectTimeoutUSec(void) + { + return m_stConnectTimeout.tv_usec; + }; + + /// Sets the timeout value that specifies the maximum amount of time a call + /// to CSimpleSocket::Receive waits until it completes. Use the method + /// CSimpleSocket::SetReceiveTimeout to specify the number of seconds to wait. + /// If a call to CSimpleSocket::Receive has blocked for the specified length of + /// time without receiving additional data, it returns with a partial count + /// or CSimpleSocket::GetSocketError set to CSimpleSocket::SocketEwouldblock if no data + /// were received. + /// @param nConnectTimeoutSec of timeout in seconds. + /// @param nConnectTimeoutUsec of timeout in microseconds. + /// @return true if socket connection timeout was successfully set. + void SetConnectTimeout(int32 nConnectTimeoutSec, int32 nConnectTimeoutUsec = 0) + { + m_stConnectTimeout.tv_sec = nConnectTimeoutSec; + m_stConnectTimeout.tv_usec = nConnectTimeoutUsec; + }; + + /// Gets the timeout value that specifies the maximum number of seconds a + /// a call to CSimpleSocket::Receive waits until it completes. + /// @return the length of time in seconds + int32 GetReceiveTimeoutSec(void) + { + return m_stRecvTimeout.tv_sec; + }; + + /// Gets the timeout value that specifies the maximum number of microseconds + /// a call to CSimpleSocket::Receive waits until it completes. + /// @return the length of time in microseconds + int32 GetReceiveTimeoutUSec(void) + { + return m_stRecvTimeout.tv_usec; + }; + + /// Sets the timeout value that specifies the maximum amount of time a call + /// to CSimpleSocket::Receive waits until it completes. Use the method + /// CSimpleSocket::SetReceiveTimeout to specify the number of seconds to wait. + /// If a call to CSimpleSocket::Receive has blocked for the specified length of + /// time without receiving additional data, it returns with a partial count + /// or CSimpleSocket::GetSocketError set to CSimpleSocket::SocketEwouldblock if no data + /// were received. + /// @param nRecvTimeoutSec of timeout in seconds. + /// @param nRecvTimeoutUsec of timeout in microseconds. + /// @return true if socket timeout was successfully set. + bool SetReceiveTimeout(int32 nRecvTimeoutSec, int32 nRecvTimeoutUsec = 0); + + /// Enable/disable multicast for a socket. This options is only valid for + /// socket descriptors of type CSimpleSocket::SocketTypeUdp. + /// @return true if multicast was enabled or false if socket type is not + /// CSimpleSocket::SocketTypeUdp and the error will be set to + /// CSimpleSocket::SocketProtocolError + bool SetMulticast(bool bEnable, uint8 multicastTTL = 1); + + /// Return true if socket is multicast or false is socket is unicast + /// @return true if multicast is enabled + bool GetMulticast() + { + return m_bIsMulticast; + }; + + /// Bind socket to a specific interface when using multicast. + /// @return true if successfully bound to interface + bool BindInterface(const char *pInterface); + + /// Gets the timeout value that specifies the maximum number of seconds a + /// a call to CSimpleSocket::Send waits until it completes. + /// @return the length of time in seconds + int32 GetSendTimeoutSec(void) + { + return m_stSendTimeout.tv_sec; + }; + + /// Gets the timeout value that specifies the maximum number of microseconds + /// a call to CSimpleSocket::Send waits until it completes. + /// @return the length of time in microseconds + int32 GetSendTimeoutUSec(void) + { + return m_stSendTimeout.tv_usec; + }; + + /// Gets the timeout value that specifies the maximum amount of time a call + /// to CSimpleSocket::Send waits until it completes. + /// @return the length of time in seconds + bool SetSendTimeout(int32 nSendTimeoutSec, int32 nSendTimeoutUsec = 0); + + /// Returns the last error that occured for the instace of the CSimpleSocket + /// instance. This method should be called immediately to retrieve the + /// error code for the failing mehtod call. + /// @return last error that occured. + CSocketError GetSocketError(void) + { + return m_socketErrno; + }; + /* + CSocketError GetSocketError(void) { + CSocketError err = m_socketErrno; + m_socketErrno = SocketSuccess; + return err; + + }; + */ + + /// Get the total time the of the last operation in milliseconds. + /// @return number of milliseconds of last operation. + uint32 GetTotalTimeMs() + { + return m_timer.GetMilliSeconds(); + }; + + /// Get the total time the of the last operation in microseconds. + /// @return number of microseconds or last operation. + uint32 GetTotalTimeUsec() + { + return m_timer.GetMicroSeconds(); + }; + + /// Return Differentiated Services Code Point (DSCP) value currently set on the socket object. + /// @return DSCP for current socket object. + ///

\b NOTE: Windows special notes http://support.microsoft.com/kb/248611. + int GetSocketDscp(void); + + /// Set Differentiated Services Code Point (DSCP) for socket object. + /// @param nDscp value of TOS setting which will be converted to DSCP + /// @return true if DSCP value was properly set + ///

\b NOTE: Windows special notes http://support.microsoft.com/kb/248611. + bool SetSocketDscp(int nDscp); + + /// Return socket descriptor + /// @return socket descriptor which is a signed 32 bit integer. + SOCKET GetSocketDescriptor() + { + return m_socket; + }; + + /// Return socket descriptor + /// @return socket descriptor which is a signed 32 bit integer. + CSocketType GetSocketType() + { + return m_nSocketType; + }; + + /// Returns clients Internet host address as a string in standard numbers-and-dots notation. + /// @return NULL if invalid + const char *GetClientAddr() + { + return inet_ntoa(m_stClientSockaddr.sin_addr); + }; + + /// Returns the port number on which the client is connected. + /// @return client port number. + uint16 GetClientPort() + { + return m_stClientSockaddr.sin_port; + }; + + /// Returns server Internet host address as a string in standard numbers-and-dots notation. + /// @return NULL if invalid + const char *GetServerAddr() + { + return inet_ntoa(m_stServerSockaddr.sin_addr); + }; + + /// Returns the port number on which the server is connected. + /// @return server port number. + uint16 GetServerPort() + { + return ntohs(m_stServerSockaddr.sin_port); + }; + + /// Get the TCP receive buffer window size for the current socket object. + ///

\b NOTE: Linux will set the receive buffer to twice the value passed. + /// @return zero on failure else the number of bytes of the TCP receive buffer window size if successful. + uint32 GetReceiveWindowSize() + { + return GetWindowSize(SO_RCVBUF); + }; + + /// Get the TCP send buffer window size for the current socket object. + ///

\b NOTE: Linux will set the send buffer to twice the value passed. + /// @return zero on failure else the number of bytes of the TCP receive buffer window size if successful. + uint32 GetSendWindowSize() + { + return GetWindowSize(SO_SNDBUF); + }; + + /// Set the TCP receive buffer window size for the current socket object. + ///

\b NOTE: Linux will set the receive buffer to twice the value passed. + /// @return zero on failure else the number of bytes of the TCP send buffer window size if successful. + uint32 SetReceiveWindowSize(uint32 nWindowSize) + { + return SetWindowSize(SO_RCVBUF, nWindowSize); + }; + + /// Set the TCP send buffer window size for the current socket object. + ///

\b NOTE: Linux will set the send buffer to twice the value passed. + /// @return zero on failure else the number of bytes of the TCP send buffer window size if successful. + uint32 SetSendWindowSize(uint32 nWindowSize) + { + return SetWindowSize(SO_SNDBUF, nWindowSize); + }; + + /// Disable the Nagle algorithm (Set TCP_NODELAY to true) + /// @return false if failed to set socket option otherwise return true; + bool DisableNagleAlgoritm(); + + /// Enable the Nagle algorithm (Set TCP_NODELAY to false) + /// @return false if failed to set socket option otherwise return true; + bool EnableNagleAlgoritm(); + +protected: + /// Set internal socket error to that specified error + /// @param error type of error + void SetSocketError(CSimpleSocket::CSocketError error) + { + m_socketErrno = error; + }; + + /// Set object socket handle to that specified as parameter + /// @param socket value of socket descriptor + void SetSocketHandle(SOCKET socket) + { + m_socket = socket; + }; + +private: + /// Generic function used to get the send/receive window size + /// @return zero on failure else the number of bytes of the TCP window size if successful. + uint32 GetWindowSize(uint32 nOptionName); + + /// Generic function used to set the send/receive window size + /// @return zero on failure else the number of bytes of the TCP window size if successful. + uint32 SetWindowSize(uint32 nOptionName, uint32 nWindowSize); + + /// Attempts to send at most nNumItem blocks described by sendVector + /// to the socket descriptor associated with the socket object. + /// @param sendVector pointer to an array of iovec structures + /// @param nNumItems number of items in the vector to process + ///
\b Note: This implementation is for systems that don't natively + /// support this functionality. + /// @return number of bytes actually sent, return of zero means the + /// connection has been shutdown on the other side, and a return of -1 + /// means that an error has occurred. + int32 Writev(const struct iovec *pVector, size_t nCount); + + /// Flush the socket descriptor owned by the object. + /// @return true data was successfully sent, else return false; + bool Flush(); + + CSimpleSocket *operator=(CSimpleSocket &socket); + +protected: + SOCKET m_socket; /// socket handle + CSocketError m_socketErrno; /// number of last error + uint8 *m_pBuffer; /// internal send/receive buffer + int32 m_nBufferSize; /// size of internal send/receive buffer + int32 m_nSocketDomain; /// socket type PF_INET, PF_INET6 + CSocketType m_nSocketType; /// socket type - UDP, TCP or RAW + int32 m_nBytesReceived; /// number of bytes received + int32 m_nBytesSent; /// number of bytes sent + uint32 m_nFlags; /// socket flags + bool m_bIsBlocking; /// is socket blocking + bool m_bIsMulticast; /// is the UDP socket multicast; + struct timeval m_stConnectTimeout; /// connection timeout + struct timeval m_stRecvTimeout; /// receive timeout + struct timeval m_stSendTimeout; /// send timeout + struct sockaddr_in m_stServerSockaddr; /// server address + struct sockaddr_in m_stClientSockaddr; /// client address + struct sockaddr_in m_stMulticastGroup; /// multicast group to bind to + struct linger m_stLinger; /// linger flag + CStatTimer m_timer; /// internal statistics. +#ifdef WIN32 + WSADATA m_hWSAData; /// Windows +#endif + fd_set m_writeFds; /// write file descriptor set + fd_set m_readFds; /// read file descriptor set + fd_set m_errorFds; /// error file descriptor set +}; + +#endif /* __SOCKET_H__ */ diff --git a/engine/inc/StatTimer.h b/engine/inc/StatTimer.h new file mode 100644 index 00000000..89d4cfa8 --- /dev/null +++ b/engine/inc/StatTimer.h @@ -0,0 +1,110 @@ +/*----------------------------------------------------------------------------*/ +/* */ +/* StatTimer.h: interface for the CStatTimer class. */ +/* */ +/* Author: Mark Carrier (mark@carrierlabs.com) */ +/* */ +/*----------------------------------------------------------------------------*/ +/* Copyright (c) 2006 CarrierLabs, LLC. All rights reserved. + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions + * are met: + * + * 1. Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * + * 2. Redistributions in binary form must reproduce the above copyright + * notice, this list of conditions and the following disclaimer in + * the documentation and/or other materials provided with the + * distribution. + * + * 3. The name of the author may not be used to endorse or promote products + * derived from this software without specific prior written permission. + * + * 4. The name "CarrierLabs" must not be used to + * endorse or promote products derived from this software without + * prior written permission. For written permission, please contact + * mark@carrierlabs.com. + * + * THIS SOFTWARE IS PROVIDED BY MARK CARRIER ``AS IS'' AND ANY + * EXPRESSED OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE + * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR + * PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL MARK CARRIER OR + * ITS CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, + * SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT + * NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; + * LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) + * HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, + * STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) + * ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED + * OF THE POSSIBILITY OF SUCH DAMAGE. + *----------------------------------------------------------------------------*/ +#ifndef __CSTATTIMER_H__ +#define __CSTATTIMER_H__ + +#include + +#ifdef WIN32 +#include +#include +#endif + +#ifdef _LINUX +#include +#include +#endif + +#include "Host.h" + +#if defined(WIN32) +#define GET_CLOCK_COUNT(x) QueryPerformanceCounter((LARGE_INTEGER *)x) +#else +#define GET_CLOCK_COUNT(x) gettimeofday(x, NULL) +#endif + +#define MILLISECONDS_CONVERSION 1000 +#define MICROSECONDS_CONVERSION 1000000 + +/// Class to abstract socket communications in a cross platform manner. +/// This class is designed +class CStatTimer +{ +public: + CStatTimer(){}; + + ~CStatTimer(){}; + + void Initialize() + { + memset(&m_startTime, 0, sizeof(struct timeval)); + memset(&m_endTime, 0, sizeof(struct timeval)); + }; + + struct timeval GetStartTime() { return m_startTime; }; + void SetStartTime() { GET_CLOCK_COUNT(&m_startTime); }; + + struct timeval GetEndTime() { return m_endTime; }; + void SetEndTime() { GET_CLOCK_COUNT(&m_endTime); }; + + uint32 GetMilliSeconds() { return (CalcTotalUSec() / MILLISECONDS_CONVERSION); }; + uint32 GetMicroSeconds() { return (CalcTotalUSec()); }; + uint32 GetSeconds() { return (CalcTotalUSec() / MICROSECONDS_CONVERSION); }; + + uint32 GetCurrentTime() + { + struct timeval tmpTime; + GET_CLOCK_COUNT(&tmpTime); + return ((tmpTime.tv_sec * MICROSECONDS_CONVERSION) + tmpTime.tv_usec); + }; + +private: + uint32 CalcTotalUSec() { return (((m_endTime.tv_sec - m_startTime.tv_sec) * MICROSECONDS_CONVERSION) + + (m_endTime.tv_usec - m_startTime.tv_usec)); }; + +private: + struct timeval m_startTime; + struct timeval m_endTime; +}; + +#endif // __CSTATTIMER_H__ diff --git a/engine/inc/Ultralight/Bitmap.h b/engine/inc/Ultralight/Bitmap.h new file mode 100644 index 00000000..8be71119 --- /dev/null +++ b/engine/inc/Ultralight/Bitmap.h @@ -0,0 +1,279 @@ +/// +/// @file Bitmap.h +/// +/// @brief The header for the Bitmap class. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include +#include +#include + +namespace ultralight { + +#pragma pack(push, 1) + +/// +/// The various Bitmap formats. +/// +enum UExport BitmapFormat { + /** + * Alpha channel only, 8-bits per pixel. + * + * Encoding: 8-bits per channel, unsigned normalized. + * + * Color-space: Linear (no gamma), alpha-coverage only. + */ + kBitmapFormat_A8_UNORM, + + /** + * Blue Green Red Alpha channels, 32-bits per pixel. + * + * Encoding: 8-bits per channel, unsigned normalized. + * + * Color-space: sRGB gamma with premultiplied linear alpha channel. + * + * NOTE: Alpha is premultiplied with BGR channels _before_ sRGB gamma is + * applied so we can use sRGB conversion hardware and perform all + * blending in linear space on GPU. + */ + kBitmapFormat_BGRA8_UNORM_SRGB, +}; + +/// +/// Macro to get the bytes per pixel from a BitmapFormat +/// +#define GetBytesPerPixel(x) (x == kBitmapFormat_A8_UNORM? 1 : 4) + +/// +/// @brief Bitmap container with basic blitting and conversion routines. +/// +class UExport Bitmap : public RefCounted { + public: + /// + /// Create an empty Bitmap. No pixels will be allocated. + /// + static Ref Create(); + + /// + /// Create a Bitmap with a certain configuration. Pixels will be allocated + /// but not initialized. + /// + /// @param width The width in pixels. + /// + /// @param height The height in pixels. + /// + /// @param format The pixel format to use. + /// + /// @return A ref-pointer to a new Bitmap instance. + /// + static Ref Create(uint32_t width, uint32_t height, + BitmapFormat format); + + /// + /// Create a Bitmap with existing pixels and configuration. + /// + /// @param width The width in pixels. + /// + /// @param height The height in pixels. + /// + /// @param format The pixel format to use. + /// + /// @param row_bytes The number of bytes between each row (note that this + /// value should be >= width * bytes_per_pixel). + /// + /// @param pixels Pointer to raw pixel buffer. + /// + /// @param size Size of the raw pixel buffer. + /// + /// @param should_copy Whether or not a copy should be made of the pixels. + /// If this is false, the returned Bitmap will use the + /// raw pixels passed in as its own, but you are still + /// responsible for destroying your buffer afterwards. + /// + /// @param fixup_gamma Whether or not we should reinterpret the source + /// as an sRGB bitmap with premultiplied alpha applied + /// after the gamma function (typical of PNGs). We + /// expect all premultiplication to be applied before + /// the gamma function so we can blend properly in + /// linear space. Only valid for + /// kBitmapFormat_BGRA8_UNORM_SRGB. + /// + /// @return A ref-pointer to a new Bitmap instance. + /// + static Ref Create(uint32_t width, uint32_t height, + BitmapFormat format, uint32_t row_bytes, + const void* pixels, size_t size, + bool should_copy = true, bool fixup_gamma = false); + + /// + /// Create a bitmap from a deep copy of another Bitmap. + /// + static Ref Create(const Bitmap& bitmap); + + /// + /// Get the width in pixels. + /// + virtual uint32_t width() const = 0; + + /// + /// Get the height in pixels. + /// + virtual uint32_t height() const = 0; + + /// + /// Get the bounds as an IntRect + /// + virtual IntRect bounds() const = 0; + + /// + /// Get the pixel format. + /// + virtual BitmapFormat format() const = 0; + + /// + /// Get the number of bytes per pixel. + /// + virtual uint32_t bpp() const = 0; + + /// + /// Get the number of bytes between each row of pixels. + /// + /// @note This value is usually calculated as width * bytes_per_pixel (bpp) + /// but it may be larger due to alignment rules in the allocator. + /// + virtual uint32_t row_bytes() const = 0; + + /// + /// Get the size in bytes of the pixel buffer. + /// + /// @note Size is calculated as row_bytes() * height(). + /// + virtual size_t size() const = 0; + + /// + /// Whether or not this Bitmap owns the pixel buffer and will destroy it + /// at the end of its lifetime. + /// + virtual bool owns_pixels() const = 0; + + /// + /// Lock the pixel buffer for reading/writing. + /// + /// @return A pointer to the pixel buffer. + /// + virtual void* LockPixels() = 0; + + /// + /// Unlock the pixel buffer. + /// + virtual void UnlockPixels() = 0; + + /// + /// Lock the pixel buffer for reading/writing. (const) + /// + /// @return A const pointer to the pixel buffer. + /// + virtual const void* LockPixels() const = 0; + + /// + /// Unlock the pixel buffer. (const) + /// + virtual void UnlockPixels() const = 0; + + /// + /// Get the raw pixel buffer. + /// + /// @note You should only call this if pixels are already locked. + /// + virtual void* raw_pixels() = 0; + + /// + /// Whether or not this Bitmap is empty (no pixels allocated). + /// + virtual bool IsEmpty() const = 0; + + /// + /// Erase the Bitmap (set all pixels to 0). + /// + virtual void Erase() = 0; + + /// + /// Assign another bitmap to this one. + /// + /// @param bitmap The bitmap to copy from. + /// + virtual void Set(Ref bitmap) = 0; + + /// + /// Draw another bitmap to this bitmap. + /// + /// @note Formats do not need to match. Bitmap formats will be converted + /// to one another automatically. Note that when converting from + /// BGRA8 to A8, only the Blue channel will be used. + /// + /// @param src_rect The source rectangle, relative to src bitmap. + /// + /// @param dest_rect The destination rectangle, relative to this bitmap. + /// + /// @param src The source bitmap. + /// + /// @param pad_repeat Whether or not we should pad the drawn bitmap by one + /// pixel of repeated edge pixels from the source bitmap. + /// + /// @return Whether or not the operation succeeded (this can fail if the + /// src_rect and/or dest_rect are invalid, or if their total + /// dimensions do not match). + /// + virtual bool DrawBitmap(IntRect src_rect, IntRect dest_rect, + Ref src, bool pad_repeat) = 0; + + /// + /// Write this Bitmap out to a PNG image. (mainly used for Debug) + /// + /// @param path The filepath to write to (opened with fopen()) + /// + /// @return Whether or not the operation succeeded. + /// + virtual bool WritePNG(const char* path) = 0; + + /// + /// Make a resized copy of this bitmap by writing to a pre-allocated + /// destination bitmap. + /// + /// @param destination The bitmap to store the result in, the width and + /// height of the destination will be used. + /// + /// @param high_quality Whether or not a high quality resampling will be + /// used during the resize. (Otherwise, just uses fast + /// nearest-neighbor sampling) + /// + /// @return Whether or not the operation succeeded. This operation is only + /// valid if both formats are kBitmapFormat_BGRA8_UNORM_SRGB and + /// both the source and destination are non-empty. + /// + virtual bool Resample(Ref destination, bool high_quality) = 0; + + /// + /// This converts a BGRA bitmap to RGBA bitmap and vice-versa by swapping + /// the red and blue channels. + /// + virtual void SwapRedBlueChannels() = 0; + +protected: + Bitmap(); + virtual ~Bitmap(); + Bitmap(const Bitmap&); + void operator=(const Bitmap&); +}; + +#pragma pack(pop) + +} // namespace ultralight diff --git a/engine/inc/Ultralight/Buffer.h b/engine/inc/Ultralight/Buffer.h new file mode 100644 index 00000000..68d2de6e --- /dev/null +++ b/engine/inc/Ultralight/Buffer.h @@ -0,0 +1,47 @@ +/// +/// @file Buffer.h +/// +/// @brief The header for the Buffer class. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include +#include + +namespace ultralight { + +/// +/// A fixed-size byte container for passing data around. +/// +class UExport Buffer : public RefCounted { +public: + /// + /// Create a Buffer, a copy of data is made. + /// + static Ref Create(const void* data, size_t size); + + /// + /// Get a pointer to raw byte data. + /// + virtual void* data() = 0; + + /// + /// Get the size in bytes. + /// + virtual size_t size() const = 0; + +protected: + Buffer(); + virtual ~Buffer(); + Buffer(const Buffer&); + void operator=(const Buffer&); +}; + +} // namespace ultralight diff --git a/engine/inc/Ultralight/CAPI.h b/engine/inc/Ultralight/CAPI.h new file mode 100644 index 00000000..ff13bbd9 --- /dev/null +++ b/engine/inc/Ultralight/CAPI.h @@ -0,0 +1,1936 @@ +/// +/// @file CAPI.h +/// +/// @brief The C-language API for Ultralight +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#ifndef ULTRALIGHT_CAPI_H +#define ULTRALIGHT_CAPI_H + +#ifndef __cplusplus +//#include +#endif + +#include +#include +#ifdef __OBJC__ +#import +#endif + +#if defined(__WIN32__) || defined(_WIN32) +# if defined(ULTRALIGHT_IMPLEMENTATION) +# define ULExport __declspec(dllexport) +# else +# define ULExport __declspec(dllimport) +# endif +#define _thread_local __declspec(thread) +#ifndef _NATIVE_WCHAR_T_DEFINED +#define DISABLE_NATIVE_WCHAR_T +typedef unsigned short ULChar16; +#else +typedef wchar_t ULChar16; +#endif +#else +# define ULExport __attribute__((visibility("default"))) +#define _thread_local __thread +typedef unsigned short ULChar16; +#endif + +#ifdef __cplusplus +extern "C" { +#endif + +typedef struct C_Config* ULConfig; +typedef struct C_Renderer* ULRenderer; +typedef struct C_Session* ULSession; +typedef struct C_View* ULView; +typedef struct C_Bitmap* ULBitmap; +typedef struct C_String* ULString; +typedef struct C_Buffer* ULBuffer; +typedef struct C_KeyEvent* ULKeyEvent; +typedef struct C_MouseEvent* ULMouseEvent; +typedef struct C_ScrollEvent* ULScrollEvent; +typedef struct C_Surface* ULSurface; +typedef struct C_Surface* ULBitmapSurface; + +typedef enum { + kMessageSource_XML = 0, + kMessageSource_JS, + kMessageSource_Network, + kMessageSource_ConsoleAPI, + kMessageSource_Storage, + kMessageSource_AppCache, + kMessageSource_Rendering, + kMessageSource_CSS, + kMessageSource_Security, + kMessageSource_ContentBlocker, + kMessageSource_Other, +} ULMessageSource; + +typedef enum { + kMessageLevel_Log = 1, + kMessageLevel_Warning = 2, + kMessageLevel_Error = 3, + kMessageLevel_Debug = 4, + kMessageLevel_Info = 5, +} ULMessageLevel; + +typedef enum { + kCursor_Pointer = 0, + kCursor_Cross, + kCursor_Hand, + kCursor_IBeam, + kCursor_Wait, + kCursor_Help, + kCursor_EastResize, + kCursor_NorthResize, + kCursor_NorthEastResize, + kCursor_NorthWestResize, + kCursor_SouthResize, + kCursor_SouthEastResize, + kCursor_SouthWestResize, + kCursor_WestResize, + kCursor_NorthSouthResize, + kCursor_EastWestResize, + kCursor_NorthEastSouthWestResize, + kCursor_NorthWestSouthEastResize, + kCursor_ColumnResize, + kCursor_RowResize, + kCursor_MiddlePanning, + kCursor_EastPanning, + kCursor_NorthPanning, + kCursor_NorthEastPanning, + kCursor_NorthWestPanning, + kCursor_SouthPanning, + kCursor_SouthEastPanning, + kCursor_SouthWestPanning, + kCursor_WestPanning, + kCursor_Move, + kCursor_VerticalText, + kCursor_Cell, + kCursor_ContextMenu, + kCursor_Alias, + kCursor_Progress, + kCursor_NoDrop, + kCursor_Copy, + kCursor_None, + kCursor_NotAllowed, + kCursor_ZoomIn, + kCursor_ZoomOut, + kCursor_Grab, + kCursor_Grabbing, + kCursor_Custom +} ULCursor; + +typedef enum { + /// + /// Alpha channel only, 8-bits per pixel. + /// + /// Encoding: 8-bits per channel, unsigned normalized. + /// + /// Color-space: Linear (no gamma), alpha-coverage only. + /// + kBitmapFormat_A8_UNORM, + + /// + /// Blue Green Red Alpha channels, 32-bits per pixel. + /// + /// Encoding: 8-bits per channel, unsigned normalized. + /// + /// Color-space: sRGB gamma with premultiplied linear alpha channel. + /// + kBitmapFormat_BGRA8_UNORM_SRGB +} ULBitmapFormat; + +typedef enum { + /// + /// Key-Down event type. (Does not trigger accelerator commands in WebCore) + /// + /// @NOTE: You should probably use RawKeyDown instead when a physical key + /// is pressed. This member is only here for historic compatibility + /// with WebCore's key event types. + /// + kKeyEventType_KeyDown, + + /// + /// Key-Up event type. Use this when a physical key is released. + /// + kKeyEventType_KeyUp, + + /// + /// Raw Key-Down type. Use this when a physical key is pressed. + /// + /// @NOTE: You should use RawKeyDown for physical key presses since it + /// allows WebCore to do additional command translation. + /// + kKeyEventType_RawKeyDown, + + /// + /// Character input event type. Use this when the OS generates text from + /// a physical key being pressed (eg, WM_CHAR on Windows). + /// + kKeyEventType_Char, +} ULKeyEventType; + +typedef enum { + kMouseEventType_MouseMoved, + kMouseEventType_MouseDown, + kMouseEventType_MouseUp, +} ULMouseEventType; + +typedef enum { + kMouseButton_None = 0, + kMouseButton_Left, + kMouseButton_Middle, + kMouseButton_Right, +} ULMouseButton; + +typedef enum { + kScrollEventType_ScrollByPixel, + kScrollEventType_ScrollByPage, +} ULScrollEventType; + +typedef enum { + kFaceWinding_Clockwise, + kFaceWindow_CounterClockwise, +} ULFaceWinding; + +typedef enum { + /// + /// Lighter hinting algorithm-- glyphs are slightly fuzzier but better + /// resemble their original shape. This is achieved by snapping glyphs to the + /// pixel grid only vertically which better preserves inter-glyph spacing. + /// + kFontHinting_Smooth, + + /// + /// Default hinting algorithm-- offers a good balance between sharpness and + /// shape at smaller font sizes. + /// + kFontHinting_Normal, + + /// + /// Strongest hinting algorithm-- outputs only black/white glyphs. The result + /// is usually unpleasant if the underlying TTF does not contain hints for + /// this type of rendering. + /// + kFontHinting_Monochrome, +} ULFontHinting; + +typedef struct { + float left; + float top; + float right; + float bottom; +} ULRect; + +typedef struct { + int left; + int top; + int right; + int bottom; +} ULIntRect; + +typedef struct { + bool is_empty; + unsigned int width; + unsigned int height; + unsigned int texture_id; + unsigned int texture_width; + unsigned int texture_height; + ULBitmapFormat texture_format; + ULRect uv_coords; + unsigned int render_buffer_id; +} ULRenderTarget; + + +/****************************************************************************** + * API Note: + * + * You should only destroy objects that you explicitly create. Do not destroy + * any objects returned from the API or callbacks unless otherwise noted. + *****************************************************************************/ + +/****************************************************************************** + * Version + *****************************************************************************/ + +/// +/// Get the version string of the library in MAJOR.MINOR.PATCH format. +/// +ULExport const char* ulVersionString(); + +/// +/// Get the numeric major version of the library. +/// +ULExport unsigned int ulVersionMajor(); + +/// +/// Get the numeric minor version of the library. +/// +ULExport unsigned int ulVersionMinor(); + +/// +/// Get the numeric patch version of the library. +/// +ULExport unsigned int ulVersionPatch(); + +/****************************************************************************** + * Config + *****************************************************************************/ + +/// +/// Create config with default values (see ). +/// +ULExport ULConfig ulCreateConfig(); + +/// +/// Destroy config. +/// +ULExport void ulDestroyConfig(ULConfig config); + +/// +/// Set the file path to the directory that contains Ultralight's bundled +/// resources (eg, cacert.pem and other localized resources). +/// +ULExport void ulConfigSetResourcePath(ULConfig config, ULString resource_path); + +/// +/// Set the file path to a writable directory that will be used to store +/// cookies, cached resources, and other persistent data. +/// +ULExport void ulConfigSetCachePath(ULConfig config, ULString cache_path); + +/// +/// When enabled, each View will be rendered to an offscreen GPU texture +/// using the GPU driver set in ulPlatformSetGPUDriver. You can fetch +/// details for the texture via ulViewGetRenderTarget. +/// +/// When disabled (the default), each View will be rendered to an offscreen +/// pixel buffer. This pixel buffer can optionally be provided by the user-- +/// for more info see ulViewGetSurface. +/// +ULExport void ulConfigSetUseGPURenderer(ULConfig config, bool use_gpu); + +/// +/// Set the amount that the application DPI has been scaled, used for +/// scaling device coordinates to pixels and oversampling raster shapes +/// (Default = 1.0). +/// +ULExport void ulConfigSetDeviceScale(ULConfig config, double value); + +/// +/// The winding order for front-facing triangles. @see FaceWinding +/// +/// Note: This is only used with custom GPUDrivers +/// +ULExport void ulConfigSetFaceWinding(ULConfig config, ULFaceWinding winding); + +/// +/// Set whether images should be enabled (Default = True). +/// +ULExport void ulConfigSetEnableImages(ULConfig config, bool enabled); + +/// +/// Set whether JavaScript should be eanbled (Default = True). +/// +ULExport void ulConfigSetEnableJavaScript(ULConfig config, bool enabled); + +/// +/// The hinting algorithm to use when rendering fonts. (Default = kFontHinting_Normal) +/// @see ULFontHinting +/// +ULExport void ulConfigSetFontHinting(ULConfig config, ULFontHinting font_hinting); + +/// +/// The gamma to use when compositing font glyphs, change this value to +/// adjust contrast (Adobe and Apple prefer 1.8, others may prefer 2.2). +/// (Default = 1.8) +/// +ULExport void ulConfigSetFontGamma(ULConfig config, double font_gamma); + +/// +/// Set default font-family to use (Default = Times New Roman). +/// +ULExport void ulConfigSetFontFamilyStandard(ULConfig config, + ULString font_name); + +/// +/// Set default font-family to use for fixed fonts, eg

 and 
+/// (Default = Courier New).
+///
+ULExport void ulConfigSetFontFamilyFixed(ULConfig config, ULString font_name);
+
+///
+/// Set default font-family to use for serif fonts (Default = Times New Roman).
+///
+ULExport void ulConfigSetFontFamilySerif(ULConfig config, ULString font_name);
+
+///
+/// Set default font-family to use for sans-serif fonts (Default = Arial).
+///
+ULExport void ulConfigSetFontFamilySansSerif(ULConfig config,
+                                             ULString font_name);
+
+///
+/// Set user agent string (See  for the default).
+///
+ULExport void ulConfigSetUserAgent(ULConfig config, ULString agent_string);
+
+///
+/// Set user stylesheet (CSS) (Default = Empty).
+///
+ULExport void ulConfigSetUserStylesheet(ULConfig config, ULString css_string);
+
+///
+/// Set whether or not we should continuously repaint any Views or compositor
+/// layers, regardless if they are dirty or not. This is mainly used to
+/// diagnose painting/shader issues. (Default = False)
+///
+ULExport void ulConfigSetForceRepaint(ULConfig config, bool enabled);
+
+///
+/// Set the amount of time to wait before triggering another repaint when a
+/// CSS animation is active. (Default = 1.0 / 60.0)
+///
+ULExport void ulConfigSetAnimationTimerDelay(ULConfig config, double delay);
+
+///
+/// When a smooth scroll animation is active, the amount of time (in seconds)
+/// to wait before triggering another repaint. Default is 60 Hz.
+///
+ULExport void ulConfigSetScrollTimerDelay(ULConfig config, double delay);
+
+///
+/// The amount of time (in seconds) to wait before running the recycler (will
+/// attempt to return excess memory back to the system). (Default = 4.0)
+///
+ULExport void ulConfigSetRecycleDelay(ULConfig config, double delay);
+
+///
+/// Set the size of WebCore's memory cache for decoded images, scripts, and
+/// other assets in bytes. (Default = 64 * 1024 * 1024)
+///
+ULExport void ulConfigSetMemoryCacheSize(ULConfig config, unsigned int size);
+
+///
+/// Set the number of pages to keep in the cache. (Default = 0)
+///
+ULExport void ulConfigSetPageCacheSize(ULConfig config, unsigned int size);
+
+///
+/// JavaScriptCore tries to detect the system's physical RAM size to set
+/// reasonable allocation limits. Set this to anything other than 0 to
+/// override the detected value. Size is in bytes.
+///
+/// This can be used to force JavaScriptCore to be more conservative with
+/// its allocation strategy (at the cost of some performance).
+///
+ULExport void ulConfigSetOverrideRAMSize(ULConfig config, unsigned int size);
+
+///
+/// The minimum size of large VM heaps in JavaScriptCore. Set this to a
+/// lower value to make these heaps start with a smaller initial value.
+///
+ULExport void ulConfigSetMinLargeHeapSize(ULConfig config, unsigned int size);
+
+///
+/// The minimum size of small VM heaps in JavaScriptCore. Set this to a
+/// lower value to make these heaps start with a smaller initial value.
+///
+ULExport void ulConfigSetMinSmallHeapSize(ULConfig config, unsigned int size);
+
+/******************************************************************************
+ * Renderer
+ *****************************************************************************/
+
+///
+/// Create the Ultralight Renderer directly.
+///
+/// Unlike ulCreateApp(), this does not use any native windows for drawing
+/// and allows you to manage your own runloop and painting. This method is
+/// recommended for those wishing to integrate the library into a game.
+///
+/// This singleton manages the lifetime of all Views and coordinates all
+/// painting, rendering, network requests, and event dispatch.
+///
+/// You should only call this once per process lifetime.
+///
+/// You shoud set up your platform handlers (eg, ulPlatformSetLogger,
+/// ulPlatformSetFileSystem, etc.) before calling this.
+///
+/// You will also need to define a font loader before calling this-- 
+/// as of this writing (v1.2) the only way to do this in C API is by calling
+/// ulEnablePlatformFontLoader() (available in ).
+///
+/// @NOTE:  You should not call this if you are using ulCreateApp(), it
+///         creates its own renderer and provides default implementations for
+///         various platform handlers automatically.
+///
+ULExport ULRenderer ulCreateRenderer(ULConfig config);
+
+///
+/// Destroy the renderer.
+///
+ULExport void ulDestroyRenderer(ULRenderer renderer);
+
+///
+/// Update timers and dispatch internal callbacks (JavaScript and network).
+///
+ULExport void ulUpdate(ULRenderer renderer);
+
+///
+/// Render all active Views.
+///
+ULExport void ulRender(ULRenderer renderer);
+
+///
+/// Attempt to release as much memory as possible. Don't call this from any
+/// callbacks or driver code.
+///
+ULExport void ulPurgeMemory(ULRenderer renderer);
+
+///
+/// Print detailed memory usage statistics to the log.
+/// (@see ulPlatformSetLogger)
+///
+ULExport void ulLogMemoryUsage(ULRenderer renderer);
+
+/******************************************************************************
+ * Session
+ *****************************************************************************/
+
+///
+/// Create a Session to store local data in (such as cookies, local storage,
+/// application cache, indexed db, etc).
+///
+ULExport ULSession ulCreateSession(ULRenderer renderer, bool is_persistent,
+                                   ULString name);
+
+///
+/// Destroy a Session.
+///
+ULExport void ulDestroySession(ULSession session);
+
+///
+/// Get the default session (persistent session named "default").
+///
+/// @note  This session is owned by the Renderer, you shouldn't destroy it.
+///
+ULExport ULSession ulDefaultSession(ULRenderer renderer);
+
+///
+/// Whether or not is persistent (backed to disk).
+///
+ULExport bool ulSessionIsPersistent(ULSession session);
+
+///
+/// Unique name identifying the session (used for unique disk path).
+///
+ULExport ULString ulSessionGetName(ULSession session);
+
+///
+/// Unique numeric Id for the session.
+///
+ULExport unsigned long long ulSessionGetId(ULSession session);
+
+///
+/// The disk path to write to (used by persistent sessions only).
+///
+ULExport ULString ulSessionGetDiskPath(ULSession session);
+
+/******************************************************************************
+ * View
+ *****************************************************************************/
+
+///
+/// Create a View with certain size (in pixels).
+///
+/// @note  You can pass null to 'session' to use the default session.
+///
+ULExport ULView ulCreateView(ULRenderer renderer, unsigned int width,
+                             unsigned int height, bool transparent,
+                             ULSession session, bool force_cpu_renderer);
+
+///
+/// Destroy a View.
+///
+ULExport void ulDestroyView(ULView view);
+
+///
+/// Get current URL.
+///
+/// @note Don't destroy the returned string, it is owned by the View.
+///
+ULExport ULString ulViewGetURL(ULView view);
+
+///
+/// Get current title.
+///
+/// @note Don't destroy the returned string, it is owned by the View.
+///
+ULExport ULString ulViewGetTitle(ULView view);
+
+///
+/// Get the width, in pixels.
+///
+ULExport unsigned int ulViewGetWidth(ULView view);
+
+///
+/// Get the height, in pixels.
+///
+ULExport unsigned int ulViewGetHeight(ULView view);
+
+///
+/// Check if main frame is loading.
+///
+ULExport bool ulViewIsLoading(ULView view);
+
+///
+/// Get the RenderTarget for the View.
+///
+/// @note  Only valid when the GPU renderer is enabled in Config.
+///
+ULExport ULRenderTarget ulViewGetRenderTarget(ULView view);
+
+///
+/// Get the Surface for the View (native pixel buffer container).
+///
+/// @note  Only valid when the GPU renderer is disabled in Config.
+///
+///        (Will return a nullptr when the GPU renderer is enabled.)
+///
+///        The default Surface is BitmapSurface but you can provide your
+///        own Surface implementation via ulPlatformSetSurfaceDefinition.
+///
+///        When using the default Surface, you can retrieve the underlying
+///        bitmap by casting ULSurface to ULBitmapSurface and calling
+///        ulBitmapSurfaceGetBitmap().
+///
+ULExport ULSurface ulViewGetSurface(ULView view);
+
+///
+/// Load a raw string of HTML.
+///
+ULExport void ulViewLoadHTML(ULView view, ULString html_string);
+
+///
+/// Load a URL into main frame.
+///
+ULExport void ulViewLoadURL(ULView view, ULString url_string);
+
+///
+/// Resize view to a certain width and height (in pixels).
+///
+ULExport void ulViewResize(ULView view, unsigned int width,
+                           unsigned int height);
+
+///
+/// Acquire the page's JSContext for use with JavaScriptCore API.
+/// 
+/// @note  This call locks the context for the current thread. You should
+///        call ulViewUnlockJSContext() after using the context so other
+///        worker threads can modify JavaScript state.
+///
+/// @note  The lock is recusive, it's okay to call this multiple times as long
+///        as you call ulViewUnlockJSContext() the same number of times.
+///
+ULExport JSContextRef ulViewLockJSContext(ULView view);
+
+///
+/// Unlock the page's JSContext after a previous call to ulViewLockJSContext().
+///
+ULExport void ulViewUnlockJSContext(ULView view);
+
+///
+/// Evaluate a string of JavaScript and return result.
+///
+/// @param  js_string  The string of JavaScript to evaluate.
+///
+/// @param  exception  The address of a ULString to store a description of the
+///                    last exception. Pass NULL to ignore this. Don't destroy
+///                    the exception string returned, it's owned by the View.
+///
+/// @note Don't destroy the returned string, it's owned by the View. This value
+///       is reset with every call-- if you want to retain it you should copy
+///       the result to a new string via ulCreateStringFromCopy().
+///
+/// @note An example of using this API:
+///       
+///         ULString script = ulCreateString("1 + 1");
+///         ULString exception;
+///         ULString result = ulViewEvaluateScript(view, script, &exception);
+///         /* Use the result ("2") and exception description (if any) here. */
+///         ulDestroyString(script);
+///       
+/// +ULExport ULString ulViewEvaluateScript(ULView view, ULString js_string, ULString* exception); + +/// +/// Check if can navigate backwards in history. +/// +ULExport bool ulViewCanGoBack(ULView view); + +/// +/// Check if can navigate forwards in history. +/// +ULExport bool ulViewCanGoForward(ULView view); + +/// +/// Navigate backwards in history. +/// +ULExport void ulViewGoBack(ULView view); + +/// +/// Navigate forwards in history. +/// +ULExport void ulViewGoForward(ULView view); + +/// +/// Navigate to arbitrary offset in history. +/// +ULExport void ulViewGoToHistoryOffset(ULView view, int offset); + +/// +/// Reload current page. +/// +ULExport void ulViewReload(ULView view); + +/// +/// Stop all page loads. +/// +ULExport void ulViewStop(ULView view); + +/// +/// Give focus to the View. +/// +/// You should call this to give visual indication that the View has input +/// focus (changes active text selection colors, for example). +/// +ULExport void ulViewFocus(ULView view); + +/// +/// Remove focus from the View and unfocus any focused input elements. +/// +/// You should call this to give visual indication that the View has lost +/// input focus. +/// +ULExport void ulViewUnfocus(ULView view); + +/// +/// Whether or not the View has focus. +/// +ULExport bool ulViewHasFocus(ULView view); + +/// +/// Whether or not the View has an input element with visible keyboard focus +/// (indicated by a blinking caret). +/// +/// You can use this to decide whether or not the View should consume +/// keyboard input events (useful in games with mixed UI and key handling). +/// +ULExport bool ulViewHasInputFocus(ULView view); + +/// +/// Fire a keyboard event. +/// +ULExport void ulViewFireKeyEvent(ULView view, ULKeyEvent key_event); + +/// +/// Fire a mouse event. +/// +ULExport void ulViewFireMouseEvent(ULView view, ULMouseEvent mouse_event); + +/// +/// Fire a scroll event. +/// +ULExport void ulViewFireScrollEvent(ULView view, ULScrollEvent scroll_event); + +typedef void +(*ULChangeTitleCallback) (void* user_data, ULView caller, ULString title); + +/// +/// Set callback for when the page title changes. +/// +ULExport void ulViewSetChangeTitleCallback(ULView view, + ULChangeTitleCallback callback, + void* user_data); + +typedef void +(*ULChangeURLCallback) (void* user_data, ULView caller, ULString url); + +/// +/// Set callback for when the page URL changes. +/// +ULExport void ulViewSetChangeURLCallback(ULView view, + ULChangeURLCallback callback, + void* user_data); + +typedef void +(*ULChangeTooltipCallback) (void* user_data, ULView caller, ULString tooltip); + +/// +/// Set callback for when the tooltip changes (usually result of a mouse hover). +/// +ULExport void ulViewSetChangeTooltipCallback(ULView view, + ULChangeTooltipCallback callback, + void* user_data); + +typedef void +(*ULChangeCursorCallback) (void* user_data, ULView caller, ULCursor cursor); + +/// +/// Set callback for when the mouse cursor changes. +/// +ULExport void ulViewSetChangeCursorCallback(ULView view, + ULChangeCursorCallback callback, + void* user_data); + +typedef void +(*ULAddConsoleMessageCallback) (void* user_data, ULView caller, + ULMessageSource source, ULMessageLevel level, + ULString message, unsigned int line_number, + unsigned int column_number, + ULString source_id); + +/// +/// Set callback for when a message is added to the console (useful for +/// JavaScript / network errors and debugging). +/// +ULExport void ulViewSetAddConsoleMessageCallback(ULView view, + ULAddConsoleMessageCallback callback, + void* user_data); + +typedef ULView +(*ULCreateChildViewCallback) (void* user_data, ULView caller, + ULString opener_url, ULString target_url, bool is_popup, + ULIntRect popup_rect); + +/// +/// Set callback for when the page wants to create a new View. +/// +/// This is usually the result of a user clicking a link with target="_blank" +/// or by JavaScript calling window.open(url). +/// +/// To allow creation of these new Views, you should create a new View in +/// this callback, resize it to your container, +/// and return it. You are responsible for displaying the returned View. +/// +/// You should return NULL if you want to block the action. +/// +ULExport void ulViewSetCreateChildViewCallback(ULView view, + ULCreateChildViewCallback callback, + void* user_data); + +typedef void +(*ULBeginLoadingCallback) (void* user_data, ULView caller, + unsigned long long frame_id, bool is_main_frame, ULString url); + +/// +/// Set callback for when the page begins loading a new URL into a frame. +/// +ULExport void ulViewSetBeginLoadingCallback(ULView view, + ULBeginLoadingCallback callback, + void* user_data); + +typedef void +(*ULFinishLoadingCallback) (void* user_data, ULView caller, + unsigned long long frame_id, bool is_main_frame, ULString url); + +/// +/// Set callback for when the page finishes loading a URL into a frame. +/// +ULExport void ulViewSetFinishLoadingCallback(ULView view, + ULFinishLoadingCallback callback, + void* user_data); + +typedef void +(*ULFailLoadingCallback) (void* user_data, ULView caller, + unsigned long long frame_id, bool is_main_frame, ULString url, + ULString description, ULString error_domain, int error_code); + +/// +/// Set callback for when an error occurs while loading a URL into a frame. +/// +ULExport void ulViewSetFailLoadingCallback(ULView view, + ULFailLoadingCallback callback, + void* user_data); + +typedef void +(*ULWindowObjectReadyCallback) (void* user_data, ULView caller, + unsigned long long frame_id, bool is_main_frame, ULString url); + +/// +/// Set callback for when the JavaScript window object is reset for a new +/// page load. +/// +/// This is called before any scripts are executed on the page and is the +/// earliest time to setup any initial JavaScript state or bindings. +/// +/// The document is not guaranteed to be loaded/parsed at this point. If +/// you need to make any JavaScript calls that are dependent on DOM elements +/// or scripts on the page, use DOMReady instead. +/// +/// The window object is lazily initialized (this will not be called on pages +/// with no scripts). +/// +ULExport void ulViewSetWindowObjectReadyCallback(ULView view, + ULWindowObjectReadyCallback callback, + void* user_data); + +typedef void +(*ULDOMReadyCallback) (void* user_data, ULView caller, + unsigned long long frame_id, bool is_main_frame, ULString url); + +/// +/// Set callback for when all JavaScript has been parsed and the document is +/// ready. +/// +/// This is the best time to make any JavaScript calls that are dependent on +/// DOM elements or scripts on the page. +/// +ULExport void ulViewSetDOMReadyCallback(ULView view, + ULDOMReadyCallback callback, + void* user_data); + +typedef void +(*ULUpdateHistoryCallback) (void* user_data, ULView caller); + +/// +/// Set callback for when the history (back/forward state) is modified. +/// +ULExport void ulViewSetUpdateHistoryCallback(ULView view, + ULUpdateHistoryCallback callback, + void* user_data); + +/// +/// Set whether or not a view should be repainted during the next call to +/// ulRender. +/// +/// @note This flag is automatically set whenever the page content changes +/// but you can set it directly in case you need to force a repaint. +/// +ULExport void ulViewSetNeedsPaint(ULView view, bool needs_paint); + +/// +/// Whether or not a view should be painted during the next call to ulRender. +/// +ULExport bool ulViewGetNeedsPaint(ULView view); + +/// +/// Create an inspector for this View, this is useful for debugging and +/// inspecting pages locally. This will only succeed if you have the +/// inspector assets in your filesystem-- the inspector will look for +/// file:///inspector/Main.html when it loads. +/// +/// @note The initial dimensions of the returned View are 10x10, you should +/// call ulViewResize on the returned View to resize it to your desired +/// dimensions. +/// +/// @note You will need to call ulDestroyView on the returned instance +/// when you're done using it. +/// +ULExport ULView ulViewCreateInspectorView(ULView view); + +/****************************************************************************** + * String + *****************************************************************************/ + +/// +/// Create string from null-terminated ASCII C-string. +/// +ULExport ULString ulCreateString(const char* str); + +/// +/// Create string from UTF-8 buffer. +/// +ULExport ULString ulCreateStringUTF8(const char* str, size_t len); + +/// +/// Create string from UTF-16 buffer. +/// +ULExport ULString ulCreateStringUTF16(ULChar16* str, size_t len); + +/// +/// Create string from copy of existing string. +/// +ULExport ULString ulCreateStringFromCopy(ULString str); + +/// +/// Destroy string (you should destroy any strings you explicitly Create). +/// +ULExport void ulDestroyString(ULString str); + +/// +/// Get internal UTF-16 buffer data. +/// +ULExport ULChar16* ulStringGetData(ULString str); + +/// +/// Get length in UTF-16 characters. +/// +ULExport size_t ulStringGetLength(ULString str); + +/// +/// Whether this string is empty or not. +/// +ULExport bool ulStringIsEmpty(ULString str); + +/// +/// Replaces the contents of 'str' with the contents of 'new_str' +/// +ULExport void ulStringAssignString(ULString str, ULString new_str); + +/// +/// Replaces the contents of 'str' with the contents of a C-string. +/// +ULExport void ulStringAssignCString(ULString str, const char* c_str); + +/****************************************************************************** + * Bitmap + *****************************************************************************/ + +/// +/// Create empty bitmap. +/// +ULExport ULBitmap ulCreateEmptyBitmap(); + +/// +/// Create bitmap with certain dimensions and pixel format. +/// +ULExport ULBitmap ulCreateBitmap(unsigned int width, unsigned int height, + ULBitmapFormat format); + +/// +/// Create bitmap from existing pixel buffer. @see Bitmap for help using +/// this function. +/// +ULExport ULBitmap ulCreateBitmapFromPixels(unsigned int width, + unsigned int height, + ULBitmapFormat format, + unsigned int row_bytes, + const void* pixels, size_t size, + bool should_copy); + +/// +/// Create bitmap from copy. +/// +ULExport ULBitmap ulCreateBitmapFromCopy(ULBitmap existing_bitmap); + +/// +/// Destroy a bitmap (you should only destroy Bitmaps you have explicitly +/// created via one of the creation functions above. +/// +ULExport void ulDestroyBitmap(ULBitmap bitmap); + +/// +/// Get the width in pixels. +/// +ULExport unsigned int ulBitmapGetWidth(ULBitmap bitmap); + +/// +/// Get the height in pixels. +/// +ULExport unsigned int ulBitmapGetHeight(ULBitmap bitmap); + +/// +/// Get the pixel format. +/// +ULExport ULBitmapFormat ulBitmapGetFormat(ULBitmap bitmap); + +/// +/// Get the bytes per pixel. +/// +ULExport unsigned int ulBitmapGetBpp(ULBitmap bitmap); + +/// +/// Get the number of bytes per row. +/// +ULExport unsigned int ulBitmapGetRowBytes(ULBitmap bitmap); + +/// +/// Get the size in bytes of the underlying pixel buffer. +/// +ULExport size_t ulBitmapGetSize(ULBitmap bitmap); + +/// +/// Whether or not this bitmap owns its own pixel buffer. +/// +ULExport bool ulBitmapOwnsPixels(ULBitmap bitmap); + +/// +/// Lock pixels for reading/writing, returns pointer to pixel buffer. +/// +ULExport void* ulBitmapLockPixels(ULBitmap bitmap); + +/// +/// Unlock pixels after locking. +/// +ULExport void ulBitmapUnlockPixels(ULBitmap bitmap); + +/// +/// Get raw pixel buffer-- you should only call this if Bitmap is already +/// locked. +/// +ULExport void* ulBitmapRawPixels(ULBitmap bitmap); + +/// +/// Whether or not this bitmap is empty. +/// +ULExport bool ulBitmapIsEmpty(ULBitmap bitmap); + +/// +/// Reset bitmap pixels to 0. +/// +ULExport void ulBitmapErase(ULBitmap bitmap); + +/// +/// Write bitmap to a PNG on disk. +/// +ULExport bool ulBitmapWritePNG(ULBitmap bitmap, const char* path); + +/// +/// This converts a BGRA bitmap to RGBA bitmap and vice-versa by swapping +/// the red and blue channels. +/// +ULExport void ulBitmapSwapRedBlueChannels(ULBitmap bitmap); + +/****************************************************************************** +* Key Event +******************************************************************************/ + +/// +/// Create a key event, @see KeyEvent for help with the following parameters. +/// +ULExport ULKeyEvent ulCreateKeyEvent(ULKeyEventType type, + unsigned int modifiers, + int virtual_key_code, int native_key_code, + ULString text, ULString unmodified_text, + bool is_keypad, bool is_auto_repeat, + bool is_system_key); + +#ifdef _WIN32 +/// +/// Create a key event from native Windows event. +/// +ULExport ULKeyEvent ulCreateKeyEventWindows(ULKeyEventType type, + uintptr_t wparam, intptr_t lparam, + bool is_system_key); +#endif + +#ifdef __OBJC__ +/// +/// Create a key event from native macOS event. +/// +ULExport ULKeyEvent ulCreateKeyEventMacOS(NSEvent* evt); +#endif + +/// +/// Destroy a key event. +/// +ULExport void ulDestroyKeyEvent(ULKeyEvent evt); + +/****************************************************************************** + * Mouse Event + *****************************************************************************/ + +/// +/// Create a mouse event, @see MouseEvent for help using this function. +/// +ULExport ULMouseEvent ulCreateMouseEvent(ULMouseEventType type, int x, int y, + ULMouseButton button); + +/// +/// Destroy a mouse event. +/// +ULExport void ulDestroyMouseEvent(ULMouseEvent evt); + +/****************************************************************************** + * Scroll Event + *****************************************************************************/ + +/// +/// Create a scroll event, @see ScrollEvent for help using this function. +/// +ULExport ULScrollEvent ulCreateScrollEvent(ULScrollEventType type, int delta_x, + int delta_y); + +/// +/// Destroy a scroll event. +/// +ULExport void ulDestroyScrollEvent(ULScrollEvent evt); + +/****************************************************************************** + * Rect + *****************************************************************************/ + +/// +/// Whether or not a ULRect is empty (all members equal to 0) +/// +ULExport bool ulRectIsEmpty(ULRect rect); + +/// +/// Create an empty ULRect (all members equal to 0) +/// +ULExport ULRect ulRectMakeEmpty(); + +/****************************************************************************** + * IntRect + *****************************************************************************/ + + /// + /// Whether or not a ULIntRect is empty (all members equal to 0) + /// +ULExport bool ulIntRectIsEmpty(ULIntRect rect); + +/// +/// Create an empty ULIntRect (all members equal to 0) +/// +ULExport ULIntRect ulIntRectMakeEmpty(); + +/****************************************************************************** + * Surface + *****************************************************************************/ + +/// +/// Width (in pixels). +/// +ULExport unsigned int ulSurfaceGetWidth(ULSurface surface); + +/// +/// Height (in pixels). +/// +ULExport unsigned int ulSurfaceGetHeight(ULSurface surface); + +/// +/// Number of bytes between rows (usually width * 4) +/// +ULExport unsigned int ulSurfaceGetRowBytes(ULSurface surface); + +/// +/// Size in bytes. +/// +ULExport size_t ulSurfaceGetSize(ULSurface surface); + +/// +/// Lock the pixel buffer and get a pointer to the beginning of the data +/// for reading/writing. +/// +/// Native pixel format is premultiplied BGRA 32-bit (8 bits per channel). +/// +ULExport void* ulSurfaceLockPixels(ULSurface surface); + +/// +/// Unlock the pixel buffer. +/// +ULExport void ulSurfaceUnlockPixels(ULSurface surface); + +/// +/// Resize the pixel buffer to a certain width and height (both in pixels). +/// +/// This should never be called while pixels are locked. +/// +ULExport void ulSurfaceResize(ULSurface surface, unsigned int width, unsigned int height); + +/// +/// Set the dirty bounds to a certain value. +/// +/// This is called after the Renderer paints to an area of the pixel buffer. +/// (The new value will be joined with the existing dirty_bounds()) +/// +ULExport void ulSurfaceSetDirtyBounds(ULSurface surface, ULIntRect bounds); + +/// +/// Get the dirty bounds. +/// +/// This value can be used to determine which portion of the pixel buffer has +/// been updated since the last call to ulSurfaceClearDirtyBounds(). +/// +/// The general algorithm to determine if a Surface needs display is: +///
+///   if (!ulIntRectIsEmpty(ulSurfaceGetDirtyBounds(surface))) {
+///       // Surface pixels are dirty and needs display.
+///       // Cast Surface to native Surface and use it here (pseudo code)
+///       DisplaySurface(surface);
+///
+///       // Once you're done, clear the dirty bounds:
+///       ulSurfaceClearDirtyBounds(surface);
+///  }
+///  
+/// +ULExport ULIntRect ulSurfaceGetDirtyBounds(ULSurface surface); + +/// +/// Clear the dirty bounds. +/// +/// You should call this after you're done displaying the Surface. +/// +ULExport void ulSurfaceClearDirtyBounds(ULSurface surface); + +/// +/// Get the underlying user data pointer (this is only valid if you have +/// set a custom surface implementation via ulPlatformSetSurfaceDefinition). +/// +/// This will return nullptr if this surface is the default ULBitmapSurface. +/// +ULExport void* ulSurfaceGetUserData(ULSurface surface); + +/****************************************************************************** + * BitmapSurface + *****************************************************************************/ + +/// +/// Get the underlying Bitmap from the default Surface. +/// +/// @note Do not call ulDestroyBitmap() on the returned value, it is owned +/// by the surface. +/// +ULExport ULBitmap ulBitmapSurfaceGetBitmap(ULBitmapSurface surface); + +/****************************************************************************** + * Surface Definition + *****************************************************************************/ + +/// +/// The callback invoked when a Surface is created. +/// +/// @param width The width in pixels. +/// @param height The height in pixels. +/// +/// @return This callback should return a pointer to user-defined data for the +/// instance. This user data pointer will be passed to all other +/// callbacks when operating on the instance. +/// +typedef void* +(*ULSurfaceDefinitionCreateCallback) (unsigned int width, unsigned int height); + +/// +/// The callback invoked when a Surface is destroyed. +/// +/// @param user_data User data pointer uniquely identifying the surface. +/// +typedef void +(*ULSurfaceDefinitionDestroyCallback) (void* user_data); + +/// +/// The callback invoked when a Surface's width (in pixels) is requested. +/// +/// @param user_data User data pointer uniquely identifying the surface. +/// +typedef unsigned int +(*ULSurfaceDefinitionGetWidthCallback) (void* user_data); + +/// +/// The callback invoked when a Surface's height (in pixels) is requested. +/// +/// @param user_data User data pointer uniquely identifying the surface. +/// +typedef unsigned int +(*ULSurfaceDefinitionGetHeightCallback) (void* user_data); + +/// +/// The callback invoked when a Surface's row bytes is requested. +/// +/// @note This value is also known as "stride". Usually width * 4. +/// +/// @param user_data User data pointer uniquely identifying the surface. +/// +typedef unsigned int +(*ULSurfaceDefinitionGetRowBytesCallback) (void* user_data); + +/// +/// The callback invoked when a Surface's size (in bytes) is requested. +/// +/// @param user_data User data pointer uniquely identifying the surface. +/// +typedef size_t +(*ULSurfaceDefinitionGetSizeCallback) (void* user_data); + +/// +/// The callback invoked when a Surface's pixel buffer is requested to be +/// locked for reading/writing (should return a pointer to locked bytes). +/// +/// @param user_data User data pointer uniquely identifying the surface. +/// +typedef void* +(*ULSurfaceDefinitionLockPixelsCallback) (void* user_data); + +/// +/// The callback invoked when a Surface's pixel buffer is requested to be +/// unlocked after previously being locked. +/// +/// @param user_data User data pointer uniquely identifying the surface. +/// +typedef void +(*ULSurfaceDefinitionUnlockPixelsCallback) (void* user_data); + +/// +/// The callback invoked when a Surface is requested to be resized to a +/// certain width/height. +/// +/// @param user_data User data pointer uniquely identifying the surface. +/// @param width Width in pixels. +/// @param height Height in pixels. +/// +typedef void +(*ULSurfaceDefinitionResizeCallback) (void* user_data, unsigned int width, unsigned int height); + +typedef struct { + ULSurfaceDefinitionCreateCallback create; + ULSurfaceDefinitionDestroyCallback destroy; + ULSurfaceDefinitionGetWidthCallback get_width; + ULSurfaceDefinitionGetHeightCallback get_height; + ULSurfaceDefinitionGetRowBytesCallback get_row_bytes; + ULSurfaceDefinitionGetSizeCallback get_size; + ULSurfaceDefinitionLockPixelsCallback lock_pixels; + ULSurfaceDefinitionUnlockPixelsCallback unlock_pixels; + ULSurfaceDefinitionResizeCallback resize; +} ULSurfaceDefinition; + +/****************************************************************************** + * File System + *****************************************************************************/ + +/// +/// File Handle type used as unique ID for opened files. +/// +#if defined(__WIN32__) || defined(_WIN32) +typedef size_t ULFileHandle; +#else +typedef int ULFileHandle; +#endif + +/// +/// Handle used to denote an invalid file. +/// +const ULFileHandle ULInvalidFileHandle = (ULFileHandle)-1; + +/// +/// The callback invoked when the FileSystem wants to check if a file path +/// exists, return true if it exists. +/// +typedef bool +(*ULFileSystemFileExistsCallback) (ULString path); + +/// +/// The callback invoked when the FileSystem wants to get the file size of a +/// previously opened file, store result in 'result'. Return true on success. +/// +typedef bool +(*ULFileSystemGetFileSizeCallback) (ULFileHandle handle, long long* result); + +/// +/// The callback invoked when the FileSystem wants to get the mime type of a +/// file (eg "text/html"), store result in 'result'. Return true on success. +/// +typedef bool +(*ULFileSystemGetFileMimeTypeCallback) (ULString path, ULString result); + +/// +/// The callback invoked when the FileSystem wants to open a file path for +/// reading or writing. Return file handle on success, or ULInvalidFileHandle +/// on failure. +/// +/// @NOTE: As of this writing (v1.2), this function is only used for reading. +/// +typedef ULFileHandle +(*ULFileSystemOpenFileCallback) (ULString path, bool open_for_writing); + +/// +/// The callback invoked when the FileSystem wants to close a previously-opened +/// file. +/// +typedef void +(*ULFileSystemCloseFileCallback) (ULFileHandle handle); + +/// +/// The callback invoked when the FileSystem wants to read from a +/// currently-opened file, return number of bytes read or -1 on failure. +/// +typedef long long +(*ULFileSystemReadFromFileCallback) (ULFileHandle handle, char* data, long long length); + +typedef struct { + ULFileSystemFileExistsCallback file_exists; + ULFileSystemGetFileSizeCallback get_file_size; + ULFileSystemGetFileMimeTypeCallback get_file_mime_type; + ULFileSystemOpenFileCallback open_file; + ULFileSystemCloseFileCallback close_file; + ULFileSystemReadFromFileCallback read_from_file; +} ULFileSystem; + +/****************************************************************************** + * Logger + *****************************************************************************/ + +typedef enum { + kLogLevel_Error = 0, + kLogLevel_Warning, + kLogLevel_Info +} ULLogLevel; + +/// +/// The callback invoked when the library wants to print a message to the log. +/// +typedef void +(*ULLoggerLogMessageCallback) (ULLogLevel log_level, ULString message); + +typedef struct { + ULLoggerLogMessageCallback log_message; +} ULLogger; + + +/****************************************************************************** + * GPUDriver + *****************************************************************************/ + +/// +/// Render buffer description. +/// +typedef struct { + unsigned int texture_id; // The backing texture for this RenderBuffer + unsigned int width; // The width of the RenderBuffer texture + unsigned int height; // The height of the RenderBuffer texture + bool has_stencil_buffer; // Currently unused, always false. + bool has_depth_buffer; // Currently unsued, always false. +} ULRenderBuffer; + +/// +/// @note This pragma pack(push, 1) command is important! Vertex layouts +/// should not be padded with any bytes. +/// +#pragma pack(push, 1) + +/// +/// Vertex layout for path vertices. +/// +/// (this struct's members aligned on single-byte boundaries) +/// +typedef struct { + float pos[2]; + unsigned char color[4]; + float obj[2]; +} ULVertex_2f_4ub_2f; + +/// +/// Vertex layout for quad vertices. +/// +/// (this struct's members aligned on single-byte boundaries) +/// +typedef struct { + float pos[2]; + unsigned char color[4]; + float tex[2]; + float obj[2]; + float data0[4]; + float data1[4]; + float data2[4]; + float data3[4]; + float data4[4]; + float data5[4]; + float data6[4]; +} ULVertex_2f_4ub_2f_2f_28f; + +/// +/// End single-byte alignment. +/// +#pragma pack(pop) + +/// +/// Vertex formats. +/// +typedef enum { + kVertexBufferFormat_2f_4ub_2f, + kVertexBufferFormat_2f_4ub_2f_2f_28f, +} ULVertexBufferFormat; + +/// +/// Vertex buffer data. +/// +typedef struct { + ULVertexBufferFormat format; + unsigned int size; + unsigned char* data; +} ULVertexBuffer; + +/// +/// Vertex index type. +/// +typedef unsigned int ULIndexType; + +/// +/// Vertex index buffer data. +/// +typedef struct { + unsigned int size; + unsigned char* data; +} ULIndexBuffer; + +/// +/// Shader types, used with ULGPUState::shader_type +/// +/// Each of these correspond to a vertex/pixel shader pair. You can find +/// stock shader code for these in the `shaders` folder of the AppCore repo. +/// +typedef enum { + kShaderType_Fill, // Shader program for quad geometry + kShaderType_FillPath, // Shader program for path geometry +} ULShaderType; + +/// +/// Raw 4x4 matrix as an array of floats +/// +typedef struct { + float data[16]; +} ULMatrix4x4; + +/// +/// 4-component float vector +/// +typedef struct { + float value[4]; +} ULvec4; + +/// +/// GPU State description. +/// +typedef struct { + /// Viewport width in pixels + unsigned int viewport_width; + + /// Viewport height in pixels + unsigned int viewport_height; + + /// Transform matrix-- you should multiply this with the screen-space + /// orthographic projection matrix then pass to the vertex shader. + ULMatrix4x4 transform; + + /// Whether or not we should enable texturing for the current draw command. + bool enable_texturing; + + /// Whether or not we should enable blending for the current draw command. + /// If blending is disabled, any drawn pixels should overwrite existing. + /// Mainly used so we can modify alpha values of the RenderBuffer during + /// scissored clears. + bool enable_blend; + + /// The vertex/pixel shader program pair to use for the current draw command. + /// You should cast this to ShaderType to get the corresponding enum. + unsigned char shader_type; + + /// The render buffer to use for the current draw command. + unsigned int render_buffer_id; + + /// The texture id to bind to slot #1. (Will be 0 if none) + unsigned int texture_1_id; + + /// The texture id to bind to slot #2. (Will be 0 if none) + unsigned int texture_2_id; + + /// The texture id to bind to slot #3. (Will be 0 if none) + unsigned int texture_3_id; + + /// The following four members are passed to the pixel shader via uniforms. + float uniform_scalar[8]; + ULvec4 uniform_vector[8]; + unsigned char clip_size; + ULMatrix4x4 clip[8]; + + /// Whether or not scissor testing should be used for the current draw + /// command. + bool enable_scissor; + + /// The scissor rect to use for scissor testing (units in pixels) + ULIntRect scissor_rect; +} ULGPUState; + +/// +/// Command types, used with ULCommand::command_type +/// +typedef enum { + kCommandType_ClearRenderBuffer, + kCommandType_DrawGeometry, +} ULCommandType; + +/// +/// Command description. +/// +typedef struct { + unsigned char command_type; // The type of command to dispatch. + ULGPUState gpu_state; // GPU state parameters for current command. + + /// The following members are only used with kCommandType_DrawGeometry + unsigned int geometry_id; // The geometry ID to bind + unsigned int indices_count; // The number of indices + unsigned int indices_offset; // The index to start from +} ULCommand; + +/// +/// Command list, @see ULGPUDriverUpdateCommandList +typedef struct { + unsigned int size; + ULCommand* commands; +} ULCommandList; + +/// +/// The callback invoked when the GPUDriver will begin dispatching commands +/// (such as CreateTexture and UpdateCommandList) during the current call to +/// ulRender(). +/// +typedef void +(*ULGPUDriverBeginSynchronizeCallback) (); + +/// +/// The callback invoked when the GPUDriver has finished dispatching commands. +/// during the current call to ulRender(). +/// +typedef void +(*ULGPUDriverEndSynchronizeCallback) (); + +/// +/// The callback invoked when the GPUDriver wants to get the next available +/// texture ID. +/// +typedef unsigned int +(*ULGPUDriverNextTextureIdCallback) (); + +/// +/// The callback invoked when the GPUDriver wants to create a texture with a +/// certain ID and optional bitmap. +/// +/// **NOTE**: If the Bitmap is empty (ulBitmapIsEmpty), then a RTT Texture +/// should be created instead. This will be used as a backing +/// texture for a new RenderBuffer. +/// +typedef void +(*ULGPUDriverCreateTextureCallback) (unsigned int texture_id, + ULBitmap bitmap); + +/// +/// The callback invoked when the GPUDriver wants to update an existing non-RTT +/// texture with new bitmap data. +/// +typedef void +(*ULGPUDriverUpdateTextureCallback) (unsigned int texture_id, + ULBitmap bitmap); + +/// +/// The callback invoked when the GPUDriver wants to destroy a texture. +/// +typedef void +(*ULGPUDriverDestroyTextureCallback) (unsigned int texture_id); + +/// +/// The callback invoked when the GPUDriver wants to generate the next +/// available render buffer ID. +/// +typedef unsigned int +(*ULGPUDriverNextRenderBufferIdCallback) (); + +/// +/// The callback invoked when the GPUDriver wants to create a render buffer +/// with certain ID and buffer description. +/// +typedef void +(*ULGPUDriverCreateRenderBufferCallback) (unsigned int render_buffer_id, + ULRenderBuffer buffer); + +/// +/// The callback invoked when the GPUDriver wants to destroy a render buffer +/// +typedef void +(*ULGPUDriverDestroyRenderBufferCallback) (unsigned int render_buffer_id); + +/// +/// The callback invoked when the GPUDriver wants to generate the next +/// available geometry ID. +/// +typedef unsigned int +(*ULGPUDriverNextGeometryIdCallback) (); + +/// +/// The callback invoked when the GPUDriver wants to create geometry with +/// certain ID and vertex/index data. +/// +typedef void +(*ULGPUDriverCreateGeometryCallback) (unsigned int geometry_id, + ULVertexBuffer vertices, + ULIndexBuffer indices); + +/// +/// The callback invoked when the GPUDriver wants to update existing geometry +/// with new vertex/index data. +/// +typedef void +(*ULGPUDriverUpdateGeometryCallback) (unsigned int geometry_id, + ULVertexBuffer vertices, + ULIndexBuffer indices); + +/// +/// The callback invoked when the GPUDriver wants to destroy geometry. +/// +typedef void +(*ULGPUDriverDestroyGeometryCallback) (unsigned int geometry_id); + +/// +/// The callback invoked when the GPUDriver wants to update the command list +/// (you should copy the commands to your own structure). +/// +typedef void +(*ULGPUDriverUpdateCommandListCallback) (ULCommandList list); + +typedef struct { + ULGPUDriverBeginSynchronizeCallback begin_synchronize; + ULGPUDriverEndSynchronizeCallback end_synchronize; + ULGPUDriverNextTextureIdCallback next_texture_id; + ULGPUDriverCreateTextureCallback create_texture; + ULGPUDriverUpdateTextureCallback update_texture; + ULGPUDriverDestroyTextureCallback destroy_texture; + ULGPUDriverNextRenderBufferIdCallback next_render_buffer_id; + ULGPUDriverCreateRenderBufferCallback create_render_buffer; + ULGPUDriverDestroyRenderBufferCallback destroy_render_buffer; + ULGPUDriverNextGeometryIdCallback next_geometry_id; + ULGPUDriverCreateGeometryCallback create_geometry; + ULGPUDriverUpdateGeometryCallback update_geometry; + ULGPUDriverDestroyGeometryCallback destroy_geometry; + ULGPUDriverUpdateCommandListCallback update_command_list; +} ULGPUDriver; + +/// +/// Sets up an orthographic projection matrix with a certain viewport width +/// and height, multiplies it by 'transform', and returns the result. +/// +/// This should be used to calculate the model-view projection matrix for the +/// vertex shaders using the current ULGPUState. +/// +/// The 'flip_y' can be optionally used to flip the Y coordinate-space. +/// (Usually flip_y == true for OpenGL) +/// +ULExport ULMatrix4x4 ulApplyProjection(ULMatrix4x4 transform, + float viewport_width, + float viewport_height, + bool flip_y); + +/****************************************************************************** + * Clipboard + *****************************************************************************/ + +/// +/// The callback invoked when the library wants to clear the system's +/// clipboard. +/// +typedef void +(*ULClipboardClearCallback) (); + +/// +/// The callback invoked when the library wants to read from the system's +/// clipboard. +/// +/// You should store the result (if any) in 'result'. +/// +typedef void +(*ULClipboardReadPlainTextCallback) (ULString result); + +/// +/// The callback invoked when the library wants to write to the system's +/// clipboard. +/// +typedef void +(*ULClipboardWritePlainTextCallback) (ULString text); + +typedef struct { + ULClipboardClearCallback clear; + ULClipboardReadPlainTextCallback read_plain_text; + ULClipboardWritePlainTextCallback write_plain_text; +} ULClipboard; + +/****************************************************************************** + * Platform + *****************************************************************************/ + +/// +/// Set a custom Logger implementation. +/// +/// This is used to log debug messages to the console or to a log file. +/// +/// You should call this before ulCreateRenderer() or ulCreateApp(). +/// +/// @note ulCreateApp() will use the default logger if you never call this. +/// +/// @note If you're not using ulCreateApp(), (eg, using ulCreateRenderer()) +/// you can still use the default logger by calling +/// ulEnableDefaultLogger() (@see ) +/// +ULExport void ulPlatformSetLogger(ULLogger logger); + +/// +/// Set a custom FileSystem implementation. +/// +/// This is used for loading File URLs (eg, ). If you don't +/// call this, and are not using ulCreateApp() or ulEnablePlatformFileSystem(), +/// you will not be able to load any File URLs. +/// +/// You should call this before ulCreateRenderer() or ulCreateApp(). +/// +/// @note ulCreateApp() will use the default platform file system if you never +/// call this. +/// +/// @note If you're not using ulCreateApp(), (eg, using ulCreateRenderer()) +/// you can still use the default platform file system by calling +/// ulEnablePlatformFileSystem() (@see ) +/// +ULExport void ulPlatformSetFileSystem(ULFileSystem file_system); + +/// +/// Set a custom Surface implementation. +/// +/// This can be used to wrap a platform-specific GPU texture, Windows DIB, +/// macOS CGImage, or any other pixel buffer target for display on screen. +/// +/// By default, the library uses a bitmap surface for all surfaces but you can +/// override this by providing your own surface definition here. +/// +/// You should call this before ulCreateRenderer() or ulCreateApp(). +/// +ULExport void ulPlatformSetSurfaceDefinition(ULSurfaceDefinition surface_definition); + +/// +/// Set a custom GPUDriver implementation. +/// +/// This should be used if you have enabled the GPU renderer in the Config and +/// are using ulCreateRenderer() (which does not provide its own GPUDriver +/// implementation). +/// +/// The GPUDriver interface is used by the library to dispatch GPU calls to +/// your native GPU context (eg, D3D11, Metal, OpenGL, Vulkan, etc.) There +/// are reference implementations for this interface in the AppCore repo. +/// +/// You should call this before ulCreateRenderer(). +/// +ULExport void ulPlatformSetGPUDriver(ULGPUDriver gpu_driver); + +/// +/// Set a custom Clipboard implementation. +/// +/// This should be used if you are using ulCreateRenderer() (which does not +/// provide its own clipboard implementation). +/// +/// The Clipboard interface is used by the library to make calls to the +/// system's native clipboard (eg, cut, copy, paste). +/// +/// You should call this before ulCreateRenderer(). +/// +ULExport void ulPlatformSetClipboard(ULClipboard clipboard); + +#ifdef __cplusplus +} +#endif + +#endif // ULTRALIGHT_CAPI_H diff --git a/engine/inc/Ultralight/Defines.h b/engine/inc/Ultralight/Defines.h new file mode 100644 index 00000000..055b4ac0 --- /dev/null +++ b/engine/inc/Ultralight/Defines.h @@ -0,0 +1,95 @@ +/// +/// @file Defines.h +/// +/// @brief Common platform definitions +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once + +// Needed for limit defines, like INTMAX_MAX, which is used by the std C++ library +#ifndef __STDC_LIMIT_MACROS +#define __STDC_LIMIT_MACROS +#endif + +#include +#include +#include + +#ifdef SWIG +#define UExport +#else + +// Require C++11 Support +#if defined(_MSC_VER) +# if _MSC_VER < 1800 +# error This project needs at least Visual Studio 2013 to build +# endif +#elif __cplusplus <= 199711L +# error This project can only be compiled with a compiler that supports C++11 +#endif + + +#if defined(__WIN32__) || defined(_WIN32) +# if defined(ULTRALIGHT_IMPLEMENTATION) +# define UExport __declspec(dllexport) +# else +# define UExport __declspec(dllimport) +# endif +#define _thread_local __declspec(thread) +#ifndef _NATIVE_WCHAR_T_DEFINED +#define DISABLE_NATIVE_WCHAR_T +#endif +#else +# define UExport __attribute__((visibility("default"))) +#define _thread_local __thread +#endif + +#endif + +#define ULTRALIGHT_VERSION "1.2.0" +#define ULTRALIGHT_VERSION_MAJOR 1 +#define ULTRALIGHT_VERSION_MINOR 2 +#define ULTRALIGHT_VERSION_PATCH 0 + +#ifdef __cplusplus +extern "C" { +#endif + +UExport const char* UltralightVersionString(); +UExport uint32_t UltralightVersionMajor(); +UExport uint32_t UltralightVersionMinor(); +UExport uint32_t UltralightVersionPatch(); + +#ifdef __cplusplus +} +#endif + +/// +/// @mainpage Ultralight C++ API Reference +/// +/// @section intro_sec Introduction +/// +/// Hi there, welcome to the C++ API Reference for Ultralight! +/// +/// Ultralight is a fast, lightweight HTML UI engine for desktop apps and games. +/// +/// If this is your first time exploring the API, we recommend +/// starting with ultralight::Renderer and ultralight::View. +/// +/// +/// @section usefullinks_sec Useful Links +/// - Home: -- Get the latest binaries +/// - Docs: -- API overview, code snippets, tutorials and more! +/// - Discord: -- Stuck? Have questions? Come chat with us! +/// - GitHub: -- Report issues and browse code +/// +/// @section copyright_sec Copyright +/// Documentation is Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// diff --git a/engine/inc/Ultralight/Geometry.h b/engine/inc/Ultralight/Geometry.h new file mode 100644 index 00000000..6616bd3e --- /dev/null +++ b/engine/inc/Ultralight/Geometry.h @@ -0,0 +1,677 @@ +/// +/// @file Geometry.h +/// +/// @brief The header for various geometry definitions and helpers +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include +#include +#include +#include +#include + +namespace ultralight { + +/// +/// 2D Vector Helper +/// +struct UExport vec2 { + union { + float value[2]; + struct { float x, y; }; + }; + + inline vec2() {} + + inline vec2(float x, float y) : x(x), y(y) {} + + inline vec2(float x) : x(x), y(x) {} + + inline vec2 yx() const { return { y, x }; } + + inline vec2 xx() const { return { x, x }; } + + inline vec2 yy() const { return { y, y }; } + + inline friend vec2 operator+(vec2 lhs, const vec2& rhs) { lhs += rhs; return lhs; } + + inline friend vec2 operator-(vec2 lhs, const vec2& rhs) { lhs -= rhs; return lhs; } + + inline friend vec2 operator*(vec2 lhs, const vec2& rhs) { lhs *= rhs; return lhs; } + + inline friend vec2 operator/(vec2 lhs, const vec2& rhs) { lhs /= rhs; return lhs; } + + inline friend vec2 operator+(vec2 lhs, float rhs) { lhs += rhs; return lhs; } + + inline friend vec2 operator-(vec2 lhs, float rhs) { lhs -= rhs; return lhs; } + + inline friend vec2 operator*(vec2 lhs, float rhs) { lhs *= rhs; return lhs; } + + inline friend vec2 operator/(vec2 lhs, float rhs) { lhs /= rhs; return lhs; } + + inline vec2& operator+=(const vec2& rhs) { + value[0] += rhs.value[0]; + value[1] += rhs.value[1]; + return *this; + } + + inline vec2& operator-=(const vec2& rhs) { + value[0] -= rhs.value[0]; + value[1] -= rhs.value[1]; + return *this; + } + + inline vec2& operator*=(const vec2& rhs) { + value[0] *= rhs.value[0]; + value[1] *= rhs.value[1]; + return *this; + } + + inline vec2& operator/=(const vec2& rhs) { + value[0] /= rhs.value[0]; + value[1] /= rhs.value[1]; + return *this; + } + + inline vec2& operator+=(float rhs) { + value[0] += rhs; + value[1] += rhs; + return *this; + } + + inline vec2& operator-=(float rhs) { + value[0] -= rhs; + value[1] -= rhs; + return *this; + } + + inline vec2& operator*=(float rhs) { + value[0] *= rhs; + value[1] *= rhs; + return *this; + } + + inline vec2& operator/=(float rhs) { + value[0] /= rhs; + value[1] /= rhs; + return *this; + } + + inline friend bool operator==(const vec2& a, const vec2& b) { + return !memcmp(&a, &b, sizeof(a)); + } + + inline friend bool operator!=(const vec2& a, const vec2& b) { + return !(a == b); + } + + inline friend vec2 min_(const vec2& a, const vec2& b) { + return{ (b.x < a.x) ? b.x : a.x, + (b.y < a.y) ? b.y : a.y }; + } + + inline friend vec2 max_(const vec2& a, const vec2& b) { + return{ (a.x < b.x) ? b.x : a.x, + (a.y < b.y) ? b.y : a.y }; + } + + inline friend vec2 clamp(const vec2& x, const vec2& minVal, const vec2& maxVal) { + return min_(max_(x, minVal), maxVal); + } + + inline friend vec2 mix(const vec2& a, const vec2& b, float t) { + return a * (1.0f - t) + b * t; + } + + inline friend float length(const vec2& a) { + return sqrtf(a.x * a.x + a.y * a.y); + } + + // squared length + inline friend float length2(const vec2& a) { + return dot(a, a); + } + + inline friend float distance(const vec2& a, const vec2& b) { + return length(a - b); + } + + // squared distance + inline friend float distance2(const vec2& a, const vec2& b) { + return length2(a - b); + } + + inline friend vec2 normalize(const vec2& a) { + return a / length(a); + } + + inline friend float dot(const vec2& a, const vec2& b) { + return a.x * b.x + a.y * b.y; + } +}; + +/// +/// 3D Vector Helper +/// +struct UExport vec3 { + union { + float value[3]; + struct { float x, y, z; }; + }; + + inline vec3() {} + + inline vec3(float x, float y, float z) : x(x), y(y), z(z) {} + + inline vec3(float x) : x(x), y(x), z(x) {} + + inline friend vec3 operator+(vec3 lhs, const vec3& rhs) { lhs += rhs; return lhs; } + + inline friend vec3 operator-(vec3 lhs, const vec3& rhs) { lhs -= rhs; return lhs; } + + inline friend vec3 operator*(vec3 lhs, const vec3& rhs) { lhs *= rhs; return lhs; } + + inline friend vec3 operator/(vec3 lhs, const vec3& rhs) { lhs /= rhs; return lhs; } + + inline friend vec3 operator+(vec3 lhs, float rhs) { lhs += rhs; return lhs; } + + inline friend vec3 operator-(vec3 lhs, float rhs) { lhs -= rhs; return lhs; } + + inline friend vec3 operator*(vec3 lhs, float rhs) { lhs *= rhs; return lhs; } + + inline friend vec3 operator/(vec3 lhs, float rhs) { lhs /= rhs; return lhs; } + + inline vec3& operator+=(const vec3& rhs) { + value[0] += rhs.value[0]; + value[1] += rhs.value[1]; + value[2] += rhs.value[2]; + return *this; + } + + inline vec3& operator-=(const vec3& rhs) { + value[0] -= rhs.value[0]; + value[1] -= rhs.value[1]; + value[2] -= rhs.value[2]; + return *this; + } + + inline vec3& operator*=(const vec3& rhs) { + value[0] *= rhs.value[0]; + value[1] *= rhs.value[1]; + value[2] *= rhs.value[2]; + return *this; + } + + inline vec3& operator/=(const vec3& rhs) { + value[0] /= rhs.value[0]; + value[1] /= rhs.value[1]; + value[2] /= rhs.value[2]; + return *this; + } + + inline vec3& operator+=(float rhs) { + value[0] += rhs; + value[1] += rhs; + value[2] += rhs; + return *this; + } + + inline vec3& operator-=(float rhs) { + value[0] -= rhs; + value[1] -= rhs; + value[2] -= rhs; + return *this; + } + + inline vec3& operator*=(float rhs) { + value[0] *= rhs; + value[1] *= rhs; + value[2] *= rhs; + return *this; + } + + inline vec3& operator/=(float rhs) { + value[0] /= rhs; + value[1] /= rhs; + value[2] /= rhs; + return *this; + } + + inline friend bool operator==(const vec3& a, const vec3& b) { + return !memcmp(&a, &b, sizeof(a)); + } + + inline friend bool operator!=(const vec3& a, const vec3& b) { + return !(a == b); + } + + inline friend vec3 min_(const vec3& a, const vec3& b) { + return{ (b.x < a.x) ? b.x : a.x, + (b.y < a.y) ? b.y : a.y, + (b.z < a.z) ? b.z : a.z }; + } + + inline friend vec3 max_(const vec3& a, const vec3& b) { + return{ (a.x < b.x) ? b.x : a.x, + (a.y < b.y) ? b.y : a.y, + (a.z < b.z) ? b.z : a.z }; + } + inline friend vec3 clamp(const vec3& x, const vec3& minVal, const vec3& maxVal) { + return min_(max_(x, minVal), maxVal); + } + + inline friend vec3 mix(const vec3& a, const vec3& b, float t) { + return a * (1.0f - t) + b * t; + } + + inline friend float length(const vec3& a) { + return sqrtf(a.x * a.x + a.y * a.y + a.z * a.z); + } + + inline friend float distance(const vec3& a, const vec3& b) { + return length(a - b); + } + + inline friend vec3 normalize(const vec3& a) { + return a / length(a); + } + + inline friend float dot(const vec3& a, const vec3& b) { + return a.x * b.x + a.y * b.y + a.z * b.z; + } +}; + +/// +/// 4D Vector Helper +/// +struct UExport vec4 { + union { + float value[4]; + struct { float x, y, z, w; }; + }; + + inline vec4() {} + + inline vec4(float x, float y, float z, float w) : x(x), y(y), z(z), w(w) {} + + inline vec4(float x) : x(x), y(x), z(x), w(x) {} + + inline vec4(const float x[4]) { memcpy(value, x, sizeof(value)); } + + inline friend bool operator==(const vec4& a, const vec4& b) { + return !memcmp(&a, &b, sizeof(a)); + } + + inline friend bool operator!=(const vec4& a, const vec4& b) { + return !(a == b); + } + + inline friend vec4 operator+(vec4 lhs, const vec4& rhs) { lhs += rhs; return lhs; } + + inline friend vec4 operator-(vec4 lhs, const vec4& rhs) { lhs -= rhs; return lhs; } + + inline friend vec4 operator*(vec4 lhs, const vec4& rhs) { lhs *= rhs; return lhs; } + + inline friend vec4 operator/(vec4 lhs, const vec4& rhs) { lhs /= rhs; return lhs; } + + inline friend vec4 operator+(vec4 lhs, float rhs) { lhs += rhs; return lhs; } + + inline friend vec4 operator-(vec4 lhs, float rhs) { lhs -= rhs; return lhs; } + + inline friend vec4 operator*(vec4 lhs, float rhs) { lhs *= rhs; return lhs; } + + inline friend vec4 operator/(vec4 lhs, float rhs) { lhs /= rhs; return lhs; } + + inline vec4& operator+=(const vec4& rhs) { + value[0] += rhs.value[0]; + value[1] += rhs.value[1]; + value[2] += rhs.value[2]; + value[3] += rhs.value[3]; + return *this; + } + + inline vec4& operator-=(const vec4& rhs) { + value[0] -= rhs.value[0]; + value[1] -= rhs.value[1]; + value[2] -= rhs.value[2]; + value[3] -= rhs.value[3]; + return *this; + } + + inline vec4& operator*=(const vec4& rhs) { + value[0] *= rhs.value[0]; + value[1] *= rhs.value[1]; + value[2] *= rhs.value[2]; + value[3] *= rhs.value[3]; + return *this; + } + + inline vec4& operator/=(const vec4& rhs) { + value[0] /= rhs.value[0]; + value[1] /= rhs.value[1]; + value[2] /= rhs.value[2]; + value[3] /= rhs.value[3]; + return *this; + } + + inline vec4& operator+=(float rhs) { + value[0] += rhs; + value[1] += rhs; + value[2] += rhs; + value[3] += rhs; + return *this; + } + + inline vec4& operator-=(float rhs) { + value[0] -= rhs; + value[1] -= rhs; + value[2] -= rhs; + value[3] -= rhs; + return *this; + } + + inline vec4& operator*=(float rhs) { + value[0] *= rhs; + value[1] *= rhs; + value[2] *= rhs; + value[3] *= rhs; + return *this; + } + + inline vec4& operator/=(float rhs) { + value[0] /= rhs; + value[1] /= rhs; + value[2] /= rhs; + value[3] /= rhs; + return *this; + } + + inline friend vec4 min_(const vec4& a, const vec4& b) { + return{ (b.x < a.x) ? b.x : a.x, + (b.y < a.y) ? b.y : a.y, + (b.z < a.z) ? b.z : a.z, + (b.w < a.w) ? b.w : a.w }; + } + + inline friend vec4 max_(const vec4& a, const vec4& b) { + return{ (a.x < b.x) ? b.x : a.x, + (a.y < b.y) ? b.y : a.y, + (a.z < b.z) ? b.z : a.z, + (a.w < b.w) ? b.w : a.w }; + } +}; + +/// +/// Point is typedef'd to a 2D vector +/// +typedef vec2 Point; + +/// +/// Float Rectangle Helper +/// +struct UExport Rect { + union { + float value[4]; + struct { float left, top, right, bottom; }; + }; + + static inline Rect MakeEmpty() { + Rect result; + result.SetEmpty(); + return result; + } + + inline float width() const { return right - left; } + inline float height() const { return bottom - top; } + inline float x() const { return left; } + inline float y() const { return top; } + inline float center_x() const { return (left + right) * 0.5f; } + inline float center_y() const { return (top + bottom) * 0.5f; } + + inline Point origin() const { return { left, top }; } + + inline void SetEmpty() { + memset(this, 0, sizeof(*this)); + } + + inline bool IsEmpty() const { + return *this == MakeEmpty(); + } + + inline bool IsValid() const { + return width() > 0 && height() > 0; + } + + inline void Inset(float dx, float dy) { + value[0] += dx; + value[1] += dy; + value[2] -= dx; + value[3] -= dy; + } + + inline void Outset(float dx, float dy) { + Inset(-dx, -dy); + } + + inline void Move(float dx, float dy) { + value[0] += dx; + value[1] += dy; + value[2] += dx; + value[3] += dy; + } + + inline float area() const { + return width() * height(); + } + + inline void Join(const Rect& rhs) { + // if we are empty, just assign + if (IsEmpty()) { + *this = rhs; + } + else { + if (rhs.value[0] < value[0]) value[0] = rhs.value[0]; + if (rhs.value[1] < value[1]) value[1] = rhs.value[1]; + if (rhs.value[2] > value[2]) value[2] = rhs.value[2]; + if (rhs.value[3] > value[3]) value[3] = rhs.value[3]; + } + } + + inline void Join(const Point& p) { + // if we are empty, just assign + if (IsEmpty()) { + *this = { p.x, p.y, p.x, p.y }; + } + else { + if (p.x < value[0]) value[0] = p.x; + if (p.y < value[1]) value[1] = p.y; + if (p.x > value[2]) value[2] = p.x; + if (p.y > value[3]) value[3] = p.y; + } + } + + inline bool Contains(const Point& p) const { + return p.x >= left && p.x <= right && + p.y >= top && p.y <= bottom; + } + + inline bool Contains(const Rect& r) const { + return left <= r.left && top <= r.top && + right >= r.right && bottom >= r.bottom; + } + + inline bool Intersects(const Rect& rhs) const { + return !(rhs.left > right || + rhs.right < left || + rhs.top > bottom || + rhs.bottom < top); + } + + inline Rect Intersect(const Rect& other) const { + return{ (left < other.left) ? other.left : left, + (top < other.top) ? other.top : top, + (other.right < right) ? other.right : right, + (other.bottom < bottom) ? other.bottom : bottom }; + } + + friend inline bool operator==(const Rect& a, const Rect& b) { + return !memcmp(&a, &b, sizeof(a)); + } + + friend inline bool operator!=(const Rect& a, const Rect& b) { + return !(a == b); + } +}; + +/// +/// Integer Rectangle Helper +/// +struct UExport IntRect { + union { + int value[4]; + struct { int left, top, right, bottom; }; + }; + + static inline IntRect MakeEmpty() { + IntRect result; + result.SetEmpty(); + return result; + } + + inline int width() const { return right - left; } + inline int height() const { return bottom - top; } + inline int x() const { return left; } + inline int y() const { return top; } + inline int center_x() const { return (int)std::round((left + right) * 0.5f); } + inline int center_y() const { return (int)std::round((top + bottom) * 0.5f); } + + inline Point origin() const { return{ (float)left, (float)top }; } + + inline void SetEmpty() { + memset(this, 0, sizeof(*this)); + } + + inline bool IsEmpty() const { + return *this == MakeEmpty(); + } + + inline bool IsValid() const { + return width() > 0 && height() > 0; + } + + inline void Inset(int dx, int dy) { + value[0] += dx; + value[1] += dy; + value[2] -= dx; + value[3] -= dy; + } + + inline void Outset(int dx, int dy) { + Inset(-dx, -dy); + } + + inline void Move(int dx, int dy) { + value[0] += dx; + value[1] += dy; + value[2] += dx; + value[3] += dy; + } + + inline int area() const { + return width() * height(); + } + + inline void Join(const IntRect& rhs) { + // if we are empty, just assign + if (IsEmpty()) { + *this = rhs; + } + else { + if (rhs.value[0] < value[0]) value[0] = rhs.value[0]; + if (rhs.value[1] < value[1]) value[1] = rhs.value[1]; + if (rhs.value[2] > value[2]) value[2] = rhs.value[2]; + if (rhs.value[3] > value[3]) value[3] = rhs.value[3]; + } + } + + inline void Join(const Point& p) { + // if we are empty, just assign + if (IsEmpty()) { + *this = { (int)std::floor(p.x), (int)std::floor(p.y), (int)std::ceil(p.x), (int)std::ceil(p.y) }; + } + else { + if ((int)std::floor(p.x) < value[0]) value[0] = (int)std::floor(p.x); + if ((int)std::floor(p.y) < value[1]) value[1] = (int)std::floor(p.y); + if ((int)std::ceil(p.x) > value[2]) value[2] = (int)std::ceil(p.x); + if ((int)std::ceil(p.y) > value[3]) value[3] = (int)std::ceil(p.y); + } + } + + inline bool Contains(const Point& p) const { + return p.x >= left && p.x <= right && + p.y >= top && p.y <= bottom; + } + + inline bool Contains(const IntRect& r) const { + return left <= r.left && top <= r.top && + right >= r.right && bottom >= r.bottom; + } + + inline bool Intersects(const IntRect& rhs) const { + // Since this is mostly used for pixel operations, we only count + // intersections that have width and height >= 1. + return !(rhs.left > right - 1 || + rhs.right < left || + rhs.top > bottom - 1 || + rhs.bottom < top); + } + + inline IntRect Intersect(const IntRect& other) const { + return{ (left < other.left) ? other.left : left, + (top < other.top) ? other.top : top, + (other.right < right) ? other.right : right, + (other.bottom < bottom) ? other.bottom : bottom }; + } + + friend inline bool operator==(const IntRect& a, const IntRect& b) { + return !memcmp(&a, &b, sizeof(a)); + } + + friend inline bool operator!=(const IntRect& a, const IntRect& b) { + return !(a == b); + } +}; + +/// +/// Rounded Rectangle Helper +/// +struct UExport RoundedRect { + Rect rect; + float radii_x[4]; + float radii_y[4]; + + void SetEmpty(); + + bool IsRounded() const; + + // Negative is inside, positive is outside. + float GetSignedDistance(const Point& p) const; + + // Returns whether or not intersection is found. Can fail if the resulting + // geometry is not a rounded rectangle. + bool Intersect(const RoundedRect& other, RoundedRect& result) const; + + void SnapToPixels(); + + Rect CalculateInterior() const; +}; + +} // namespace ultralight diff --git a/engine/inc/Ultralight/JavaScript.h b/engine/inc/Ultralight/JavaScript.h new file mode 100644 index 00000000..bf6faedd --- /dev/null +++ b/engine/inc/Ultralight/JavaScript.h @@ -0,0 +1,39 @@ +/// +/// @file View.h +/// +/// @brief The header for the View class. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include +#include +#include +#include + +namespace ultralight { + +/// +/// This class wraps a JSContextRef (a JavaScript execution context for use +/// with JavaScriptCore) and locks the context on the current thread for the +/// duration of its lifetime. +/// +class UExport JSContext : public RefCounted { +public: + /// Get the underlying JSContextRef for use with JavaScriptCore C API + virtual JSContextRef ctx() = 0; + + /// Typecast to a JSContextRef for use with JavaScriptCore C API + operator JSContextRef(); + +protected: + virtual ~JSContext(); +}; + +} // namespace ultralight diff --git a/engine/inc/Ultralight/KeyCodes.h b/engine/inc/Ultralight/KeyCodes.h new file mode 100644 index 00000000..3a4a7451 --- /dev/null +++ b/engine/inc/Ultralight/KeyCodes.h @@ -0,0 +1,527 @@ +/// +/// @file KeyCodes.h +/// +/// @brief The header for the KeyCodes definitions. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once + +namespace ultralight { + +/// +/// Namespace containing all the key-code definitions for KeyboardEvent. +/// Most of these correspond directly to the key-code values on Windows. + /// +namespace KeyCodes { + + // GK_BACK (08) BACKSPACE key + const int GK_BACK = 0x08; + + // GK_TAB (09) TAB key + const int GK_TAB = 0x09; + + // GK_CLEAR (0C) CLEAR key + const int GK_CLEAR = 0x0C; + + // GK_RETURN (0D) + const int GK_RETURN = 0x0D; + + // GK_SHIFT (10) SHIFT key + const int GK_SHIFT = 0x10; + + // GK_CONTROL (11) CTRL key + const int GK_CONTROL = 0x11; + + // GK_MENU (12) ALT key + const int GK_MENU = 0x12; + + // GK_PAUSE (13) PAUSE key + const int GK_PAUSE = 0x13; + + // GK_CAPITAL (14) CAPS LOCK key + const int GK_CAPITAL = 0x14; + + // GK_KANA (15) Input Method Editor (IME) Kana mode + const int GK_KANA = 0x15; + + // GK_HANGUEL (15) IME Hanguel mode (maintained for compatibility; use GK_HANGUL) + // GK_HANGUL (15) IME Hangul mode + const int GK_HANGUL = 0x15; + + // GK_JUNJA (17) IME Junja mode + const int GK_JUNJA = 0x17; + + // GK_FINAL (18) IME final mode + const int GK_FINAL = 0x18; + + // GK_HANJA (19) IME Hanja mode + const int GK_HANJA = 0x19; + + // GK_KANJI (19) IME Kanji mode + const int GK_KANJI = 0x19; + + // GK_ESCAPE (1B) ESC key + const int GK_ESCAPE = 0x1B; + + // GK_CONVERT (1C) IME convert + const int GK_CONVERT = 0x1C; + + // GK_NONCONVERT (1D) IME nonconvert + const int GK_NONCONVERT = 0x1D; + + // GK_ACCEPT (1E) IME accept + const int GK_ACCEPT = 0x1E; + + // GK_MODECHANGE (1F) IME mode change request + const int GK_MODECHANGE = 0x1F; + + // GK_SPACE (20) SPACEBAR + const int GK_SPACE = 0x20; + + // GK_PRIOR (21) PAGE UP key + const int GK_PRIOR = 0x21; + + // GK_NEXT (22) PAGE DOWN key + const int GK_NEXT = 0x22; + + // GK_END (23) END key + const int GK_END = 0x23; + + // GK_HOME (24) HOME key + const int GK_HOME = 0x24; + + // GK_LEFT (25) LEFT ARROW key + const int GK_LEFT = 0x25; + + // GK_UP (26) UP ARROW key + const int GK_UP = 0x26; + + // GK_RIGHT (27) RIGHT ARROW key + const int GK_RIGHT = 0x27; + + // GK_DOWN (28) DOWN ARROW key + const int GK_DOWN = 0x28; + + // GK_SELECT (29) SELECT key + const int GK_SELECT = 0x29; + + // GK_PRINT (2A) PRINT key + const int GK_PRINT = 0x2A; + + // GK_EXECUTE (2B) EXECUTE key + const int GK_EXECUTE = 0x2B; + + // GK_SNAPSHOT (2C) PRINT SCREEN key + const int GK_SNAPSHOT = 0x2C; + + // GK_INSERT (2D) INS key + const int GK_INSERT = 0x2D; + + // GK_DELETE (2E) DEL key + const int GK_DELETE = 0x2E; + + // GK_HELP (2F) HELP key + const int GK_HELP = 0x2F; + + // (30) 0 key + const int GK_0 = 0x30; + + // (31) 1 key + const int GK_1 = 0x31; + + // (32) 2 key + const int GK_2 = 0x32; + + // (33) 3 key + const int GK_3 = 0x33; + + // (34) 4 key + const int GK_4 = 0x34; + + // (35) 5 key; + const int GK_5 = 0x35; + + // (36) 6 key + const int GK_6 = 0x36; + + // (37) 7 key + const int GK_7 = 0x37; + + // (38) 8 key + const int GK_8 = 0x38; + + // (39) 9 key + const int GK_9 = 0x39; + + // (41) A key + const int GK_A = 0x41; + + // (42) B key + const int GK_B = 0x42; + + // (43) C key + const int GK_C = 0x43; + + // (44) D key + const int GK_D = 0x44; + + // (45) E key + const int GK_E = 0x45; + + // (46) F key + const int GK_F = 0x46; + + // (47) G key + const int GK_G = 0x47; + + // (48) H key + const int GK_H = 0x48; + + // (49) I key + const int GK_I = 0x49; + + // (4A) J key + const int GK_J = 0x4A; + + // (4B) K key + const int GK_K = 0x4B; + + // (4C) L key + const int GK_L = 0x4C; + + // (4D) M key + const int GK_M = 0x4D; + + // (4E) N key + const int GK_N = 0x4E; + + // (4F) O key + const int GK_O = 0x4F; + + // (50) P key + const int GK_P = 0x50; + + // (51) Q key + const int GK_Q = 0x51; + + // (52) R key + const int GK_R = 0x52; + + // (53) S key + const int GK_S = 0x53; + + // (54) T key + const int GK_T = 0x54; + + // (55) U key + const int GK_U = 0x55; + + // (56) V key + const int GK_V = 0x56; + + // (57) W key + const int GK_W = 0x57; + + // (58) X key + const int GK_X = 0x58; + + // (59) Y key + const int GK_Y = 0x59; + + // (5A) Z key + const int GK_Z = 0x5A; + + // GK_LWIN (5B) Left Windows key (Microsoft Natural keyboard) + const int GK_LWIN = 0x5B; + + // GK_RWIN (5C) Right Windows key (Natural keyboard) + const int GK_RWIN = 0x5C; + + // GK_APPS (5D) Applications key (Natural keyboard) + const int GK_APPS = 0x5D; + + // GK_SLEEP (5F) Computer Sleep key + const int GK_SLEEP = 0x5F; + + // GK_NUMPAD0 (60) Numeric keypad 0 key + const int GK_NUMPAD0 = 0x60; + + // GK_NUMPAD1 (61) Numeric keypad 1 key + const int GK_NUMPAD1 = 0x61; + + // GK_NUMPAD2 (62) Numeric keypad 2 key + const int GK_NUMPAD2 = 0x62; + + // GK_NUMPAD3 (63) Numeric keypad 3 key + const int GK_NUMPAD3 = 0x63; + + // GK_NUMPAD4 (64) Numeric keypad 4 key + const int GK_NUMPAD4 = 0x64; + + // GK_NUMPAD5 (65) Numeric keypad 5 key + const int GK_NUMPAD5 = 0x65; + + // GK_NUMPAD6 (66) Numeric keypad 6 key + const int GK_NUMPAD6 = 0x66; + + // GK_NUMPAD7 (67) Numeric keypad 7 key + const int GK_NUMPAD7 = 0x67; + + // GK_NUMPAD8 (68) Numeric keypad 8 key + const int GK_NUMPAD8 = 0x68; + + // GK_NUMPAD9 (69) Numeric keypad 9 key + const int GK_NUMPAD9 = 0x69; + + // GK_MULTIPLY (6A) Multiply key + const int GK_MULTIPLY = 0x6A; + + // GK_ADD (6B) Add key + const int GK_ADD = 0x6B; + + // GK_SEPARATOR (6C) Separator key + const int GK_SEPARATOR = 0x6C; + + // GK_SUBTRACT (6D) Subtract key + const int GK_SUBTRACT = 0x6D; + + // GK_DECIMAL (6E) Decimal key + const int GK_DECIMAL = 0x6E; + + // GK_DIVIDE (6F) Divide key + const int GK_DIVIDE = 0x6F; + + // GK_F1 (70) F1 key + const int GK_F1 = 0x70; + + // GK_F2 (71) F2 key + const int GK_F2 = 0x71; + + // GK_F3 (72) F3 key + const int GK_F3 = 0x72; + + // GK_F4 (73) F4 key + const int GK_F4 = 0x73; + + // GK_F5 (74) F5 key + const int GK_F5 = 0x74; + + // GK_F6 (75) F6 key + const int GK_F6 = 0x75; + + // GK_F7 (76) F7 key + const int GK_F7 = 0x76; + + // GK_F8 (77) F8 key + const int GK_F8 = 0x77; + + // GK_F9 (78) F9 key + const int GK_F9 = 0x78; + + // GK_F10 (79) F10 key + const int GK_F10 = 0x79; + + // GK_F11 (7A) F11 key + const int GK_F11 = 0x7A; + + // GK_F12 (7B) F12 key + const int GK_F12 = 0x7B; + + // GK_F13 (7C) F13 key + const int GK_F13 = 0x7C; + + // GK_F14 (7D) F14 key + const int GK_F14 = 0x7D; + + // GK_F15 (7E) F15 key + const int GK_F15 = 0x7E; + + // GK_F16 (7F) F16 key + const int GK_F16 = 0x7F; + + // GK_F17 (80H) F17 key + const int GK_F17 = 0x80; + + // GK_F18 (81H) F18 key + const int GK_F18 = 0x81; + + // GK_F19 (82H) F19 key + const int GK_F19 = 0x82; + + // GK_F20 (83H) F20 key + const int GK_F20 = 0x83; + + // GK_F21 (84H) F21 key + const int GK_F21 = 0x84; + + // GK_F22 (85H) F22 key + const int GK_F22 = 0x85; + + // GK_F23 (86H) F23 key + const int GK_F23 = 0x86; + + // GK_F24 (87H) F24 key + const int GK_F24 = 0x87; + + // GK_NUMLOCK (90) NUM LOCK key + const int GK_NUMLOCK = 0x90; + + // GK_SCROLL (91) SCROLL LOCK key + const int GK_SCROLL = 0x91; + + // GK_LSHIFT (A0) Left SHIFT key + const int GK_LSHIFT = 0xA0; + + // GK_RSHIFT (A1) Right SHIFT key + const int GK_RSHIFT = 0xA1; + + // GK_LCONTROL (A2) Left CONTROL key + const int GK_LCONTROL = 0xA2; + + // GK_RCONTROL (A3) Right CONTROL key + const int GK_RCONTROL = 0xA3; + + // GK_LMENU (A4) Left MENU key + const int GK_LMENU = 0xA4; + + // GK_RMENU (A5) Right MENU key + const int GK_RMENU = 0xA5; + + // GK_BROWSER_BACK (A6) Windows 2000/XP: Browser Back key + const int GK_BROWSER_BACK = 0xA6; + + // GK_BROWSER_FORWARD (A7) Windows 2000/XP: Browser Forward key + const int GK_BROWSER_FORWARD = 0xA7; + + // GK_BROWSER_REFRESH (A8) Windows 2000/XP: Browser Refresh key + const int GK_BROWSER_REFRESH = 0xA8; + + // GK_BROWSER_STOP (A9) Windows 2000/XP: Browser Stop key + const int GK_BROWSER_STOP = 0xA9; + + // GK_BROWSER_SEARCH (AA) Windows 2000/XP: Browser Search key + const int GK_BROWSER_SEARCH = 0xAA; + + // GK_BROWSER_FAVORITES (AB) Windows 2000/XP: Browser Favorites key + const int GK_BROWSER_FAVORITES = 0xAB; + + // GK_BROWSER_HOME (AC) Windows 2000/XP: Browser Start and Home key + const int GK_BROWSER_HOME = 0xAC; + + // GK_VOLUME_MUTE (AD) Windows 2000/XP: Volume Mute key + const int GK_VOLUME_MUTE = 0xAD; + + // GK_VOLUME_DOWN (AE) Windows 2000/XP: Volume Down key + const int GK_VOLUME_DOWN = 0xAE; + + // GK_VOLUME_UP (AF) Windows 2000/XP: Volume Up key + const int GK_VOLUME_UP = 0xAF; + + // GK_MEDIA_NEXT_TRACK (B0) Windows 2000/XP: Next Track key + const int GK_MEDIA_NEXT_TRACK = 0xB0; + + // GK_MEDIA_PREV_TRACK (B1) Windows 2000/XP: Previous Track key + const int GK_MEDIA_PREV_TRACK = 0xB1; + + // GK_MEDIA_STOP (B2) Windows 2000/XP: Stop Media key + const int GK_MEDIA_STOP = 0xB2; + + // GK_MEDIA_PLAY_PAUSE (B3) Windows 2000/XP: Play/Pause Media key + const int GK_MEDIA_PLAY_PAUSE = 0xB3; + + // GK_LAUNCH_MAIL (B4) Windows 2000/XP: Start Mail key + const int GK_MEDIA_LAUNCH_MAIL = 0xB4; + + // GK_LAUNCH_MEDIA_SELECT (B5) Windows 2000/XP: Select Media key + const int GK_MEDIA_LAUNCH_MEDIA_SELECT = 0xB5; + + // GK_LAUNCH_APP1 (B6) Windows 2000/XP: Start Application 1 key + const int GK_MEDIA_LAUNCH_APP1 = 0xB6; + + // GK_LAUNCH_APP2 (B7) Windows 2000/XP: Start Application 2 key + const int GK_MEDIA_LAUNCH_APP2 = 0xB7; + + // GK_OEM_1 (BA) Used for miscellaneous characters; it can vary by keyboard. Windows 2000/XP: For the US standard keyboard, the ';:' key + const int GK_OEM_1 = 0xBA; + + // GK_OEM_PLUS (BB) Windows 2000/XP: For any country/region, the '+' key + const int GK_OEM_PLUS = 0xBB; + + // GK_OEM_COMMA (BC) Windows 2000/XP: For any country/region, the ',' key + const int GK_OEM_COMMA = 0xBC; + + // GK_OEM_MINUS (BD) Windows 2000/XP: For any country/region, the '-' key + const int GK_OEM_MINUS = 0xBD; + + // GK_OEM_PERIOD (BE) Windows 2000/XP: For any country/region, the '.' key + const int GK_OEM_PERIOD = 0xBE; + + // GK_OEM_2 (BF) Used for miscellaneous characters; it can vary by keyboard. Windows 2000/XP: For the US standard keyboard, the '/?' key + const int GK_OEM_2 = 0xBF; + + // GK_OEM_3 (C0) Used for miscellaneous characters; it can vary by keyboard. Windows 2000/XP: For the US standard keyboard, the '`~' key + const int GK_OEM_3 = 0xC0; + + // GK_OEM_4 (DB) Used for miscellaneous characters; it can vary by keyboard. Windows 2000/XP: For the US standard keyboard, the '[{' key + const int GK_OEM_4 = 0xDB; + + // GK_OEM_5 (DC) Used for miscellaneous characters; it can vary by keyboard. Windows 2000/XP: For the US standard keyboard, the '\|' key + const int GK_OEM_5 = 0xDC; + + // GK_OEM_6 (DD) Used for miscellaneous characters; it can vary by keyboard. Windows 2000/XP: For the US standard keyboard, the ']}' key + const int GK_OEM_6 = 0xDD; + + // GK_OEM_7 (DE) Used for miscellaneous characters; it can vary by keyboard. Windows 2000/XP: For the US standard keyboard, the 'single-quote/double-quote' key + const int GK_OEM_7 = 0xDE; + + // GK_OEM_8 (DF) Used for miscellaneous characters; it can vary by keyboard. + const int GK_OEM_8 = 0xDF; + + // GK_OEM_102 (E2) Windows 2000/XP: Either the angle bracket key or the backslash key on the RT 102-key keyboard + const int GK_OEM_102 = 0xE2; + + // GK_PROCESSKEY (E5) Windows 95/98/Me, Windows NT 4.0, Windows 2000/XP: IME PROCESS key + const int GK_PROCESSKEY = 0xE5; + + // GK_PACKET (E7) Windows 2000/XP: Used to pass Unicode characters as if they were keystrokes. The GK_PACKET key is the low word of a 32-bit Virtual Key value used for non-keyboard input methods. For more information, see Remark in KEYBDINPUT,SendInput, WM_KEYDOWN, and WM_KEYUP + const int GK_PACKET = 0xE7; + + // GK_ATTN (F6) Attn key + const int GK_ATTN = 0xF6; + + // GK_CRSEL (F7) CrSel key + const int GK_CRSEL = 0xF7; + + // GK_EXSEL (F8) ExSel key + const int GK_EXSEL = 0xF8; + + // GK_EREOF (F9) Erase EOF key + const int GK_EREOF = 0xF9; + + // GK_PLAY (FA) Play key + const int GK_PLAY = 0xFA; + + // GK_ZOOM (FB) Zoom key + const int GK_ZOOM = 0xFB; + + // GK_NONAME (FC) Reserved for future use + const int GK_NONAME = 0xFC; + + // GK_PA1 (FD) PA1 key + const int GK_PA1 = 0xFD; + + // GK_OEM_CLEAR (FE) Clear key + const int GK_OEM_CLEAR = 0xFE; + + const int GK_UNKNOWN = 0; + +} // namespace KeyCodes + +} // namespace ultralight diff --git a/engine/inc/Ultralight/KeyEvent.h b/engine/inc/Ultralight/KeyEvent.h new file mode 100644 index 00000000..ce8e8073 --- /dev/null +++ b/engine/inc/Ultralight/KeyEvent.h @@ -0,0 +1,180 @@ +/// +/// @file KeyEvent.h +/// +/// @brief The header for the KeyEvent class. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include +#include +#include +#ifdef __OBJC__ +#import +#endif + +namespace ultralight { + +/// +/// @brief A generic keyboard event that can be created from a platform event +/// or synthesized from scratch. +/// +/// @see View::FireKeyEvent +/// +class UExport KeyEvent { +public: + /// + /// The various KeyEvent types. + /// + enum Type { + /// + /// Key-Down event type. (Does not trigger accelerator commands in WebCore) + /// + /// @NOTE: You should probably use RawKeyDown instead when a physical key + /// is pressed. This member is only here for historic compatibility + /// with WebCore's key event types. + /// + kType_KeyDown, + + /// + /// Key-Up event type. Use this when a physical key is released. + /// + kType_KeyUp, + + /// + /// Raw Key-Down type. Use this when a physical key is pressed. + /// + /// @NOTE: You should use RawKeyDown for physical key presses since it + /// allows WebCore to do additional command translation. + /// + kType_RawKeyDown, + + /// + /// Character input event type. Use this when the OS generates text from + /// a physical key being pressed (eg, WM_CHAR on Windows). + /// + kType_Char, + }; + + /// + /// Creates an empty KeyEvent, you will need to initialize its members + /// yourself. This is useful for synthesizing your own keyboard events. + /// + KeyEvent(); + +#ifdef _WIN32 + /// + /// Create a KeyEvent directly from a Windows keyboard event. + /// + KeyEvent(Type type, uintptr_t wparam, intptr_t lparam, bool is_system_key); +#endif + +#ifdef __OBJC__ + /// + /// Create a KeyEvent directly from a macOS NSEvent. + /// + KeyEvent(NSEvent* evt); +#endif + + /// + /// An enumeration of the different keyboard modifiers. + /// + enum Modifiers : uint8_t { + /// Whether or not an ALT key is down + kMod_AltKey = 1 << 0, + + /// Whether or not a Control key is down + kMod_CtrlKey = 1 << 1, + + /// Whether or not a meta key (Command-key on Mac, Windows-key on Win) is down + kMod_MetaKey = 1 << 2, + + /// Whether or not a Shift key is down + kMod_ShiftKey = 1 << 3, + }; + + /// + // The type of this KeyEvent + /// + Type type; + + /// + /// The current state of the keyboard. Modifiers may be OR'd together to + /// represent multiple values. + /// + unsigned modifiers; + + /// + // The virtual key-code associated with this keyboard event. This is either + // directly from the event (ie, WPARAM on Windows) or via a mapping function. + // You can see a full list of the possible virtual key-codes in + // KeyboardCodes.h + /// + int virtual_key_code; + + /// + /// The actual key-code generated by the platform. The DOM spec primarily + /// uses Windows-equivalent codes (hence virtualKeyCode above) but it helps to + /// also specify the platform-specific key-code as well. + /// + int native_key_code; + + /// + /// This is a string identifying the key that was pressed. This can be + /// generated from the virtual_key_code via the GetKeyIdentifierFromVirtualKeyCode() + /// utility function. You can find the full list of key identifiers at: + /// + /// + String key_identifier; + + /// + /// The actual text generated by this keyboard event. This is usually only a + /// single character. + /// + String text; + + /// + /// The text generated by this keyboard event before all modifiers except + /// shift are applied. This is used internally for working out shortcut keys. + /// This is usually only a single character. + /// + String unmodified_text; + + /// + /// Whether or not this is a keypad event. + /// + bool is_keypad; + + /// + /// Whether or not this was generated as the result of an auto-repeat + /// (eg, holding down a key). + /// + bool is_auto_repeat; + + /// + /// Whether or not the pressed key is a "system key". This is a Windows-only + /// concept and should be "false" for all non-Windows platforms. For more + /// information, see the following link: + /// + bool is_system_key; +}; + +/// +/// Utility function for generating a key identifier string from a virtual +/// key-code. +/// +/// @param virtual_key_code The virtual key-code to generate the key +/// identifier from. +/// +/// @param key_identifier_result The string to store the result in. +/// +void UExport GetKeyIdentifierFromVirtualKeyCode(int virtual_key_code, + String& key_identifier_result); + +} // namespace ultralight diff --git a/engine/inc/Ultralight/Listener.h b/engine/inc/Ultralight/Listener.h new file mode 100644 index 00000000..a6464633 --- /dev/null +++ b/engine/inc/Ultralight/Listener.h @@ -0,0 +1,287 @@ +/// +/// @file Listener.h +/// +/// @brief The header for View listener interfaces. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include +#include +#include +#include + +namespace ultralight { + +class View; + +/// +/// MessageSource types, @see ViewListener::OnAddConsoleMessage +/// +enum MessageSource { + kMessageSource_XML = 0, + kMessageSource_JS, + kMessageSource_Network, + kMessageSource_ConsoleAPI, + kMessageSource_Storage, + kMessageSource_AppCache, + kMessageSource_Rendering, + kMessageSource_CSS, + kMessageSource_Security, + kMessageSource_ContentBlocker, + kMessageSource_Other, +}; + +/// +/// MessageLevel types, @see ViewListener::OnAddConsoleMessage +/// +enum MessageLevel { + kMessageLevel_Log = 1, + kMessageLevel_Warning = 2, + kMessageLevel_Error = 3, + kMessageLevel_Debug = 4, + kMessageLevel_Info = 5, +}; + +/// +/// Cursor types, @see ViewListener::OnChangeCursor +/// +enum Cursor { + kCursor_Pointer = 0, + kCursor_Cross, + kCursor_Hand, + kCursor_IBeam, + kCursor_Wait, + kCursor_Help, + kCursor_EastResize, + kCursor_NorthResize, + kCursor_NorthEastResize, + kCursor_NorthWestResize, + kCursor_SouthResize, + kCursor_SouthEastResize, + kCursor_SouthWestResize, + kCursor_WestResize, + kCursor_NorthSouthResize, + kCursor_EastWestResize, + kCursor_NorthEastSouthWestResize, + kCursor_NorthWestSouthEastResize, + kCursor_ColumnResize, + kCursor_RowResize, + kCursor_MiddlePanning, + kCursor_EastPanning, + kCursor_NorthPanning, + kCursor_NorthEastPanning, + kCursor_NorthWestPanning, + kCursor_SouthPanning, + kCursor_SouthEastPanning, + kCursor_SouthWestPanning, + kCursor_WestPanning, + kCursor_Move, + kCursor_VerticalText, + kCursor_Cell, + kCursor_ContextMenu, + kCursor_Alias, + kCursor_Progress, + kCursor_NoDrop, + kCursor_Copy, + kCursor_None, + kCursor_NotAllowed, + kCursor_ZoomIn, + kCursor_ZoomOut, + kCursor_Grab, + kCursor_Grabbing, + kCursor_Custom +}; + +/// +/// @brief Interface for View-related events +/// +/// @note For more info @see View::set_view_listener +/// +class UExport ViewListener { +public: + virtual ~ViewListener() {} + + /// + /// Called when the page title changes + /// + virtual void OnChangeTitle(ultralight::View* caller, + const String& title) {} + + /// + /// Called when the page URL changes + /// + virtual void OnChangeURL(ultralight::View* caller, + const String& url) {} + + /// + /// Called when the tooltip changes (usually as result of a mouse hover) + /// + virtual void OnChangeTooltip(ultralight::View* caller, + const String& tooltip) {} + + /// + /// Called when the mouse cursor changes + /// + virtual void OnChangeCursor(ultralight::View* caller, + Cursor cursor) {} + + /// + /// Called when a message is added to the console (useful for errors / debug) + /// + virtual void OnAddConsoleMessage(ultralight::View* caller, + MessageSource source, + MessageLevel level, + const String& message, + uint32_t line_number, + uint32_t column_number, + const String& source_id) {} + + /// + /// Called when the page wants to create a new View. + /// + /// This is usually the result of a user clicking a link with target="_blank" + /// or by JavaScript calling window.open(url). + /// + /// To allow creation of these new Views, you should create a new View in + /// this callback (eg, Renderer::CreateView()), resize it to your container, + /// and return it. You are responsible for displaying the returned View. + /// + /// @param caller The View that called this event. + /// + /// @param opener_url The URL of the page that initiated this request. + /// + /// @param target_url The URL that the new View will navigate to. + /// + /// @param is_popup Whether or not this was triggered by window.open(). + /// + /// @param popup_rect Popups can optionally request certain dimensions and + /// coordinates via window.open(). You can choose to + /// respect these or not by resizing/moving the View to + /// this rect. + /// + /// @return Returns a RefPtr<> to a created View to use to satisfy the + /// the request (or return nullptr if you want to block the action). + /// + virtual RefPtr OnCreateChildView(ultralight::View* caller, + const String& opener_url, + const String& target_url, + bool is_popup, + const IntRect& popup_rect); +}; + +/// +/// @brief Interface for Load-related events +/// +/// @note For more info @see View::set_load_listener +/// +class UExport LoadListener { +public: + virtual ~LoadListener() {} + + /// + /// Called when the page begins loading a new URL into a frame. + /// + /// @param frame_id A unique ID for the frame. + /// + /// @param is_main_frame Whether or not this is the main frame. + /// + /// @param url The URL for the load. + /// + virtual void OnBeginLoading(ultralight::View* caller, + uint64_t frame_id, + bool is_main_frame, + const String& url) {} + + /// + /// Called when the page finishes loading a URL into a frame. + /// + /// @param frame_id A unique ID for the frame. + /// + /// @param is_main_frame Whether or not this is the main frame. + /// + /// @param url The URL for the load. + /// + virtual void OnFinishLoading(ultralight::View* caller, + uint64_t frame_id, + bool is_main_frame, + const String& url) {} + + /// + /// Called when an error occurs while loading a URL into a frame. + /// + /// @param frame_id A unique ID for the frame. + /// + /// @param is_main_frame Whether or not this is the main frame. + /// + /// @param url The URL for the load. + /// + /// @param description A human-readable description of the error. + /// + /// @param error_domain The name of the module that triggered the error. + /// + /// @param error_code Internal error code generated by the module. + /// + virtual void OnFailLoading(ultralight::View* caller, + uint64_t frame_id, + bool is_main_frame, + const String& url, + const String& description, + const String& error_domain, + int error_code) {} + + /// + /// Called when the JavaScript window object is reset for a new page load. + /// + /// This is called before any scripts are executed on the page and is the + /// earliest time to setup any initial JavaScript state or bindings. + /// + /// The document is not guaranteed to be loaded/parsed at this point. If + /// you need to make any JavaScript calls that are dependent on DOM elements + /// or scripts on the page, use OnDOMReady instead. + /// + /// The window object is lazily initialized (this will not be called on pages + /// with no scripts). + /// + /// @param frame_id A unique ID for the frame. + /// + /// @param is_main_frame Whether or not this is the main frame. + /// + /// @param url The URL for the load. + /// + virtual void OnWindowObjectReady(ultralight::View* caller, + uint64_t frame_id, + bool is_main_frame, + const String& url) {} + + /// + /// Called when all JavaScript has been parsed and the document is ready. + /// + /// This is the best time to make any JavaScript calls that are dependent on + /// DOM elements or scripts on the page. + /// + /// @param frame_id A unique ID for the frame. + /// + /// @param is_main_frame Whether or not this is the main frame. + /// + /// @param url The URL for the load. + /// + virtual void OnDOMReady(ultralight::View* caller, + uint64_t frame_id, + bool is_main_frame, + const String& url) {} + + /// + /// Called when the session history (back/forward state) is modified. + /// + virtual void OnUpdateHistory(ultralight::View* caller) {} + +}; + +} // namespace ultralight diff --git a/engine/inc/Ultralight/Matrix.h b/engine/inc/Ultralight/Matrix.h new file mode 100644 index 00000000..f3292ada --- /dev/null +++ b/engine/inc/Ultralight/Matrix.h @@ -0,0 +1,190 @@ +/// +/// @file Matrix.h +/// +/// @brief The header for Matrix helpers +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include +#include +#include + +namespace ultralight { + +/// +/// 4x4 Matrix Helper +/// +struct UExport Matrix4x4 { + /// + /// Raw 4x4 matrix as an array + /// + float data[16]; + + /// + /// Set to identity matrix. + /// + void SetIdentity(); +}; + +/// +/// Transformation Matrix helper +/// +struct UExport Matrix { +#if defined(__x86_64__) || defined(_M_X64) +#if defined(_MSC_VER) + __declspec(align(16)) typedef double Aligned4x4[4][4]; +#else + typedef double Aligned4x4[4][4] __attribute__((aligned(16))); +#endif +#else + typedef double Aligned4x4[4][4]; +#endif + + Aligned4x4 data; + + /// + /// Set to identity matrix. + /// + void SetIdentity(); + + /// + /// Set to an orthographic projection matrix suitable for use with our + /// vertex shaders. Optionally flip the y-coordinate space (eg, for OpenGL). + /// + void SetOrthographicProjection(double screen_width, double screen_height, + bool flip_y); + + /// + /// Set to another matrix. + /// + void Set(const Matrix& other); + + /// + /// Set to another matrix. + /// + void Set(const Matrix4x4& other); + + /// + /// Set from raw affine members. + /// + void Set(double a, double b, double c, double d, double e, double f); + + /// + /// Set from raw 4x4 components. + /// + void Set(double m11, double m12, double m13, double m14, + double m21, double m22, double m23, double m24, + double m31, double m32, double m33, double m34, + double m41, double m42, double m43, double m44); + + inline double m11() const { return data[0][0]; } + inline double m12() const { return data[0][1]; } + inline double m13() const { return data[0][2]; } + inline double m14() const { return data[0][3]; } + inline double m21() const { return data[1][0]; } + inline double m22() const { return data[1][1]; } + inline double m23() const { return data[1][2]; } + inline double m24() const { return data[1][3]; } + inline double m31() const { return data[2][0]; } + inline double m32() const { return data[2][1]; } + inline double m33() const { return data[2][2]; } + inline double m34() const { return data[2][3]; } + inline double m41() const { return data[3][0]; } + inline double m42() const { return data[3][1]; } + inline double m43() const { return data[3][2]; } + inline double m44() const { return data[3][3]; } + + inline double a() const { return data[0][0]; } + inline double b() const { return data[0][1]; } + inline double c() const { return data[1][0]; } + inline double d() const { return data[1][1]; } + inline double e() const { return data[3][0]; } + inline double f() const { return data[3][1]; } + + /// + /// Whether or not this is an identity matrix. + /// + bool IsIdentity() const; + + /// + /// Whether or not this is an identity matrix or translation. + /// + bool IsIdentityOrTranslation() const; + + /// + /// Whether or not this matrix uses only affine transformations. + /// + bool IsAffine() const; + + /// + /// Whether or not this is an identity, translation, or non-negative + /// uniform scale. + /// + bool IsSimple() const; + + /// + /// Translate by x and y. + /// + void Translate(double x, double y); + + /// + /// Scale by x and y. + /// + void Scale(double x, double y); + + /// + /// Rotate matrix by theta (in degrees) + /// + void Rotate(double theta); + + /// + /// Rotate matrix by x and y + /// + void Rotate(double x, double y); + + /// + /// Transform (multiply) by another Matrix + /// + void Transform(const Matrix& other); + + /// + /// Get the inverse of this matrix. May return false if not invertible. + /// + bool GetInverse(Matrix& result) const; + + /// + /// Transform point by this matrix and get the result. + /// + Point Apply(const Point& p) const; + + /// + /// Transform rect by this matrix and get the result as an axis-aligned rect. + /// + Rect Apply(const Rect& r) const; + + /// + /// Get an integer hash of this matrix's members. + /// + uint32_t Hash() const; + + /// + /// Get this matrix as unaligned 4x4 float components (for use passing to + /// GPU driver APIs). + /// + Matrix4x4 GetMatrix4x4() const; +}; + +bool UExport operator==(const Matrix& a, const Matrix& b); +bool UExport operator!=(const Matrix& a, const Matrix& b); + +bool UExport operator==(const Matrix4x4& a, const Matrix4x4& b); +bool UExport operator!=(const Matrix4x4& a, const Matrix4x4& b); + +} // namespace ultralight diff --git a/engine/inc/Ultralight/MouseEvent.h b/engine/inc/Ultralight/MouseEvent.h new file mode 100644 index 00000000..9b92f3d0 --- /dev/null +++ b/engine/inc/Ultralight/MouseEvent.h @@ -0,0 +1,77 @@ +/// +/// @file MouseEvent.h +/// +/// @brief The header for the MouseEvent class. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include + +namespace ultralight { + +/// +/// @brief A generic mouse event. +/// +/// @note @see View::FireMouseEvent +/// +class MouseEvent { +public: + /// + /// The various MouseEvent types. + /// + enum Type { + /// + /// Mouse moved type + /// + kType_MouseMoved, + + /// + /// Mouse button pressed type + /// + kType_MouseDown, + + /// + /// Mouse button released type + /// + kType_MouseUp, + }; + + /// + /// The various mouse button types. + /// + enum Button { + kButton_None = 0, + kButton_Left, + kButton_Middle, + kButton_Right, + }; + + /// + /// The type of this MouseEvent + /// + Type type; + + /// + /// The current x-position of the mouse, relative to the View + /// + int x; + + /// + /// The current y-position of the mouse, relative to the View + /// + int y; + + /// + /// The mouse button that was pressed/released, if any. + /// + Button button; +}; + +} // namespace ultralight diff --git a/engine/inc/Ultralight/RefPtr.h b/engine/inc/Ultralight/RefPtr.h new file mode 100644 index 00000000..1859b2aa --- /dev/null +++ b/engine/inc/Ultralight/RefPtr.h @@ -0,0 +1,538 @@ +/// +/// @file RefPtr.h +/// +/// @brief The header for all ref-counting utilities. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +/* +* Portions of the below code are derived from 'RefPtr.h' from Apple's WTF, +* with the following license header: +* +* Copyright (C) 2013-2014 Apple Inc. All rights reserved. +* +* Redistribution and use in source and binary forms, with or without +* modification, are permitted provided that the following conditions +* are met: +* 1. Redistributions of source code must retain the above copyright +* notice, this list of conditions and the following disclaimer. +* 2. Redistributions in binary form must reproduce the above copyright +* notice, this list of conditions and the following disclaimer in the +* documentation and/or other materials provided with the distribution. +* +* THIS SOFTWARE IS PROVIDED BY APPLE INC. AND ITS CONTRIBUTORS ``AS IS'' +* AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, +* THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR +* PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL APPLE INC. OR ITS CONTRIBUTORS +* BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR +* CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF +* SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS +* INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN +* CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) +* ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF +* THE POSSIBILITY OF SUCH DAMAGE. +*/ + +#pragma once +#include +#include +#include + +namespace ultralight { + +/// +/// @brief Interface for all ref-counted objects that will be managed using +/// the Ref<> and RefPtr<> smart pointers. +/// +class UExport RefCounted { + public: + virtual void AddRef() const = 0; + virtual void Release() const = 0; + virtual int ref_count() const = 0; + protected: + virtual ~RefCounted(); +}; + +inline void adopted(const void*) { } + +template class Ref; +template class RefPtr; + +/// +/// @brief Helper for wrapping new objects with the Ref smart pointer. +/// +/// All ref-counted object are created with an initial ref-count of '1'. +/// The AdoptRef() helper returns a Ref without calling AddRef(). +/// This is used for creating new objects, like so: +/// +/// Ref ref = AdoptRef(*new ObjectImpl()); +/// +template Ref AdoptRef(T&); + +/// +/// @brief A non-nullable smart pointer. +/// +/// This smart pointer automatically manages the lifetime of a RefCounted +/// object. Also guarantees that the managed instance is not NULL. +/// +template class Ref { +public: + /// + /// Destroy Ref (wll decrement ref-count by one) + /// + ~Ref() + { + if (instance_) + instance_->Release(); + } + + /// + /// Construct Ref from a reference. (Will increment ref-count by one) + /// + Ref(T& object) + : instance_(&object) + { + instance_->AddRef(); + } + + /// + /// Copy constructor. + /// + Ref(const Ref& other) + : instance_(other.instance_) + { + instance_->AddRef(); + } + + /// + /// Copy constructor with internal type conversion. + /// + template + Ref(Ref& other) + : instance_(other.ptr()) + { + instance_->AddRef(); + } + + /// + /// Copy constructor with internal type conversion. + /// + template + Ref(const Ref& other) + : instance_(other.ptr()) + { + instance_->AddRef(); + } + + /// + /// Move constructor. + /// + Ref(Ref&& other) + : instance_(&other.LeakRef()) + { + assert(instance_); + } + + /// + /// Move constructor. + /// + template + Ref(Ref&& other) + : instance_(&other.LeakRef()) + { + assert(instance_); + } + + Ref& operator=(T& object) + { + assert(instance_); + object.AddRef(); + instance_->Release(); + instance_ = &object; + assert(instance_); + return *this; + } + + Ref& operator=(const Ref& other) + { + assert(instance_); + other.instance_->AddRef(); + instance_->Release(); + instance_ = other.instance_; + assert(instance_); + return *this; + } + + template + Ref& operator=(const Ref& other) + { + assert(instance_); + other.instance_->AddRef(); + instance_->Release(); + instance_ = other.instance_; + assert(instance_); + return *this; + } + + Ref& operator=(Ref&& reference) + { + assert(instance_); + instance_->Release(); + instance_ = &reference.LeakRef(); + assert(instance_); + return *this; + } + + template Ref& operator=(Ref&& reference) + { + assert(instance_); + instance_->Release(); + instance_ = &reference.LeakRef(); + assert(instance_); + return *this; + } + + const T* operator->() const { assert(instance_); return instance_; } + T* operator->() { assert(instance_); return instance_; } + + /// + /// Get a pointer to wrapped object. + /// + const T* ptr() const { assert(instance_); return instance_; } + + /// + /// Get a pointer to wrapped object. + /// + T* ptr() { assert(instance_); return instance_; } + + /// + /// Get a reference to wrapped object. + /// + const T& get() const { assert(instance_); return *instance_; } + + /// + /// Get a reference to wrapped object. + /// + T& get() { assert(instance_); return *instance_; } + + operator T&() { assert(instance_); return *instance_; } + operator const T&() const { assert(instance_); return *instance_; } + + template Ref Replace(Ref&&); + + T& LeakRef() { + assert(instance_); + + T* result = std::move(instance_); + instance_ = std::forward(nullptr); + return *result; + } + + friend inline bool operator==(const Ref& a, const Ref& b) { + return a.instance_ == b.instance_; + } + + friend inline bool operator!=(const Ref& a, const Ref& b) { + return a.instance_ != b.instance_; + } + + friend inline bool operator<(const Ref& a, const Ref& b) { + return a.instance_ < b.instance_; + } + +protected: + friend Ref AdoptRef(T&); + template friend class RefPtr; + + enum AdoptTag { Adopt }; + Ref(T& object, AdoptTag) + : instance_(&object) + { + } + + T* instance_; +}; + +template template Ref Ref::Replace(Ref&& reference) +{ + auto oldReference = AdoptRef(*instance_); + instance_ = &reference.LeakRef(); + return oldReference; +} + +template +Ref AdoptRef(T& reference) +{ + adopted(&reference); + return Ref(reference, Ref::Adopt); +} + +/// +/// @brief A nullable smart pointer. +/// +/// This smart pointer automatically manages the lifetime of a RefCounted +/// object. The managed instance may be NULL. +/// +template class RefPtr { + public: + /// + /// Construct a NULL ref-pointer. + /// + RefPtr() + : instance_(nullptr) + { + } + + /// + /// Construct a NULL ref-pointer. + /// + RefPtr(std::nullptr_t) + : instance_(nullptr) + { + } + + /// + /// Construct from a pointer. (Will increment ref-count by one) + /// + RefPtr(T* other) + : instance_(other) + { + if (instance_) + instance_->AddRef(); + } + + /// + /// Copy constructor. + /// + RefPtr(const RefPtr& other) + : instance_(other.instance_) + { + if (instance_) + instance_->AddRef(); + } + + /// + /// Copy constructor with internal type conversion. + /// + template + RefPtr(const RefPtr& other) + : instance_(other.instance_) + { + if (instance_) + instance_->AddRef(); + } + + /// + /// Move constructor. + /// + RefPtr(RefPtr&& other) + : instance_(other.LeakRef()) + { + } + + /// + /// Move constructor. + /// + template + RefPtr(RefPtr&& other) + : instance_(other.LeakRef()) + { + } + + /// + /// Construct from a Ref + /// + template + RefPtr(const Ref& other) + : instance_(other.instance_) + { + if (instance_) + instance_->AddRef(); + } + + /// + /// Construct by moving from a Ref + /// + template + RefPtr(Ref&& other); + + /// + /// Destroy RefPtr (wll decrement ref-count by one) + /// + ~RefPtr() + { + T* old_value = std::move(instance_); + instance_ = std::forward(nullptr); + if (old_value) + old_value->Release(); + } + + /// + /// Get a pointer to wrapped object. + /// + T* get() const { return instance_; } + + T* LeakRef() { + T* result = std::move(instance_); + instance_ = std::forward(nullptr); + return result; + } + + T& operator*() const { assert(instance_); return *instance_; } + T* operator->() const { return instance_; } + + bool operator!() const { return !instance_; } + + // This conversion operator allows implicit conversion to bool but not to other integer types. + typedef T* (RefPtr::*UnspecifiedBoolType); + operator UnspecifiedBoolType() const { return instance_ ? &RefPtr::instance_ : nullptr; } + + RefPtr& operator=(const RefPtr&); + RefPtr& operator=(T*); + RefPtr& operator=(std::nullptr_t); + template RefPtr& operator=(const RefPtr&); + RefPtr& operator=(RefPtr&&); + template RefPtr& operator=(RefPtr&&); + template RefPtr& operator=(Ref&&); + + friend inline bool operator==(const RefPtr& a, const RefPtr& b) { + return a.instance_ == b.instance_; + } + + friend inline bool operator!=(const RefPtr& a, const RefPtr& b) { + return a.instance_ != b.instance_; + } + + friend inline bool operator<(const RefPtr& a, const RefPtr& b) { + return a.instance_ < b.instance_; + } + + void Swap(RefPtr&); + +private: + T* instance_; +}; + +template +template +RefPtr::RefPtr(Ref&& reference) + : instance_(&reference.LeakRef()) +{ +} + +template +RefPtr& RefPtr::operator=(const RefPtr& other) +{ + RefPtr ptr = other; + Swap(ptr); + return *this; +} + +template +template +RefPtr& RefPtr::operator=(const RefPtr& other) +{ + RefPtr ptr = other; + Swap(ptr); + return *this; +} + +template +RefPtr& RefPtr::operator=(T* object) +{ + RefPtr ptr = object; + Swap(ptr); + return *this; +} + +template +RefPtr& RefPtr::operator=(std::nullptr_t) +{ + T* old_instance = std::move(instance_); + instance_ = std::forward(nullptr); + if (old_instance) + old_instance->Release(); + return *this; +} + +template +RefPtr& RefPtr::operator=(RefPtr&& other) +{ + RefPtr ptr = std::move(other); + Swap(ptr); + return *this; +} + +template +template +RefPtr& RefPtr::operator=(RefPtr&& other) +{ + RefPtr ptr = std::move(other); + Swap(ptr); + return *this; +} + +template +template +RefPtr& RefPtr::operator=(Ref&& other) +{ + RefPtr ptr = std::move(other); + Swap(ptr); + return *this; +} + +template +void RefPtr::Swap(RefPtr& other) +{ + std::swap(instance_, other.instance_); +} + +template +void Swap(RefPtr& a, RefPtr& b) +{ + a.Swap(b); +} + +template +bool operator==(const RefPtr& a, const RefPtr& b) +{ + return a.get() == b.get(); +} + +template +bool operator==(const RefPtr& a, U* b) +{ + return a.get() == b; +} + +template +bool operator==(T* a, const RefPtr& b) +{ + return a == b.get(); +} + +template +bool operator!=(const RefPtr& a, const RefPtr& b) +{ + return a.get() != b.get(); +} + +template +bool operator!=(const RefPtr& a, U* b) +{ + return a.get() != b; +} + +template +bool operator!=(T* a, const RefPtr& b) +{ + return a != b.get(); +} + +} // namespace ultralight diff --git a/engine/inc/Ultralight/RenderTarget.h b/engine/inc/Ultralight/RenderTarget.h new file mode 100644 index 00000000..842f0592 --- /dev/null +++ b/engine/inc/Ultralight/RenderTarget.h @@ -0,0 +1,84 @@ +/// +/// @file RenderTarget.h +/// +/// @brief The header for the RenderTarget struct. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include +#include +#include + +namespace ultralight { + +#pragma pack(push, 1) + +/// +/// @brief Rendering details for a View, to be used with your own GPUDriver +/// +/// When using your own GPUDriver, each View is rendered to an offscreen +/// texture that you can display on a 3D quad in your application. This struct +/// provides all the details you need to display the corresponding texture in +/// your application. +/// +struct UExport RenderTarget { + /// + /// Whether this target is empty (null texture) + /// + bool is_empty; + + /// + /// The viewport width (in device coordinates). + /// + uint32_t width; + + /// + /// The viewport height (in device coordinates). + /// + uint32_t height; + + /// + /// The GPUDriver-specific texture ID (you should bind the texture using + /// your implementation of GPUDriver::BindTexture before drawing a quad). + /// + uint32_t texture_id; + + /// + /// The texture width (in pixels). This may be padded. + /// + uint32_t texture_width; + + /// + /// The texture height (in pixels). This may be padded. + /// + uint32_t texture_height; + + /// + /// The pixel format of the texture. + /// + BitmapFormat texture_format; + + /// + /// UV coordinates of the texture (this is needed because the texture may + /// be padded). + /// + Rect uv_coords; + + /// + /// The GPUDriver-specific render buffer ID. + /// + uint32_t render_buffer_id; + + RenderTarget(); +}; + +#pragma pack(pop) + +} // namespace ultralight diff --git a/engine/inc/Ultralight/Renderer.h b/engine/inc/Ultralight/Renderer.h new file mode 100644 index 00000000..9e6de5a7 --- /dev/null +++ b/engine/inc/Ultralight/Renderer.h @@ -0,0 +1,137 @@ +/// +/// @file Renderer.h +/// +/// @brief The header for the Renderer class. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include +#include +#include +#include + +namespace ultralight { + +/// +/// @brief This singleton manages the lifetime of all Views (@see View) and +/// coordinates painting, network requests, and event dispatch. +/// +/// @note You don't have to create this instance directly if you use the +/// AppCore API. The App class will automatically create a Renderer and +/// perform all rendering within its run loop. @see App::Create +/// +class UExport Renderer : public RefCounted { +public: + /// + /// Create the Ultralight Renderer directly. + /// + /// Unlike App::Create(), this does not use any native windows for drawing + /// and allows you to manage your own runloop and painting. This method is + /// recommended for those wishing to integrate the library into a game. + /// + /// You should set up your Platform config, file-system, font loader, + /// and surface-factories/gpu-drivers before calling this function. + /// (@see ) + /// + /// At a minimum, you will need to define a FontLoader ahead of time or this + /// call will fail. You can use the platform's native FontLoader by calling: + ///
+  ///   /// This function is defined in 
+  ///   Platform::instance().set_font_loader(GetPlatformFontLoader());
+  /// 
+ /// + /// @note You should only create one Renderer per application lifetime. + /// + /// @note: You should not call this if you are using App::Create(), it + /// creates its own renderer and provides default implementations for + /// various platform handlers automatically. + /// + /// @return Renderer is ref-counted. This method returns a ref-pointer + /// to a new instance, you should store it in a RefPtr<> to keep + /// the instance alive. + /// + static Ref Create(); + + /// + /// Create a Session to store local data in (such as cookies, local storage, + /// application cache, indexed db, etc). + /// + /// @note A default, persistent Session is already created for you. You + /// only need to call this if you want to create private, in-memory + /// session or use a separate session for each View. + /// + /// @param is_persistent Whether or not to store the session on disk. + /// Persistent sessions will be written to the path + /// set in Config::cache_path + /// + /// @param name A unique name for this session, this will be used to + /// generate a unique disk path for persistent sessions. + /// + virtual Ref CreateSession(bool is_persistent, const String& name) = 0; + + /// + /// Get the default Session. This session is persistent (backed to disk) and + /// has the name "default". + /// + virtual Ref default_session() = 0; + + /// + /// Create a new View. + /// + /// @param width The initial width, in pixels. + /// + /// @param height The initial height, in pixels. + /// + /// @param transparent Whether or not the view background is transparent. + /// + /// @param session The session to store local data in. Pass a nullptr to + /// use the default session. + /// + /// @return Returns a ref-pointer to a new View instance. You should assign + /// it to either a Ref (non-nullable) or RefPtr + /// (nullable). + /// + virtual Ref CreateView(uint32_t width, uint32_t height, + bool transparent, RefPtr session, + bool force_cpu_renderer = false) = 0; + + /// + /// Update timers and dispatch internal callbacks. You should call this often + /// from your main application loop. + /// + virtual void Update() = 0; + + /// + /// Render all active views to their respective render-targets/surfaces. + /// + /// You should call this once per frame (usually in synchrony with the + /// monitor's refresh rate). + /// + /// @note Views are only repainted if they actually need painting. + /// + virtual void Render() = 0; + + /// + /// Attempt to release as much memory as possible. Don't call this from any + /// callbacks or driver code. + /// + virtual void PurgeMemory() = 0; + + /// + /// Print detailed memory usage statistics to the log. + /// (@see Platform::set_logger()) + /// + virtual void LogMemoryUsage() = 0; + +protected: + virtual ~Renderer(); +}; + +} // namespace ultralight diff --git a/data/entities/gui/mainmenu/sound.json b/engine/inc/Ultralight/RequestHandler.h similarity index 100% rename from data/entities/gui/mainmenu/sound.json rename to engine/inc/Ultralight/RequestHandler.h diff --git a/engine/inc/Ultralight/ScrollEvent.h b/engine/inc/Ultralight/ScrollEvent.h new file mode 100644 index 00000000..a48bea5d --- /dev/null +++ b/engine/inc/Ultralight/ScrollEvent.h @@ -0,0 +1,53 @@ +/// +/// @file ScrollEvent.h +/// +/// @brief The header for the ScrollEvent class. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include + +namespace ultralight { + +/// +/// @brief A generic scroll event. +/// +/// @note @see View::FireScrollEvent +/// +class ScrollEvent { +public: + /// + /// The scroll event granularity type + /// + enum Type { + /// The delta value is interpreted as number of pixels + kType_ScrollByPixel, + + /// The delta value is interpreted as number of pages + kType_ScrollByPage, + }; + + /// + /// Scroll granularity type + /// + Type type; + + /// + /// Horizontal scroll amount + /// + int delta_x; + + /// + /// Vertical scroll amount + /// + int delta_y; +}; + +} // namespace ultralight diff --git a/engine/inc/Ultralight/Session.h b/engine/inc/Ultralight/Session.h new file mode 100644 index 00000000..68819f2d --- /dev/null +++ b/engine/inc/Ultralight/Session.h @@ -0,0 +1,53 @@ +/// +/// @file Session.h +/// +/// @brief The header for the Session class. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include +#include +#include + +namespace ultralight { + +/// +/// @brief A Session stores local data such as cookies, local storage, +/// and application cache for one or more Views. +/// +/// @see Renderer::CreateSession +/// +class UExport Session : public RefCounted { +public: + /// + /// Whether or not this session is written to disk. + /// + virtual bool is_persistent() const = 0; + + /// + /// A unique name identifying this session. + /// + virtual String name() const = 0; + + /// + /// A unique numeric ID identifying this session. + /// + virtual uint64_t id() const = 0; + + /// + /// The disk path of this session (only valid for persistent sessions). + /// + virtual String disk_path() const = 0; + +protected: + virtual ~Session(); +}; + +} // namespace ultralight diff --git a/engine/inc/Ultralight/String.h b/engine/inc/Ultralight/String.h new file mode 100644 index 00000000..0362a91c --- /dev/null +++ b/engine/inc/Ultralight/String.h @@ -0,0 +1,120 @@ +/// +/// @file String.h +/// +/// @brief The header for the String class. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include +#include +#include +#include + +namespace ultralight { + +/// +/// @brief UTF-16 String container with conversions for UTF-8 and UTF-32. +/// +/// @note Internally, all strings are represented as UTF-16. +/// +class UExport String { +public: + /// + /// Create empty string + /// + String(); + + /// + /// Create from null-terminated, ASCII C-string + /// + String(const char* str); + + /// + /// Create from raw, UTF-8 string with certain length + /// + String(const char* str, size_t len); + + /// + /// Create from existing String8 (UTF-8). + /// + String(const String8& str); + + /// + /// Create from raw UTF-16 string with certain length + /// + String(const Char16* str, size_t len); + + /// + /// Create from existing String16 (UTF-16) + /// + String(const String16& str); + + /// + /// Create from existing String32 (UTF-32) + /// + String(const String32& str); + + /// + /// Copy constructor + /// + String(const String& other); + + /// + /// Destructor + /// + ~String(); + + /// + /// Assign string from another, copy is made + /// + String& operator=(const String& other); + + /// + /// Append string with another + /// + String& operator+=(const String& other); + + /// + /// Concatenation operator + /// + inline friend String operator+(String lhs, const String& rhs) { lhs += rhs; return lhs; } + + /// + /// Get native UTF-16 string + /// + String16& utf16() { return str_; } + + /// + /// Get native UTF-16 string + /// + const String16& utf16() const { return str_; } + + /// + /// Convert to UTF-8 string + /// + String8 utf8() const; + + /// + /// Convert to UTF-32 string + /// + String32 utf32() const; + + /// + /// Check if string is empty or not + /// + bool empty() const { return utf16().empty(); } + +private: + String16 str_; +}; + + +} // namespace ultralight + diff --git a/engine/inc/Ultralight/String16.h b/engine/inc/Ultralight/String16.h new file mode 100644 index 00000000..9de8405c --- /dev/null +++ b/engine/inc/Ultralight/String16.h @@ -0,0 +1,130 @@ +/// +/// @file String16.h +/// +/// @brief The header for the String16 class. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include +#include +#include + +namespace ultralight { + +namespace detail { + template struct selector; + template<> struct selector<4> { typedef char16_t Char16; }; + template<> struct selector<2> { typedef wchar_t Char16; }; +} + +#ifdef DISABLE_NATIVE_WCHAR_T +// Force Char16 type to use char16_t, used on Windows when native wchar_t support is disabled. +typedef char16_t Char16; +#else +// We use wchar_t if size == 2, otherwise use char16_t +typedef detail::selector::Char16 Char16; +#endif + +/// +/// @brief A UTF-16 string container. +/// +class UExport String16 { +public: + // Make an empty String16 + String16(); + + // Make a String16 from null-terminated ASCII C-string + String16(const char* c_str); + + // Make a String16 from ASCII C-string with certain length + String16(const char* c_str, size_t len); + + // Make a String16 from raw UTF-16 buffer with certain length + String16(const Char16* str, size_t len); + + // Make a String16 from raw unsigned short UTF-16 buffer with certain length. Useful on Windows + // when native support for wchar_t is disabled (eg, /Zc:wchar_t-). + String16(const unsigned short* str, size_t len); + + // Make a deep copy of String16 + String16(const String16& other); + + ~String16(); + + // Assign a String16 to this one, deep copy is made + String16& operator=(const String16& other); + + // Append a String16 to this one. + String16& operator+=(const String16& other); + + // Concatenation operator + inline friend String16 operator+(String16 lhs, const String16& rhs) { lhs += rhs; return lhs; } + + // Get raw UTF-16 data + Char16* data() { return data_; } + + // Get raw UTF-16 data (const) + const Char16* data() const { return data_; } + + // Get raw UTF-16 data as unsigned short. This is useful on Windows if you compile without native + // support for wchar_t (eg, /Zc:wchar_t-) + unsigned short* udata() { return reinterpret_cast(data_); } + + // Get raw UTF-16 data as unsigned short (const). + const unsigned short* udata() const { return reinterpret_cast(data_); } + + // Get length in characters. + size_t length() const { return length_; } + + // Get size in characters (synonym for length) + size_t size() const { return length_; } + + // Check if string is empty. + bool empty() const { return !data_ || length_ == 0; } + + // Get character at specific position + Char16& operator[](size_t pos) { return data_[pos]; } + + // Get character at specific position (const) + const Char16& operator[](size_t pos) const { return data_[pos]; } + +private: + Char16* data_; + size_t length_; +}; + +/// +/// @brief A UTF-16 string vector. +/// +class UExport String16Vector : public RefCounted { +public: + // Create an empty string vector + static Ref Create(); + + // Create a string vector from an existing array (a deep copy is made) + static Ref Create(const String16* stringArray, size_t len); + + // Add an element to the back of the string vector + virtual void push_back(const String16& val) = 0; + + // Get raw String16 vector array + virtual String16* data() = 0; + + // Get the number of elements in vector + virtual size_t size() const = 0; + +protected: + String16Vector(); + virtual ~String16Vector(); + String16Vector(const String16Vector&); + void operator=(const String16Vector&); +}; + +} // namespace ultralight diff --git a/engine/inc/Ultralight/String32.h b/engine/inc/Ultralight/String32.h new file mode 100644 index 00000000..21738264 --- /dev/null +++ b/engine/inc/Ultralight/String32.h @@ -0,0 +1,71 @@ +/// +/// @file String32.h +/// +/// @brief The header for the String32 class. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include +#include + +namespace ultralight { + +/// +/// @brief A UTF-32 string container. +/// +class UExport String32 { +public: + // Make an empty String32 + String32(); + + // Make a String32 from raw UTF-32 string with certain length + String32(const char32_t* c_str, size_t len); + + // Make a deep copy of String32 + String32(const String32& other); + + ~String32(); + + // Assign a String32 to this one, deep copy is made + String32& operator=(const String32& other); + + // Append a String32 to this one. + String32& operator+=(const String32& other); + + // Concatenation operator + inline friend String32 operator+(String32 lhs, const String32& rhs) { lhs += rhs; return lhs; } + + // Get raw UTF-32 data + char32_t* data() { return data_; } + + // Get raw UTF-32 data (const) + const char32_t* data() const { return data_; } + + // Get length in characters. + size_t length() const { return length_; } + + // Get size in characters (synonym for length) + size_t size() const { return length_; } + + // Check if string is empty. + bool empty() const { return !data_ || length_ == 0; } + + // Get character at specific position + char32_t& operator[](size_t pos) { return data_[pos]; } + + // Get character at specific position (const) + const char32_t& operator[](size_t pos) const { return data_[pos]; } + +private: + char32_t* data_; + size_t length_; +}; + +} // namespace ultralight diff --git a/engine/inc/Ultralight/String8.h b/engine/inc/Ultralight/String8.h new file mode 100644 index 00000000..f83d75b2 --- /dev/null +++ b/engine/inc/Ultralight/String8.h @@ -0,0 +1,74 @@ +/// +/// @file String8.h +/// +/// @brief The header for the String8 class. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include +#include + +namespace ultralight { + +/// +/// @brief A UTF-8 string container. +// +class UExport String8 { +public: + // Make an empty String8 + String8(); + + // Make a String8 from raw, null-terminated UTF-8 string + String8(const char* c_str); + + // Make a String8 from raw UTF-8 string with certain length + String8(const char* c_str, size_t len); + + // Make a deep copy of String8 + String8(const String8& other); + + ~String8(); + + // Assign a String8 to this one, deep copy is made + String8& operator=(const String8& other); + + // Append a String8 to this one. + String8& operator+=(const String8& other); + + // Concatenation operator + inline friend String8 operator+(String8 lhs, const String8& rhs) { lhs += rhs; return lhs; } + + // Get raw UTF-8 data + char* data() { return data_; } + + // Get raw UTF-8 data (const) + const char* data() const { return data_; } + + // Get length in characters. + size_t length() const { return length_; } + + // Get size in characters (synonym for length) + size_t size() const { return length_; } + + // Check if string is empty. + bool empty() const { return !data_ || length_ == 0; } + + // Get character at specific position + char& operator[](size_t pos) { return data_[pos]; } + + // Get character at specific position (const) + const char& operator[](size_t pos) const { return data_[pos]; } + +private: + char* data_; + size_t length_; +}; + +} // namespace ultralight diff --git a/engine/inc/Ultralight/Ultralight.h b/engine/inc/Ultralight/Ultralight.h new file mode 100644 index 00000000..6db2c6e1 --- /dev/null +++ b/engine/inc/Ultralight/Ultralight.h @@ -0,0 +1,29 @@ +// Copyright 2020 Ultralight, Inc. All rights reserved. +#pragma once +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include diff --git a/engine/inc/Ultralight/View.h b/engine/inc/Ultralight/View.h new file mode 100644 index 00000000..c56c5b8e --- /dev/null +++ b/engine/inc/Ultralight/View.h @@ -0,0 +1,307 @@ +/// +/// @file View.h +/// +/// @brief The header for the View class. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include + +namespace ultralight { + +/// +/// @brief The View class is used to load and display web content. +/// +/// View is an offscreen web-page container that can be used to display +/// web-content in your application. +/// +/// You can load content into a View via View::LoadURL() or View::LoadHTML() +/// and interact with it via View::FireMouseEvent() and similar API. +/// +/// When displaying a View, the API is different depending on whether you +/// are using the CPU renderer or the GPU renderer: +/// +/// When using the CPU renderer, you would get the underlying pixel-buffer +/// surface for a View via View::surface(). +/// +/// When using the GPU renderer, you would get the underlying render target +/// and texture information via View::render_target(). +/// +/// @note The API is not currently thread-safe, all calls must be made on the +/// same thread that the Renderer/App was created on. +/// +class UExport View : public RefCounted { +public: + /// + /// Get the URL of the current page loaded into this View, if any. + /// + virtual String url() = 0; + + /// + /// Get the title of the current page loaded into this View, if any. + /// + virtual String title() = 0; + + /// + /// Get the width of the View, in pixels. + /// + virtual uint32_t width() const = 0; + + /// + /// Get the height of the View, in pixels. + /// + virtual uint32_t height() const = 0; + + /// + /// Check if the main frame of the page is currently loading. + /// + virtual bool is_loading() = 0; + + /// + /// Get the offscreen RenderTarget for the View. + /// + /// @note Only valid when the GPU renderer is enabled in Config. + /// + /// You can use this with your GPUDriver implementation to bind + /// and display the corresponding texture in your application. + /// + virtual RenderTarget render_target() = 0; + + /// + /// Get the offscreen Surface for the View (pixel-buffer container). + /// + /// @note Only valid when the CPU is enabled (will return a nullptr + /// otherwise) + /// + /// The default Surface is BitmapSurface but you can provide your + /// own Surface implementation via Platform::set_surface_factory. + /// + virtual Surface* surface() = 0; + + /// + /// Load a raw string of HTML, the View will navigate to it as a new page. + /// + /// @param html The raw HTML string to load. + /// + /// @param url An optional URL for this load (to make it appear as if we + /// we loaded this HTML from a certain URL). Can be used for + /// resolving relative URLs and cross-origin rules. + /// + /// @param add_to_history Whether or not this load should be added to the + /// session's history (back/forward list). + /// + virtual void LoadHTML(const String& html, + const String& url = "", + bool add_to_history = false) = 0; + + /// + /// Load a URL, the View will navigate to it as a new page. + /// + /// @note You can use File URLs (eg, file:///page.html) but you must define + /// your own FileSystem implementation if you are not using AppCore. + /// @see Platform::set_file_system + /// + virtual void LoadURL(const String& url) = 0; + + /// + /// Resize View to a certain size. + /// + /// @param width The initial width, in pixels. + /// + /// @param height The initial height, in pixels. + /// + /// + virtual void Resize(uint32_t width, uint32_t height) = 0; + + /// + /// Acquire the page's JSContext for use with the JavaScriptCore API + /// + /// @note You can use the underlying JSContextRef with the JavaScriptCore + /// C API. This allows you to marshall C/C++ objects to/from + /// JavaScript, bind callbacks, and call JS functions directly. + /// + /// @note The JSContextRef gets reset after each page navigation. You + /// should initialize your JavaScript state within the + /// OnWindowObjectReady and OnDOMReady events, @see ViewListener. + /// + /// @note This call locks the internal context for the current thread. + /// It will be unlocked when the returned JSContext's ref-count goes + /// to zero. The lock is recursive, you can call this multiple times. + /// + virtual Ref LockJSContext() = 0; + + /// + /// Helper function to evaluate a raw string of JavaScript and return the + /// result as a String. + /// + /// @param script A string of JavaScript to evaluate in the main frame. + /// + /// @param exception A string to store the exception in, if any. Pass a + /// nullptr if you don't care about exceptions. + /// + /// @return Returns the JavaScript result typecast to a String. + /// + /// + /// @note You do not need to lock the JS context, it is done automatically. + /// + /// @note If you need lower-level access to native JavaScript values, you + /// should instead lock the JS context and call JSEvaluateScript() in + /// the JavaScriptCore C API. @see + /// + virtual String EvaluateScript(const String& script, String* exception = nullptr) = 0; + + /// + /// Whether or not we can navigate backwards in history + /// + virtual bool CanGoBack() = 0; + + /// + /// Whether or not we can navigate forwards in history + /// + virtual bool CanGoForward() = 0; + + /// + /// Navigate backwards in history + /// + virtual void GoBack() = 0; + + /// + /// Navigate forwards in history + /// + virtual void GoForward() = 0; + + /// + /// Navigate to an arbitrary offset in history + /// + virtual void GoToHistoryOffset(int offset) = 0; + + /// + /// Reload current page + /// + virtual void Reload() = 0; + + /// + /// Stop all page loads + /// + virtual void Stop() = 0; + + /// + /// Give focus to the View. + /// + /// You should call this to give visual indication that the View has input + /// focus (changes active text selection colors, for example). + /// + virtual void Focus() = 0; + + /// + /// Remove focus from the View and unfocus any focused input elements. + /// + /// You should call this to give visual indication that the View has lost + /// input focus. + /// + virtual void Unfocus() = 0; + + /// + /// Whether or not the View has focus. + /// + virtual bool HasFocus() = 0; + + /// + /// Whether or not the View has an input element with visible keyboard focus + /// (indicated by a blinking caret). + /// + /// You can use this to decide whether or not the View should consume + /// keyboard input events (useful in games with mixed UI and key handling). + /// + virtual bool HasInputFocus() = 0; + + /// + /// Fire a keyboard event + /// + /// @note Only 'Char' events actually generate text in input fields. + /// + virtual void FireKeyEvent(const KeyEvent& evt) = 0; + + /// + /// Fire a mouse event + /// + virtual void FireMouseEvent(const MouseEvent& evt) = 0; + + /// + /// Fire a scroll event + /// + virtual void FireScrollEvent(const ScrollEvent& evt) = 0; + + /// + /// Set a ViewListener to receive callbacks for View-related events. + /// + /// @note Ownership remains with the caller. + /// + virtual void set_view_listener(ViewListener* listener) = 0; + + /// + /// Get the active ViewListener, if any + /// + virtual ViewListener* view_listener() const = 0; + + /// + /// Set a LoadListener to receive callbacks for Load-related events. + /// + /// @note Ownership remains with the caller. + /// + virtual void set_load_listener(LoadListener* listener) = 0; + + /// + /// Get the active LoadListener, if any + /// + virtual LoadListener* load_listener() const = 0; + + /// + /// Set whether or not this View should be repainted during the next + /// call to Renderer::Render + /// + /// @note This flag is automatically set whenever the page content changes + /// but you can set it directly in case you need to force a repaint. + /// + virtual void set_needs_paint(bool needs_paint) = 0; + + /// + /// Whether or not this View should be repainted during the next call to + /// Renderer::Render. + /// + virtual bool needs_paint() const = 0; + + /// + /// Get the inspector for this View, this is useful for debugging and + /// inspecting pages locally. This will only succeed if you have the + /// inspector assets in your filesystem-- the inspector will look for + /// file:///inspector/Main.html when it first loads. + /// + /// @note The inspector View is owned by the View and lazily-created on + /// first call. The initial dimensions are 10x10, you should call + /// View::Resize() on the returned View to resize it to your desired + /// dimensions. + /// + virtual RefPtr inspector() = 0; + +protected: + virtual ~View(); +}; + +} // namespace ultralight diff --git a/engine/inc/Ultralight/platform/Clipboard.h b/engine/inc/Ultralight/platform/Clipboard.h new file mode 100644 index 00000000..a5a35cc0 --- /dev/null +++ b/engine/inc/Ultralight/platform/Clipboard.h @@ -0,0 +1,51 @@ +/// +/// @file Clipboard.h +/// +/// @brief The header for the Clipboard interface. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include +#include + +namespace ultralight { + +/// +/// @brief Clipboard interface. +/// +/// This is used for reading and writing data to the platform Clipboard. +/// +/// AppCore automatically provides a platform-specific implementation of this +/// that cuts/copies/pastes to the OS clipboard when you call App::Create(). +/// +/// If you are using Renderer::Create() instead, you will need to provide your +/// own implementation of this. @see Platform::set_clipboard(). +/// +class UExport Clipboard { +public: + virtual ~Clipboard(); + + /// + /// Clear the clipboard. + /// + virtual void Clear() = 0; + + /// + /// Read plain text from the clipboard + /// + virtual String16 ReadPlainText() = 0; + + /// + /// Write plain text to the clipboard. + /// + virtual void WritePlainText(const String16& text) = 0; +}; + +} // namespace ultralight diff --git a/engine/inc/Ultralight/platform/Config.h b/engine/inc/Ultralight/platform/Config.h new file mode 100644 index 00000000..b5c2f9a3 --- /dev/null +++ b/engine/inc/Ultralight/platform/Config.h @@ -0,0 +1,230 @@ +/// +/// @file Config.h +/// +/// @brief The header for the Config struct. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include +#include + +namespace ultralight { + +/// +/// The winding order for front-facing triangles. (This is only used when the +/// GPU renderer is enabled) +/// +/// @note In most 3D engines, there is the concept that triangles have a +/// a "front" and a "back". All the front-facing triangles (eg, those +/// that are facing the camera) are rendered, and all back-facing +/// triangles are culled (ignored). The winding-order of the triangle's +/// vertices is used to determine which side is front and back. You +/// should tell Ultralight which winding-order your 3D engine uses. +/// +enum FaceWinding { + /// + /// Clockwise Winding (Direct3D, etc.) + /// + kFaceWinding_Clockwise, + + /// + /// Counter-Clockwise Winding (OpenGL, etc.) + /// + kFaceWinding_CounterClockwise, +}; + +enum FontHinting { + /// + /// Lighter hinting algorithm-- glyphs are slightly fuzzier but better + /// resemble their original shape. This is achieved by snapping glyphs to the + /// pixel grid only vertically which better preserves inter-glyph spacing. + /// + kFontHinting_Smooth, + + /// + /// Default hinting algorithm-- offers a good balance between sharpness and + /// shape at smaller font sizes. + /// + kFontHinting_Normal, + + /// + /// Strongest hinting algorithm-- outputs only black/white glyphs. The result + /// is usually unpleasant if the underlying TTF does not contain hints for + /// this type of rendering. + /// + kFontHinting_Monochrome, +}; + +/// +/// @brief Configuration settings for Ultralight. +/// +/// This is intended to be implemented by users and defined before creating the +/// Renderer. @see Platform::set_config. +/// +struct UExport Config { + /// + /// The file path to the directory that contains Ultralight's bundled + /// resources (eg, cacert.pem and other localized resources). + /// + String16 resource_path; + + /// + /// The file path to a writable directory that will be used to store cookies, + /// cached resources, and other persistent data. + /// + String16 cache_path; + + /// + /// When enabled, each View will be rendered to an offscreen GPU texture + /// using the GPU driver set in Platform::set_gpu_driver. You can fetch + /// details for the texture via View::render_target. + /// + /// When disabled (the default), each View will be rendered to an offscreen + /// pixel buffer. This pixel buffer can optionally be provided by the user-- + /// for more info see and View::surface. + /// + bool use_gpu_renderer = false; + + /// + /// The amount that the application DPI has been scaled (200% = 2.0). + /// This should match the device scale set for the current monitor. + /// + /// Note: Device scales are rounded to nearest 1/8th (eg, 0.125). + /// + double device_scale = 1.0; + + /// + /// The winding order for front-facing triangles. @see FaceWinding + /// + /// Note: This is only used when the GPU renderer is enabled. + /// + FaceWinding face_winding = kFaceWinding_CounterClockwise; + + /// + /// Whether or not images should be enabled. + /// + bool enable_images = true; + + /// + /// Whether or not JavaScript should be enabled. + /// + bool enable_javascript = true; + + /// + /// The hinting algorithm to use when rendering fonts. @see FontHinting + /// + FontHinting font_hinting = kFontHinting_Normal; + + /// + /// The gamma to use when compositing font glyphs, change this value to + /// adjust contrast (Adobe and Apple prefer 1.8, others may prefer 2.2). + /// + double font_gamma = 1.8; + + /// + /// Default font-family to use. + /// + String16 font_family_standard = "Times New Roman"; + + /// + /// Default font-family to use for fixed fonts. (pre/code) + /// + String16 font_family_fixed = "Courier New"; + + /// + /// Default font-family to use for serif fonts. + /// + String16 font_family_serif = "Times New Roman"; + + /// + /// Default font-family to use for sans-serif fonts. + /// + String16 font_family_sans_serif = "Arial"; + + /// + /// Default user-agent string. + /// + String16 user_agent = "Mozilla/5.0 (Windows NT 10.0; Win64; x64) " + "AppleWebKit/608.3.10 (KHTML, like Gecko) " + "Ultralight/1.2.0 Safari/608.3.10"; + + /// + /// Default user stylesheet. You should set this to your own custom CSS + /// string to define default styles for various DOM elements, scrollbars, + /// and platform input widgets. + /// + String16 user_stylesheet; + + /// + /// Whether or not we should continuously repaint any Views or compositor + /// layers, regardless if they are dirty or not. This is mainly used to + /// diagnose painting/shader issues. + /// + bool force_repaint = false; + + /// + /// When a CSS animation is active, the amount of time (in seconds) to wait + /// before triggering another repaint. Default is 60 Hz. + /// + double animation_timer_delay = 1.0 / 60.0; + + /// + /// When a smooth scroll animation is active, the amount of time (in seconds) + /// to wait before triggering another repaint. Default is 60 Hz. + /// + double scroll_timer_delay = 1.0 / 60.0; + + /// + /// The amount of time (in seconds) to wait before running the recycler (will + /// attempt to return excess memory back to the system). + /// + double recycle_delay = 4.0; + + /// + /// Size of WebCore's memory cache in bytes. + /// + /// @note You should increase this if you anticipate handling pages with + /// large resources, Safari typically uses 128+ MiB for its cache. + /// + uint32_t memory_cache_size = 64 * 1024 * 1024; + + /// + /// Number of pages to keep in the cache. Defaults to 0 (none). + /// + /// @note Safari typically caches about 5 pages and maintains an on-disk + /// cache to support typical web-browsing activities. If you increase + /// this, you should probably increase the memory cache size as well. + /// + uint32_t page_cache_size = 0; + + /// + /// JavaScriptCore tries to detect the system's physical RAM size to set + /// reasonable allocation limits. Set this to anything other than 0 to + /// override the detected value. Size is in bytes. + /// + /// This can be used to force JavaScriptCore to be more conservative with + /// its allocation strategy (at the cost of some performance). + /// + uint32_t override_ram_size = 0; + + /// + /// The minimum size of large VM heaps in JavaScriptCore. Set this to a + /// lower value to make these heaps start with a smaller initial value. + /// + uint32_t min_large_heap_size = 32 * 1024 * 1024; + + /// + /// The minimum size of small VM heaps in JavaScriptCore. Set this to a + /// lower value to make these heaps start with a smaller initial value. + /// + uint32_t min_small_heap_size = 1 * 1024 * 1024; +}; + +} // namespace ultralight diff --git a/engine/inc/Ultralight/platform/FileSystem.h b/engine/inc/Ultralight/platform/FileSystem.h new file mode 100644 index 00000000..19b6d9a2 --- /dev/null +++ b/engine/inc/Ultralight/platform/FileSystem.h @@ -0,0 +1,93 @@ +/// +/// @file FileSystem.h +/// +/// @brief The header for the FileSystem interface. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include +#include + +namespace ultralight { + +/// +/// File Handle type used as unique ID for opened files. +/// +#if defined(__WIN32__) || defined(_WIN32) +typedef size_t FileHandle; +#else +typedef int FileHandle; +#endif + +/// +/// Handle used to denote an invalid file. +/// +const FileHandle invalidFileHandle = (FileHandle)-1; + +/// +/// @brief FileSystem interface. +/// +/// This is used for loading File URLs (eg, ). +/// +/// You can provide the library with your own FileSystem implementation so that +/// file assets are loaded from your own pipeline (useful if you would like +/// to encrypt/compress your file assets or ship it in a custom format). +/// +/// AppCore automatically provides a platform-specific implementation of this +/// that loads files from a local directory when you call App::Create(). +/// +/// If you are using Renderer::Create() instead, you will need to provide your +/// own implementation via `Platform::instance().set_file_system(). For +/// convenience, you can still use AppCore's file system implementation-- +/// see the helper functions defined in . +/// +/// To provide your own custom FileSystem implementation, you should inherit +/// from this class, handle the virtual member functions, and then pass an +/// instance of your class to `Platform::instance().set_file_system()` before +/// calling Renderer::Create() or App::Create(). +/// +class UExport FileSystem { +public: + virtual ~FileSystem(); + + /// + /// Check if file path exists, return true if exists. + /// + virtual bool FileExists(const String16& path) = 0; + + /// + /// Get file size of previously opened file, store result in 'result'. Return true on success. + /// + virtual bool GetFileSize(FileHandle handle, int64_t& result) = 0; + + /// + /// Get file mime type (eg "text/html"), store result in 'result'. Return true on success. + /// + virtual bool GetFileMimeType(const String16& path, String16& result) = 0; + + /// + /// Open file path for reading or writing. Return file handle on success, or invalidFileHandle on failure. + /// + /// @NOTE: As of this writing (v1.2), this function is only used for reading. + /// + virtual FileHandle OpenFile(const String16& path, bool open_for_writing) = 0; + + /// + /// Close previously-opened file. + /// + virtual void CloseFile(FileHandle& handle) = 0; + + /// + /// Read from currently-opened file, return number of bytes read or -1 on failure. + /// + virtual int64_t ReadFromFile(FileHandle handle, char* data, int64_t length) = 0; +}; + +} // namespace ultralight diff --git a/engine/inc/Ultralight/platform/FontLoader.h b/engine/inc/Ultralight/platform/FontLoader.h new file mode 100644 index 00000000..ccda81d9 --- /dev/null +++ b/engine/inc/Ultralight/platform/FontLoader.h @@ -0,0 +1,132 @@ +/// +/// @file FontLoader.h +/// +/// @brief The header for the FontLoader interface. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include +#include +#include + +namespace ultralight { + +/// +/// Represents a font file, either on-disk path or in-memory file contents. +/// +class UExport FontFile : public RefCounted { +public: + /// + /// Create a font file from an on-disk file path. + /// + /// @note The file path should already exist. + /// + static Ref Create(const String16& filepath); + + /// + /// Create a font file from an in-memory buffer. + /// + static Ref Create(Ref buffer); + + /// + /// Whether or not this font file was created from an in-memory buffer. + /// + virtual bool is_in_memory() const = 0; + + /// + /// The file path (if any). + /// + virtual String16 filepath() const = 0; + + /// + /// The in-memory buffer (if any). + /// + virtual RefPtr buffer() const = 0; + + /// + /// Unique hash (if this is a filepath, only the path string is hashed). + /// + virtual uint32_t hash() const = 0; + +protected: + FontFile(); + virtual ~FontFile(); + FontFile(const FontFile&); + void operator=(const FontFile&); +}; + +/// +/// @brief Font Loader interface, used for all font lookup operations. +/// +/// Every operating system has its own library of installed system fonts. The +/// FontLoader interface is used to lookup these fonts and fetch the actual +/// font data (raw TTF/OTF file data) for a given a certain font description. +/// +/// AppCore automatically provides a platform-specific implementation of this +/// that loads installed fonts from the OS when you call App::Create(). +/// +/// If you are using Renderer::Create() instead, you will need to provide your +/// own implementation via `Platform::instance().set_font_loader(). For +/// convenience, you can still use AppCore's font loader implementation-- +/// see the helper functions defined in . +/// +/// To provide your own custom FontLoader implementation, you should inherit +/// from this class, handle the virtual member functions, and then pass an +/// instance of your class to `Platform::instance().set_font_loader()` before +/// calling Renderer::Create() or App::Create(). +/// +class UExport FontLoader { +public: + virtual ~FontLoader(); + + /// + /// Fallback font family name. Will be used if all other fonts fail to load. + /// + /// @note This font should be guaranteed to exist (eg, FontLoader::Load + /// won't fail when passed this font family name). + /// + virtual String16 fallback_font() const = 0; + + /// + /// Fallback font family name that can render the specified characters. This + /// is mainly used to support CJK (Chinese, Japanese, Korean) text display. + /// + /// @param characters One or more UTF-16 characters. This is almost always + /// a single character. + /// + /// @param weight Font weight. + /// + /// @param italic Whether or not italic is requested. + /// + /// @return Should return a font family name that can render the text. + /// + virtual String16 fallback_font_for_characters(const String16& characters, + int weight, + bool italic) const = 0; + + /// + /// Get the actual font file data (TTF/OTF) for a given font description. + /// + /// @param family Font family name. + /// + /// @param weight Font weight. + /// + /// @param italic Whether or not italic is requested. + /// + /// @return A font file matching the given description (either an on-disk + /// font filepath or an in-memory file contents). You can return + /// NULL here and the loader will fallback to another font. + /// + virtual RefPtr Load(const String16& family, + int weight, + bool italic) = 0; +}; + +} // namespace ultralight diff --git a/engine/inc/Ultralight/platform/GPUDriver.h b/engine/inc/Ultralight/platform/GPUDriver.h new file mode 100644 index 00000000..902f8925 --- /dev/null +++ b/engine/inc/Ultralight/platform/GPUDriver.h @@ -0,0 +1,288 @@ +/// +/// @file GPUDriver.h +/// +/// @brief The header for the GPUDriver interface. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#pragma warning(disable: 4251) +#include +#include +#include +#include + +namespace ultralight { + +/// +/// @note This pragma pack(push, 1) command is important! Vertex layouts +/// should not be padded with any bytes. +/// +#pragma pack(push, 1) + +/// +/// RenderBuffer description, @see GPUDriver::CreateRenderBuffer. +/// +struct UExport RenderBuffer { + uint32_t texture_id; // The backing texture for this RenderBuffer + uint32_t width; // The width of the RenderBuffer texture + uint32_t height; // The height of the RenderBuffer texture + bool has_stencil_buffer; // Currently unused, always false. + bool has_depth_buffer; // Currently unsued, always false. +}; + +/// +/// Vertex layout for path vertices, useful for synthesizing or modifying +/// vertex data. +/// +struct Vertex_2f_4ub_2f { + float pos[2]; + unsigned char color[4]; + float obj[2]; +}; + +/// +/// Vertex layout for quad vertices, useful for synthesizing or modifying +/// vertex data. +/// +struct Vertex_2f_4ub_2f_2f_28f { + float pos[2]; + unsigned char color[4]; + float tex[2]; + float obj[2]; + float data0[4]; + float data1[4]; + float data2[4]; + float data3[4]; + float data4[4]; + float data5[4]; + float data6[4]; +}; + +/// +/// Vertex formats +/// +enum UExport VertexBufferFormat { + kVertexBufferFormat_2f_4ub_2f, + kVertexBufferFormat_2f_4ub_2f_2f_28f, +}; + +/// +/// Vertex buffer, @see GPUDriver::CreateGeometry +/// +struct UExport VertexBuffer { + VertexBufferFormat format; + uint32_t size; + uint8_t* data; +}; + +/// +/// Vertex index type +/// +typedef uint32_t IndexType; + +/// +/// Vertex index buffer, @see GPUDriver::CreateGeometry +/// +struct UExport IndexBuffer { + uint32_t size; + uint8_t* data; +}; + +/// +/// Shader types, used by GPUState::shader_type +/// +/// Each of these correspond to a vertex/pixel shader pair. You can find +/// stock shader code for these in the `shaders` folder of the AppCore repo. +/// +enum UExport ShaderType { + kShaderType_Fill, // Shader program for quad geometry + kShaderType_FillPath, // Shader program for path geometry +}; + +/// +/// GPU state description. +/// +struct UExport GPUState { + /// Viewport width in pixels + uint32_t viewport_width; + + /// Viewport height in pixels + uint32_t viewport_height; + + /// Transform matrix-- you should multiply this with the screen-space + /// orthographic projection matrix then pass to the vertex shader. + Matrix4x4 transform; + + /// Whether or not we should enable texturing for the current draw command. + bool enable_texturing; + + /// Whether or not we should enable blending for the current draw command. + /// If blending is disabled, any drawn pixels should overwrite existing. + /// Mainly used so we can modify alpha values of the RenderBuffer during + /// scissored clears. + bool enable_blend; + + /// The vertex/pixel shader program pair to use for the current draw command. + /// You should cast this to ShaderType to get the corresponding enum. + uint8_t shader_type; + + /// The render buffer to use for the current draw command. + uint32_t render_buffer_id; + + /// The texture id to bind to slot #1. (Will be 0 if none) + uint32_t texture_1_id; + + /// The texture id to bind to slot #2. (Will be 0 if none) + uint32_t texture_2_id; + + /// The texture id to bind to slot #3. (Will be 0 if none) + uint32_t texture_3_id; + + /// The following four members are passed to the pixel shader via uniforms. + float uniform_scalar[8]; + vec4 uniform_vector[8]; + uint8_t clip_size; + Matrix4x4 clip[8]; + + /// Whether or not scissor testing should be used for the current draw command. + bool enable_scissor; + + /// The scissor rect to use for scissor testing (units in pixels) + IntRect scissor_rect; +}; + +/// +/// Command types, used by Command::command_type +/// +enum UExport CommandType { + kCommandType_ClearRenderBuffer, + kCommandType_DrawGeometry, +}; + +/// +/// Command description. +/// +struct UExport Command { + uint8_t command_type; // The type of command to dispatch. + GPUState gpu_state; // GPU state parameters for current command. + + /// The following members are only used with kCommandType_DrawGeometry + uint32_t geometry_id; // The geometry ID to bind + uint32_t indices_count; // The number of indices + uint32_t indices_offset; // The index to start from +}; + +/// +/// Command list, @see GPUDriver::UpdateCommandList +/// +struct UExport CommandList { + uint32_t size; + Command* commands; +}; + +#pragma pack(pop) + +/// +/// @brief GPUDriver interface, dispatches GPU calls to the native driver. +/// +/// This is automatically provided for you when you use App::Create(), AppCore +/// provides platform-specific implementations of GPUDriver for each OS. +/// +/// If you are using Renderer::Create(), you will need to provide your own +/// implementation of this class if you have enabled the GPU renderer in the +/// Config. @see Platform::set_gpu_driver +/// +class UExport GPUDriver { +public: + virtual ~GPUDriver(); + + /// + /// Called before any commands are dispatched during a frame. + /// + virtual void BeginSynchronize() = 0; + + /// + /// Called after any commands are dispatched during a frame. + /// + virtual void EndSynchronize() = 0; + + /// + /// Get the next available texture ID. + /// + virtual uint32_t NextTextureId() = 0; + + /// + /// Create a texture with a certain ID and optional bitmap. + /// + /// **NOTE**: If the Bitmap is empty (Bitmap::IsEmpty), then a RTT Texture + /// should be created instead. This will be used as a backing + /// texture for a new RenderBuffer. + /// + virtual void CreateTexture(uint32_t texture_id, + Ref bitmap) = 0; + + /// + /// Update an existing non-RTT texture with new bitmap data. + /// + virtual void UpdateTexture(uint32_t texture_id, + Ref bitmap) = 0; + + /// + /// Destroy a texture. + /// + virtual void DestroyTexture(uint32_t texture_id) = 0; + + /// + /// Generate the next available render buffer ID. + /// + virtual uint32_t NextRenderBufferId() = 0; + + /// + /// Create a render buffer with certain ID and buffer description. + /// + virtual void CreateRenderBuffer(uint32_t render_buffer_id, + const RenderBuffer& buffer) = 0; + + /// + /// Destroy a render buffer + /// + virtual void DestroyRenderBuffer(uint32_t render_buffer_id) = 0; + + /// + /// Generate the next available geometry ID. + /// + virtual uint32_t NextGeometryId() = 0; + + /// + /// Create geometry with certain ID and vertex/index data. + /// + virtual void CreateGeometry(uint32_t geometry_id, + const VertexBuffer& vertices, + const IndexBuffer& indices) = 0; + + /// + /// Update existing geometry with new vertex/index data. + /// + virtual void UpdateGeometry(uint32_t geometry_id, + const VertexBuffer& vertices, + const IndexBuffer& indices) = 0; + + /// + /// Destroy geometry. + /// + virtual void DestroyGeometry(uint32_t geometry_id) = 0; + + /// + /// Update command list (you should copy the commands to your own structure). + /// + virtual void UpdateCommandList(const CommandList& list) = 0; +}; + +} // namespace ultralight diff --git a/engine/inc/Ultralight/platform/Logger.h b/engine/inc/Ultralight/platform/Logger.h new file mode 100644 index 00000000..4aa0603e --- /dev/null +++ b/engine/inc/Ultralight/platform/Logger.h @@ -0,0 +1,47 @@ +/// +/// @file Logger.h +/// +/// @brief The header for the Logger interface. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include +#include + +namespace ultralight { + +/// +/// Log levels, used with Logger::LogMessage +/// +enum LogLevel { + kLogLevel_Error = 0, + kLogLevel_Warning, + kLogLevel_Info +}; + +/// +/// @brief Logger interface. +/// +/// This can be used to log debug messages to the console or to a log file. +/// +/// This is intended to be implemented by users and defined before creating the +/// Renderer. @see Platform::set_file_system. +/// +class UExport Logger { +public: + virtual ~Logger(); + + /// + /// Called when the library wants to print a message to the log. + /// + virtual void LogMessage(LogLevel log_level, const String16& message) = 0; +}; + +} // namespace ultralight diff --git a/engine/inc/Ultralight/platform/Platform.h b/engine/inc/Ultralight/platform/Platform.h new file mode 100644 index 00000000..ad92ba9e --- /dev/null +++ b/engine/inc/Ultralight/platform/Platform.h @@ -0,0 +1,141 @@ +/// +/// @file Platform.h +/// +/// @brief The header for the Platform singleton. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include + +namespace ultralight { + +struct Config; +class Logger; +class GPUDriver; +class FontLoader; +class FileSystem; +class Clipboard; +class SurfaceFactory; + +/// +/// @brief Platform singleton to configure Ultralight and provide user-defined +/// implementations for various platform operations. +/// +/// @note All of these settings and user-defined interfaces should be set +/// BEFORE creating the Renderer. +/// +class UExport Platform { + public: + /// + /// Get the Platform singleton + /// + static Platform& instance(); + + virtual ~Platform(); + + /// + /// Set the Config + /// + virtual void set_config(const Config& config) = 0; + + /// + /// Get the Config + /// + virtual const Config& config() const = 0; + + /// + /// Set the Logger (to handle error messages and debug output). + /// + /// @param logger A user-defined Logger implementation, ownership remains + /// with the caller. + /// + virtual void set_logger(Logger* logger) = 0; + + /// + /// Get the Logger + /// + virtual Logger* logger() const = 0; + + /// + /// Set the GPU Driver (will handle all rendering) + /// + /// @param gpu_driver A user-defined GPUDriver implementation, ownership + /// remains with the caller. + /// + virtual void set_gpu_driver(GPUDriver* gpu_driver) = 0; + + /// + /// Get the GPU Driver + /// + virtual GPUDriver* gpu_driver() const = 0; + + /// + /// Set the Font Loader (will be used to map font families to actual fonts) + /// + /// @param font_loader A user-defined FontLoader implementation, ownership + /// remains with the caller. + /// + virtual void set_font_loader(FontLoader* font_loader) = 0; + + /// + /// Get the Font Loader + /// + virtual FontLoader* font_loader() const = 0; + + /// + /// Set the File System (will be used for all file system operations) + /// + /// @param file_system A user-defined FileSystem implementation, ownership + /// remains with the caller. + /// + virtual void set_file_system(FileSystem* file_system) = 0; + + /// + /// Get the File System + /// + virtual FileSystem* file_system() const = 0; + + /// + /// Set the Clipboard (will be used for all clipboard operations) + /// + /// @param clipboard A user-defined Clipboard implementation, ownership + /// remains with the caller. + /// + virtual void set_clipboard(Clipboard* clipboard) = 0; + + /// + /// Get the Clipboard + /// + virtual Clipboard* clipboard() const = 0; + + /// + /// Set the SurfaceFactory + /// + /// This can be used to provide a platform-specific bitmap surface for View + /// to paint into when the CPU renderer is enabled. See View::surface(). + /// + /// @param surface_factory A user-defined SurfaceFactory implementation, + /// ownership remains with the caller. + /// + /// @note A default BitmapSurfaceFactory is defined if you never call this, + /// View::surface() can be safely cast to BitmapSurface. + /// + virtual void set_surface_factory(SurfaceFactory* surface_factory) = 0; + + /// + /// Get the SurfaceFactory + /// + /// @note A default BitmapSurfaceFactory is set by default, View::surface() + /// can be safely cast to BitmapSurface if you don't define your own. + /// + virtual SurfaceFactory* surface_factory() const = 0; +}; + +} // namespace ultralight diff --git a/engine/inc/Ultralight/platform/Surface.h b/engine/inc/Ultralight/platform/Surface.h new file mode 100644 index 00000000..6d2af244 --- /dev/null +++ b/engine/inc/Ultralight/platform/Surface.h @@ -0,0 +1,191 @@ +/// +/// @file Surface.h +/// +/// @brief The header for the Surface and SurfaceFactory interfaces. +/// +/// @author +/// +/// This file is a part of Ultralight, a fast, lightweight, HTML UI engine +/// +/// Website: +/// +/// Copyright (C) 2020 Ultralight, Inc. All rights reserved. +/// +#pragma once +#include +#include +#include +#include + +namespace ultralight { + +/// +/// Offscreen pixel buffer surface. (Premultiplied BGRA 32-bit format) +/// +/// When using the CPU renderer, each View is painted to its own Surface. +/// +/// You can provide your own Surface implementation to make the renderer +/// paint directly to a block of memory controlled by you (this is useful for +/// lower-latency uploads to GPU memory or other platform-specific bitmaps). +/// +/// A default Surface implementation, BitmapSurface, is automatically +/// provided by the library when you call Renderer::Create() without defining +/// a custom SurfaceFactory. +/// +/// To provide your own custom Surface implementation, you should inherit +/// from this class, handle the virtual member functions, and then define a +/// custom SurfaceFactory that creates/destroys an instance of your class. +/// After that, you should pass an instance of your custom SurfaceFactory class +/// to `Platform::instance().set_font_loader()` before calling App::Create() +/// or Renderer::Create(). +/// +class UExport Surface { +public: + virtual ~Surface(); + + /// + /// Width (in pixels). + /// + virtual uint32_t width() const = 0; + + /// + /// Height (in pixels). + /// + virtual uint32_t height() const = 0; + + /// + /// Number of bytes between rows (usually width * 4) + /// + virtual uint32_t row_bytes() const = 0; + + /// + /// Size in bytes. + /// + virtual size_t size() const = 0; + + /// + /// Lock the pixel buffer and get a pointer to the beginning of the data + /// for reading/writing. + /// + /// Native pixel format is premultiplied BGRA 32-bit (8 bits per channel). + /// + virtual void* LockPixels() = 0; + + /// + /// Unlock the pixel buffer. + /// + virtual void UnlockPixels() = 0; + + /// + /// Resize the pixel buffer to a certain width and height (both in pixels). + /// + /// This should never be called while pixels are locked. + /// + virtual void Resize(uint32_t width, uint32_t height) = 0; + + /// + /// Set the dirty bounds to a certain value. + /// + /// This is called after the Renderer paints to an area of the pixel buffer. + /// (The new value will be joined with the existing dirty_bounds()) + /// + virtual void set_dirty_bounds(const IntRect& bounds); + + /// + /// Get the dirty bounds. + /// + /// This value can be used to determine which portion of the pixel buffer has + /// been updated since the last call to ClearDirtyBounds(). + /// + /// The general algorithm to determine if a Surface needs display is: + ///
+  ///   if (!surface.dirty_bounds().IsEmpty()) {
+  ///       // Surface pixels are dirty and needs display.
+  ///       // Cast Surface to native Surface and use it here (pseudo code)
+  ///       DisplaySurface(surface);
+  ///
+  ///       // Once you're done, clear the dirty bounds:
+  ///       surface.ClearDirtyBounds();
+  ///  }
+  ///  
+ /// + virtual IntRect dirty_bounds() const; + + /// + /// Clear the dirty bounds. + /// + /// You should call this after you're done displaying the Surface. + /// + virtual void ClearDirtyBounds(); + +protected: + Surface(); + + IntRect dirty_bounds_; +}; + +/// +/// SurfaceFactory can be used to provide your own native Surface implementation. +/// +/// This can be used to wrap a platform-specific GPU texture, Windows DIB, +/// macOS CGImage, or any other pixel buffer target for display on screen. +/// +/// The default factory creates/destroys a BitmapSurface but you can override +/// this by providing your own factory to Platform::set_surface_factory. +/// +class UExport SurfaceFactory { +public: + virtual ~SurfaceFactory(); + + /// + /// Create a native Surface with a certain width and height (in pixels). + /// + virtual Surface* CreateSurface(uint32_t width, uint32_t height) = 0; + + /// + /// Destroy a native Surface previously created by CreateSurface(). + /// + virtual void DestroySurface(Surface* surface) = 0; +}; + +/// +/// The default Surface implementation, backed by a Bitmap. +/// +class UExport BitmapSurface : public Surface { +public: + virtual uint32_t width() const override; + + virtual uint32_t height() const override; + + virtual uint32_t row_bytes() const override; + + virtual size_t size() const override; + + virtual void* LockPixels() override; + + virtual void UnlockPixels() override; + + virtual void Resize(uint32_t width, uint32_t height) override; + + /// + /// Get the underlying Bitmap. + /// + RefPtr bitmap(); + +protected: + BitmapSurface(uint32_t width, uint32_t height); + virtual ~BitmapSurface(); + BitmapSurface(const BitmapSurface&) = delete; + void operator=(const BitmapSurface&) = delete; + friend class BitmapSurfaceFactory; + + void* impl_; +}; + +/// +/// Get the default Bitmap Surface Factory singleton. (Do not destroy this, +/// this singleton is owned by the library). +/// +UExport SurfaceFactory* GetBitmapSurfaceFactory(); + +} // namespace ultralight diff --git a/engine/inc/Ultralight/private/PlatformFileSystem.h b/engine/inc/Ultralight/private/PlatformFileSystem.h new file mode 100644 index 00000000..9b5a98a3 --- /dev/null +++ b/engine/inc/Ultralight/private/PlatformFileSystem.h @@ -0,0 +1,17 @@ +#pragma once +#include +#include + +namespace ultralight { +namespace PlatformFileSystem { + +bool UExport FileExists(const String& path); +bool UExport IsDirectory(const String& path, bool follow_symbolic_links); +String UExport AppendPath(const String& path, const String& component); +bool UExport MakeAllDirectories(const String& path); +String UExport GetFileName(const String& path); +String UExport GetDirectoryName(const String& path); +String UExport RealFilePath(const String& path); + +} // PlatformFileSystem +} // ultralight diff --git a/engine/inc/assimp/.editorconfig b/engine/inc/assimp/.editorconfig new file mode 100644 index 00000000..9ea66423 --- /dev/null +++ b/engine/inc/assimp/.editorconfig @@ -0,0 +1,8 @@ +# See for details + +[*.{h,hpp,inl}] +end_of_line = lf +insert_final_newline = true +trim_trailing_whitespace = true +indent_size = 4 +indent_style = space diff --git a/engine/inc/assimp/BaseImporter.h b/engine/inc/assimp/BaseImporter.h new file mode 100644 index 00000000..0c0fd110 --- /dev/null +++ b/engine/inc/assimp/BaseImporter.h @@ -0,0 +1,362 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +/** @file Definition of the base class for all importer worker classes. */ +#ifndef INCLUDED_AI_BASEIMPORTER_H +#define INCLUDED_AI_BASEIMPORTER_H + +#include "Exceptional.h" + +#include +#include +#include +#include + +struct aiScene; +struct aiImporterDesc; + +namespace Assimp { + +class Importer; +class IOSystem; +class BaseProcess; +class SharedPostProcessInfo; +class IOStream; + +// utility to do char4 to uint32 in a portable manner +#define AI_MAKE_MAGIC(string) ((uint32_t)((string[0] << 24) + \ + (string[1] << 16) + (string[2] << 8) + string[3])) + + +// --------------------------------------------------------------------------- +/** FOR IMPORTER PLUGINS ONLY: The BaseImporter defines a common interface + * for all importer worker classes. + * + * The interface defines two functions: CanRead() is used to check if the + * importer can handle the format of the given file. If an implementation of + * this function returns true, the importer then calls ReadFile() which + * imports the given file. ReadFile is not overridable, it just calls + * InternReadFile() and catches any ImportErrorException that might occur. + */ +class ASSIMP_API BaseImporter +{ + friend class Importer; + +public: + + /** Constructor to be privately used by #Importer */ + BaseImporter(); + + /** Destructor, private as well */ + virtual ~BaseImporter(); + +public: + // ------------------------------------------------------------------- + /** Returns whether the class can handle the format of the given file. + * + * The implementation should be as quick as possible. A check for + * the file extension is enough. If no suitable loader is found with + * this strategy, CanRead() is called again, the 'checkSig' parameter + * set to true this time. Now the implementation is expected to + * perform a full check of the file structure, possibly searching the + * first bytes of the file for magic identifiers or keywords. + * + * @param pFile Path and file name of the file to be examined. + * @param pIOHandler The IO handler to use for accessing any file. + * @param checkSig Set to true if this method is called a second time. + * This time, the implementation may take more time to examine the + * contents of the file to be loaded for magic bytes, keywords, etc + * to be able to load files with unknown/not existent file extensions. + * @return true if the class can read this file, false if not. + */ + virtual bool CanRead( + const std::string& pFile, + IOSystem* pIOHandler, + bool checkSig + ) const = 0; + + // ------------------------------------------------------------------- + /** Imports the given file and returns the imported data. + * If the import succeeds, ownership of the data is transferred to + * the caller. If the import fails, NULL is returned. The function + * takes care that any partially constructed data is destroyed + * beforehand. + * + * @param pImp #Importer object hosting this loader. + * @param pFile Path of the file to be imported. + * @param pIOHandler IO-Handler used to open this and possible other files. + * @return The imported data or NULL if failed. If it failed a + * human-readable error description can be retrieved by calling + * GetErrorText() + * + * @note This function is not intended to be overridden. Implement + * InternReadFile() to do the import. If an exception is thrown somewhere + * in InternReadFile(), this function will catch it and transform it into + * a suitable response to the caller. + */ + aiScene* ReadFile( + const Importer* pImp, + const std::string& pFile, + IOSystem* pIOHandler + ); + + // ------------------------------------------------------------------- + /** Returns the error description of the last error that occurred. + * @return A description of the last error that occurred. An empty + * string if there was no error. + */ + const std::string& GetErrorText() const { + return m_ErrorText; + } + + // ------------------------------------------------------------------- + /** Called prior to ReadFile(). + * The function is a request to the importer to update its configuration + * basing on the Importer's configuration property list. + * @param pImp Importer instance + */ + virtual void SetupProperties( + const Importer* pImp + ); + + // ------------------------------------------------------------------- + /** Called by #Importer::GetImporterInfo to get a description of + * some loader features. Importers must provide this information. */ + virtual const aiImporterDesc* GetInfo() const = 0; + + // ------------------------------------------------------------------- + /** Called by #Importer::GetExtensionList for each loaded importer. + * Take the extension list contained in the structure returned by + * #GetInfo and insert all file extensions into the given set. + * @param extension set to collect file extensions in*/ + void GetExtensionList(std::set& extensions); + +protected: + + // ------------------------------------------------------------------- + /** Imports the given file into the given scene structure. The + * function is expected to throw an ImportErrorException if there is + * an error. If it terminates normally, the data in aiScene is + * expected to be correct. Override this function to implement the + * actual importing. + *
+ * The output scene must meet the following requirements:
+ *
    + *
  • At least a root node must be there, even if its only purpose + * is to reference one mesh.
  • + *
  • aiMesh::mPrimitiveTypes may be 0. The types of primitives + * in the mesh are determined automatically in this case.
  • + *
  • the vertex data is stored in a pseudo-indexed "verbose" format. + * In fact this means that every vertex that is referenced by + * a face is unique. Or the other way round: a vertex index may + * not occur twice in a single aiMesh.
  • + *
  • aiAnimation::mDuration may be -1. Assimp determines the length + * of the animation automatically in this case as the length of + * the longest animation channel.
  • + *
  • aiMesh::mBitangents may be NULL if tangents and normals are + * given. In this case bitangents are computed as the cross product + * between normal and tangent.
  • + *
  • There needn't be a material. If none is there a default material + * is generated. However, it is recommended practice for loaders + * to generate a default material for yourself that matches the + * default material setting for the file format better than Assimp's + * generic default material. Note that default materials *should* + * be named AI_DEFAULT_MATERIAL_NAME if they're just color-shaded + * or AI_DEFAULT_TEXTURED_MATERIAL_NAME if they define a (dummy) + * texture.
  • + *
+ * If the AI_SCENE_FLAGS_INCOMPLETE-Flag is not set:
    + *
  • at least one mesh must be there
  • + *
  • there may be no meshes with 0 vertices or faces
  • + *
+ * This won't be checked (except by the validation step): Assimp will + * crash if one of the conditions is not met! + * + * @param pFile Path of the file to be imported. + * @param pScene The scene object to hold the imported data. + * NULL is not a valid parameter. + * @param pIOHandler The IO handler to use for any file access. + * NULL is not a valid parameter. */ + virtual void InternReadFile( + const std::string& pFile, + aiScene* pScene, + IOSystem* pIOHandler + ) = 0; + +public: // static utilities + + // ------------------------------------------------------------------- + /** A utility for CanRead(). + * + * The function searches the header of a file for a specific token + * and returns true if this token is found. This works for text + * files only. There is a rudimentary handling of UNICODE files. + * The comparison is case independent. + * + * @param pIOSystem IO System to work with + * @param file File name of the file + * @param tokens List of tokens to search for + * @param numTokens Size of the token array + * @param searchBytes Number of bytes to be searched for the tokens. + */ + static bool SearchFileHeaderForToken( + IOSystem* pIOSystem, + const std::string& file, + const char** tokens, + unsigned int numTokens, + unsigned int searchBytes = 200, + bool tokensSol = false); + + // ------------------------------------------------------------------- + /** @brief Check whether a file has a specific file extension + * @param pFile Input file + * @param ext0 Extension to check for. Lowercase characters only, no dot! + * @param ext1 Optional second extension + * @param ext2 Optional third extension + * @note Case-insensitive + */ + static bool SimpleExtensionCheck ( + const std::string& pFile, + const char* ext0, + const char* ext1 = NULL, + const char* ext2 = NULL); + + // ------------------------------------------------------------------- + /** @brief Extract file extension from a string + * @param pFile Input file + * @return Extension without trailing dot, all lowercase + */ + static std::string GetExtension ( + const std::string& pFile); + + // ------------------------------------------------------------------- + /** @brief Check whether a file starts with one or more magic tokens + * @param pFile Input file + * @param pIOHandler IO system to be used + * @param magic n magic tokens + * @params num Size of magic + * @param offset Offset from file start where tokens are located + * @param Size of one token, in bytes. Maximally 16 bytes. + * @return true if one of the given tokens was found + * + * @note For convenience, the check is also performed for the + * byte-swapped variant of all tokens (big endian). Only for + * tokens of size 2,4. + */ + static bool CheckMagicToken( + IOSystem* pIOHandler, + const std::string& pFile, + const void* magic, + unsigned int num, + unsigned int offset = 0, + unsigned int size = 4); + + // ------------------------------------------------------------------- + /** An utility for all text file loaders. It converts a file to our + * UTF8 character set. Errors are reported, but ignored. + * + * @param data File buffer to be converted to UTF8 data. The buffer + * is resized as appropriate. */ + static void ConvertToUTF8( + std::vector& data); + + // ------------------------------------------------------------------- + /** An utility for all text file loaders. It converts a file from our + * UTF8 character set back to ISO-8859-1. Errors are reported, but ignored. + * + * @param data File buffer to be converted from UTF8 to ISO-8859-1. The buffer + * is resized as appropriate. */ + static void ConvertUTF8toISO8859_1( + std::string& data); + + // ------------------------------------------------------------------- + /// @brief Enum to define, if empty files are ok or not. + enum TextFileMode { + ALLOW_EMPTY, + FORBID_EMPTY + }; + + // ------------------------------------------------------------------- + /** Utility for text file loaders which copies the contents of the + * file into a memory buffer and converts it to our UTF8 + * representation. + * @param stream Stream to read from. + * @param data Output buffer to be resized and filled with the + * converted text file data. The buffer is terminated with + * a binary 0. + * @param mode Whether it is OK to load empty text files. */ + static void TextFileToBuffer( + IOStream* stream, + std::vector& data, + TextFileMode mode = FORBID_EMPTY); + + // ------------------------------------------------------------------- + /** Utility function to move a std::vector into a aiScene array + * @param vec The vector to be moved + * @param out The output pointer to the allocated array. + * @param numOut The output count of elements copied. */ + template + AI_FORCE_INLINE + static void CopyVector( + std::vector& vec, + T*& out, + unsigned int& outLength) + { + outLength = unsigned(vec.size()); + if (outLength) { + out = new T[outLength]; + std::swap_ranges(vec.begin(), vec.end(), out); + } + } + +protected: + /// Error description in case there was one. + std::string m_ErrorText; + /// Currently set progress handler. + ProgressHandler* m_progress; +}; + + + +} // end of namespace Assimp + +#endif // AI_BASEIMPORTER_H_INC diff --git a/engine/inc/assimp/Bitmap.h b/engine/inc/assimp/Bitmap.h new file mode 100644 index 00000000..20911686 --- /dev/null +++ b/engine/inc/assimp/Bitmap.h @@ -0,0 +1,125 @@ +/* +--------------------------------------------------------------------------- +Open Asset Import Library (assimp) +--------------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the following +conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. +--------------------------------------------------------------------------- +*/ + +/** @file Bitmap.h + * @brief Defines bitmap format helper for textures + * + * Used for file formats which embed their textures into the model file. + */ + +#ifndef AI_BITMAP_H_INC +#define AI_BITMAP_H_INC + +#include "defs.h" +#include +#include + +struct aiTexture; + +namespace Assimp { + +class IOStream; + +class ASSIMP_API Bitmap { +protected: + + struct Header { + uint16_t type; + uint32_t size; + uint16_t reserved1; + uint16_t reserved2; + uint32_t offset; + + // We define the struct size because sizeof(Header) might return a wrong result because of structure padding. + // Moreover, we must use this ugly and error prone syntax because Visual Studio neither support constexpr or sizeof(name_of_field). + static const std::size_t header_size = + sizeof(uint16_t) + // type + sizeof(uint32_t) + // size + sizeof(uint16_t) + // reserved1 + sizeof(uint16_t) + // reserved2 + sizeof(uint32_t); // offset + }; + + struct DIB { + uint32_t size; + int32_t width; + int32_t height; + uint16_t planes; + uint16_t bits_per_pixel; + uint32_t compression; + uint32_t image_size; + int32_t x_resolution; + int32_t y_resolution; + uint32_t nb_colors; + uint32_t nb_important_colors; + + // We define the struct size because sizeof(DIB) might return a wrong result because of structure padding. + // Moreover, we must use this ugly and error prone syntax because Visual Studio neither support constexpr or sizeof(name_of_field). + static const std::size_t dib_size = + sizeof(uint32_t) + // size + sizeof(int32_t) + // width + sizeof(int32_t) + // height + sizeof(uint16_t) + // planes + sizeof(uint16_t) + // bits_per_pixel + sizeof(uint32_t) + // compression + sizeof(uint32_t) + // image_size + sizeof(int32_t) + // x_resolution + sizeof(int32_t) + // y_resolution + sizeof(uint32_t) + // nb_colors + sizeof(uint32_t); // nb_important_colors + }; + + static const std::size_t mBytesPerPixel = 4; + +public: + static void Save(aiTexture* texture, IOStream* file); + +protected: + static void WriteHeader(Header& header, IOStream* file); + static void WriteDIB(DIB& dib, IOStream* file); + static void WriteData(aiTexture* texture, IOStream* file); +}; + +} + +#endif // AI_BITMAP_H_INC diff --git a/engine/inc/assimp/BlobIOSystem.h b/engine/inc/assimp/BlobIOSystem.h new file mode 100644 index 00000000..3c1691d5 --- /dev/null +++ b/engine/inc/assimp/BlobIOSystem.h @@ -0,0 +1,338 @@ +/* +--------------------------------------------------------------------------- +Open Asset Import Library (assimp) +--------------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the following +conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. +--------------------------------------------------------------------------- +*/ + +/** @file Provides cheat implementations for IOSystem and IOStream to + * redirect exporter output to a blob chain.*/ + +#ifndef AI_BLOBIOSYSTEM_H_INCLUDED +#define AI_BLOBIOSYSTEM_H_INCLUDED + +#include +#include +#include +#include +#include +#include +#include + +namespace Assimp { + class BlobIOSystem; + +// -------------------------------------------------------------------------------------------- +/** Redirect IOStream to a blob */ +// -------------------------------------------------------------------------------------------- +class BlobIOStream : public IOStream +{ +public: + + BlobIOStream(BlobIOSystem* creator, const std::string& file, size_t initial = 4096) + : buffer() + , cur_size() + , file_size() + , cursor() + , initial(initial) + , file(file) + , creator(creator) + { + } + + + virtual ~BlobIOStream(); + +public: + + // ------------------------------------------------------------------- + aiExportDataBlob* GetBlob() + { + aiExportDataBlob* blob = new aiExportDataBlob(); + blob->size = file_size; + blob->data = buffer; + + buffer = NULL; + + return blob; + } + + +public: + + + // ------------------------------------------------------------------- + virtual size_t Read( void *, + size_t, + size_t ) + { + return 0; + } + + // ------------------------------------------------------------------- + virtual size_t Write(const void* pvBuffer, + size_t pSize, + size_t pCount) + { + pSize *= pCount; + if (cursor + pSize > cur_size) { + Grow(cursor + pSize); + } + + memcpy(buffer+cursor, pvBuffer, pSize); + cursor += pSize; + + file_size = std::max(file_size,cursor); + return pCount; + } + + // ------------------------------------------------------------------- + virtual aiReturn Seek(size_t pOffset, + aiOrigin pOrigin) + { + switch(pOrigin) + { + case aiOrigin_CUR: + cursor += pOffset; + break; + + case aiOrigin_END: + cursor = file_size - pOffset; + break; + + case aiOrigin_SET: + cursor = pOffset; + break; + + default: + return AI_FAILURE; + } + + if (cursor > file_size) { + Grow(cursor); + } + + file_size = std::max(cursor,file_size); + return AI_SUCCESS; + } + + // ------------------------------------------------------------------- + virtual size_t Tell() const + { + return cursor; + } + + // ------------------------------------------------------------------- + virtual size_t FileSize() const + { + return file_size; + } + + // ------------------------------------------------------------------- + virtual void Flush() + { + // ignore + } + + + +private: + + // ------------------------------------------------------------------- + void Grow(size_t need = 0) + { + // 1.5 and phi are very heap-friendly growth factors (the first + // allows for frequent re-use of heap blocks, the second + // forms a fibonacci sequence with similar characteristics - + // since this heavily depends on the heap implementation + // and other factors as well, i'll just go with 1.5 since + // it is quicker to compute). + size_t new_size = std::max(initial, std::max( need, cur_size+(cur_size>>1) )); + + const uint8_t* const old = buffer; + buffer = new uint8_t[new_size]; + + if (old) { + memcpy(buffer,old,cur_size); + delete[] old; + } + + cur_size = new_size; + } + +private: + + uint8_t* buffer; + size_t cur_size,file_size, cursor, initial; + + const std::string file; + BlobIOSystem* const creator; +}; + + +#define AI_BLOBIO_MAGIC "$blobfile" + +// -------------------------------------------------------------------------------------------- +/** Redirect IOSystem to a blob */ +// -------------------------------------------------------------------------------------------- +class BlobIOSystem : public IOSystem +{ + + friend class BlobIOStream; + typedef std::pair BlobEntry; + +public: + + BlobIOSystem() + { + } + + virtual ~BlobIOSystem() + { + for(BlobEntry& blobby : blobs) { + delete blobby.second; + } + } + +public: + + // ------------------------------------------------------------------- + const char* GetMagicFileName() const + { + return AI_BLOBIO_MAGIC; + } + + + // ------------------------------------------------------------------- + aiExportDataBlob* GetBlobChain() + { + // one must be the master + aiExportDataBlob* master = NULL, *cur; + for(const BlobEntry& blobby : blobs) { + if (blobby.first == AI_BLOBIO_MAGIC) { + master = blobby.second; + break; + } + } + if (!master) { + DefaultLogger::get()->error("BlobIOSystem: no data written or master file was not closed properly."); + return NULL; + } + + master->name.Set(""); + + cur = master; + for(const BlobEntry& blobby : blobs) { + if (blobby.second == master) { + continue; + } + + cur->next = blobby.second; + cur = cur->next; + + // extract the file extension from the file written + const std::string::size_type s = blobby.first.find_first_of('.'); + cur->name.Set(s == std::string::npos ? blobby.first : blobby.first.substr(s+1)); + } + + // give up blob ownership + blobs.clear(); + return master; + } + +public: + + // ------------------------------------------------------------------- + virtual bool Exists( const char* pFile) const { + return created.find(std::string(pFile)) != created.end(); + } + + + // ------------------------------------------------------------------- + virtual char getOsSeparator() const { + return '/'; + } + + + // ------------------------------------------------------------------- + virtual IOStream* Open(const char* pFile, + const char* pMode) + { + if (pMode[0] != 'w') { + return NULL; + } + + created.insert(std::string(pFile)); + return new BlobIOStream(this,std::string(pFile)); + } + + // ------------------------------------------------------------------- + virtual void Close( IOStream* pFile) + { + delete pFile; + } + +private: + + // ------------------------------------------------------------------- + void OnDestruct(const std::string& filename, BlobIOStream* child) + { + // we don't know in which the files are closed, so we + // can't reliably say that the first must be the master + // file ... + blobs.push_back( BlobEntry(filename,child->GetBlob()) ); + } + +private: + std::set created; + std::vector< BlobEntry > blobs; +}; + + +// -------------------------------------------------------------------------------------------- +BlobIOStream :: ~BlobIOStream() +{ + creator->OnDestruct(file,this); + delete[] buffer; +} + + +} // end Assimp + +#endif diff --git a/engine/inc/assimp/ByteSwapper.h b/engine/inc/assimp/ByteSwapper.h new file mode 100644 index 00000000..136944f2 --- /dev/null +++ b/engine/inc/assimp/ByteSwapper.h @@ -0,0 +1,288 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +/** @file Helper class tp perform various byte oder swappings + (e.g. little to big endian) */ +#ifndef AI_BYTESWAPPER_H_INC +#define AI_BYTESWAPPER_H_INC + +#include +#include +#include + +#if _MSC_VER >= 1400 +#include +#endif + +namespace Assimp { +// -------------------------------------------------------------------------------------- +/** Defines some useful byte order swap routines. + * + * This is required to read big-endian model formats on little-endian machines, + * and vice versa. Direct use of this class is DEPRECATED. Use #StreamReader instead. */ +// -------------------------------------------------------------------------------------- +class ByteSwap +{ + ByteSwap() {} + +public: + + // ---------------------------------------------------------------------- + /** Swap two bytes of data + * @param[inout] _szOut A void* to save the reintcasts for the caller. */ + static inline void Swap2(void* _szOut) + { + ai_assert(_szOut); + +#if _MSC_VER >= 1400 + uint16_t* const szOut = reinterpret_cast(_szOut); + *szOut = _byteswap_ushort(*szOut); +#else + uint8_t* const szOut = reinterpret_cast(_szOut); + std::swap(szOut[0],szOut[1]); +#endif + } + + // ---------------------------------------------------------------------- + /** Swap four bytes of data + * @param[inout] _szOut A void* to save the reintcasts for the caller. */ + static inline void Swap4(void* _szOut) + { + ai_assert(_szOut); + +#if _MSC_VER >= 1400 + uint32_t* const szOut = reinterpret_cast(_szOut); + *szOut = _byteswap_ulong(*szOut); +#else + uint8_t* const szOut = reinterpret_cast(_szOut); + std::swap(szOut[0],szOut[3]); + std::swap(szOut[1],szOut[2]); +#endif + } + + // ---------------------------------------------------------------------- + /** Swap eight bytes of data + * @param[inout] _szOut A void* to save the reintcasts for the caller. */ + static inline void Swap8(void* _szOut) + { + ai_assert(_szOut); + +#if _MSC_VER >= 1400 + uint64_t* const szOut = reinterpret_cast(_szOut); + *szOut = _byteswap_uint64(*szOut); +#else + uint8_t* const szOut = reinterpret_cast(_szOut); + std::swap(szOut[0],szOut[7]); + std::swap(szOut[1],szOut[6]); + std::swap(szOut[2],szOut[5]); + std::swap(szOut[3],szOut[4]); +#endif + } + + // ---------------------------------------------------------------------- + /** ByteSwap a float. Not a joke. + * @param[inout] fOut ehm. .. */ + static inline void Swap(float* fOut) { + Swap4(fOut); + } + + // ---------------------------------------------------------------------- + /** ByteSwap a double. Not a joke. + * @param[inout] fOut ehm. .. */ + static inline void Swap(double* fOut) { + Swap8(fOut); + } + + + // ---------------------------------------------------------------------- + /** ByteSwap an int16t. Not a joke. + * @param[inout] fOut ehm. .. */ + static inline void Swap(int16_t* fOut) { + Swap2(fOut); + } + + static inline void Swap(uint16_t* fOut) { + Swap2(fOut); + } + + // ---------------------------------------------------------------------- + /** ByteSwap an int32t. Not a joke. + * @param[inout] fOut ehm. .. */ + static inline void Swap(int32_t* fOut){ + Swap4(fOut); + } + + static inline void Swap(uint32_t* fOut){ + Swap4(fOut); + } + + // ---------------------------------------------------------------------- + /** ByteSwap an int64t. Not a joke. + * @param[inout] fOut ehm. .. */ + static inline void Swap(int64_t* fOut) { + Swap8(fOut); + } + + static inline void Swap(uint64_t* fOut) { + Swap8(fOut); + } + + // ---------------------------------------------------------------------- + //! Templatized ByteSwap + //! \returns param tOut as swapped + template + static inline Type Swapped(Type tOut) + { + return _swapper()(tOut); + } + +private: + + template struct _swapper; +}; + +template struct ByteSwap::_swapper { + T operator() (T tOut) { + Swap2(&tOut); + return tOut; + } +}; + +template struct ByteSwap::_swapper { + T operator() (T tOut) { + Swap4(&tOut); + return tOut; + } +}; + +template struct ByteSwap::_swapper { + T operator() (T tOut) { + Swap8(&tOut); + return tOut; + } +}; + + +// -------------------------------------------------------------------------------------- +// ByteSwap macros for BigEndian/LittleEndian support +// -------------------------------------------------------------------------------------- +#if (defined AI_BUILD_BIG_ENDIAN) +# define AI_LE(t) (t) +# define AI_BE(t) ByteSwap::Swapped(t) +# define AI_LSWAP2(p) +# define AI_LSWAP4(p) +# define AI_LSWAP8(p) +# define AI_LSWAP2P(p) +# define AI_LSWAP4P(p) +# define AI_LSWAP8P(p) +# define LE_NCONST const +# define AI_SWAP2(p) ByteSwap::Swap2(&(p)) +# define AI_SWAP4(p) ByteSwap::Swap4(&(p)) +# define AI_SWAP8(p) ByteSwap::Swap8(&(p)) +# define AI_SWAP2P(p) ByteSwap::Swap2((p)) +# define AI_SWAP4P(p) ByteSwap::Swap4((p)) +# define AI_SWAP8P(p) ByteSwap::Swap8((p)) +# define BE_NCONST +#else +# define AI_BE(t) (t) +# define AI_LE(t) ByteSwap::Swapped(t) +# define AI_SWAP2(p) +# define AI_SWAP4(p) +# define AI_SWAP8(p) +# define AI_SWAP2P(p) +# define AI_SWAP4P(p) +# define AI_SWAP8P(p) +# define BE_NCONST const +# define AI_LSWAP2(p) ByteSwap::Swap2(&(p)) +# define AI_LSWAP4(p) ByteSwap::Swap4(&(p)) +# define AI_LSWAP8(p) ByteSwap::Swap8(&(p)) +# define AI_LSWAP2P(p) ByteSwap::Swap2((p)) +# define AI_LSWAP4P(p) ByteSwap::Swap4((p)) +# define AI_LSWAP8P(p) ByteSwap::Swap8((p)) +# define LE_NCONST +#endif + + +namespace Intern { + +// -------------------------------------------------------------------------------------------- +template +struct ByteSwapper { + void operator() (T* inout) { + ByteSwap::Swap(inout); + } +}; + +template +struct ByteSwapper { + void operator() (T*) { + } +}; + +// -------------------------------------------------------------------------------------------- +template +struct Getter { + void operator() (T* inout, bool le) { +#ifdef AI_BUILD_BIG_ENDIAN + le = le; +#else + le = !le; +#endif + if (le) { + ByteSwapper1?true:false)> () (inout); + } + else ByteSwapper () (inout); + } +}; + +template +struct Getter { + + void operator() (T* inout, bool /*le*/) { + // static branch + ByteSwapper1)> () (inout); + } +}; +} // end Intern +} // end Assimp + +#endif //!! AI_BYTESWAPPER_H_INC diff --git a/engine/inc/assimp/Compiler/poppack1.h b/engine/inc/assimp/Compiler/poppack1.h new file mode 100644 index 00000000..e033bc14 --- /dev/null +++ b/engine/inc/assimp/Compiler/poppack1.h @@ -0,0 +1,22 @@ + +// =============================================================================== +// May be included multiple times - resets structure packing to the defaults +// for all supported compilers. Reverts the changes made by #include +// +// Currently this works on the following compilers: +// MSVC 7,8,9 +// GCC +// BORLAND (complains about 'pack state changed but not reverted', but works) +// =============================================================================== + +#ifndef AI_PUSHPACK_IS_DEFINED +# error pushpack1.h must be included after poppack1.h +#endif + +// reset packing to the original value +#if defined(_MSC_VER) || defined(__BORLANDC__) || defined (__BCPLUSPLUS__) +# pragma pack( pop ) +#endif +#undef PACK_STRUCT + +#undef AI_PUSHPACK_IS_DEFINED diff --git a/engine/inc/assimp/Compiler/pstdint.h b/engine/inc/assimp/Compiler/pstdint.h new file mode 100644 index 00000000..4de4ce2a --- /dev/null +++ b/engine/inc/assimp/Compiler/pstdint.h @@ -0,0 +1,912 @@ +/* A portable stdint.h + **************************************************************************** + * BSD License: + **************************************************************************** + * + * Copyright (c) 2005-2016 Paul Hsieh + * All rights reserved. + * + * Redistribution and use in source and binary forms, with or without + * modification, are permitted provided that the following conditions + * are met: + * + * 1. Redistributions of source code must retain the above copyright + * notice, this list of conditions and the following disclaimer. + * 2. Redistributions in binary form must reproduce the above copyright + * notice, this list of conditions and the following disclaimer in the + * documentation and/or other materials provided with the distribution. + * 3. The name of the author may not be used to endorse or promote products + * derived from this software without specific prior written permission. + * + * THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR + * IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES + * OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. + * IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, + * INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT + * NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, + * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY + * THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT + * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF + * THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + * + **************************************************************************** + * + * Version 0.1.15.4 + * + * The ANSI C standard committee, for the C99 standard, specified the + * inclusion of a new standard include file called stdint.h. This is + * a very useful and long desired include file which contains several + * very precise definitions for integer scalar types that is + * critically important for making portable several classes of + * applications including cryptography, hashing, variable length + * integer libraries and so on. But for most developers its likely + * useful just for programming sanity. + * + * The problem is that some compiler vendors chose to ignore the C99 + * standard and some older compilers have no opportunity to be updated. + * Because of this situation, simply including stdint.h in your code + * makes it unportable. + * + * So that's what this file is all about. Its an attempt to build a + * single universal include file that works on as many platforms as + * possible to deliver what stdint.h is supposed to. Even compilers + * that already come with stdint.h can use this file instead without + * any loss of functionality. A few things that should be noted about + * this file: + * + * 1) It is not guaranteed to be portable and/or present an identical + * interface on all platforms. The extreme variability of the + * ANSI C standard makes this an impossibility right from the + * very get go. Its really only meant to be useful for the vast + * majority of platforms that possess the capability of + * implementing usefully and precisely defined, standard sized + * integer scalars. Systems which are not intrinsically 2s + * complement may produce invalid constants. + * + * 2) There is an unavoidable use of non-reserved symbols. + * + * 3) Other standard include files are invoked. + * + * 4) This file may come in conflict with future platforms that do + * include stdint.h. The hope is that one or the other can be + * used with no real difference. + * + * 5) In the current version, if your platform can't represent + * int32_t, int16_t and int8_t, it just dumps out with a compiler + * error. + * + * 6) 64 bit integers may or may not be defined. Test for their + * presence with the test: #ifdef INT64_MAX or #ifdef UINT64_MAX. + * Note that this is different from the C99 specification which + * requires the existence of 64 bit support in the compiler. If + * this is not defined for your platform, yet it is capable of + * dealing with 64 bits then it is because this file has not yet + * been extended to cover all of your system's capabilities. + * + * 7) (u)intptr_t may or may not be defined. Test for its presence + * with the test: #ifdef PTRDIFF_MAX. If this is not defined + * for your platform, then it is because this file has not yet + * been extended to cover all of your system's capabilities, not + * because its optional. + * + * 8) The following might not been defined even if your platform is + * capable of defining it: + * + * WCHAR_MIN + * WCHAR_MAX + * (u)int64_t + * PTRDIFF_MIN + * PTRDIFF_MAX + * (u)intptr_t + * + * 9) The following have not been defined: + * + * WINT_MIN + * WINT_MAX + * + * 10) The criteria for defining (u)int_least(*)_t isn't clear, + * except for systems which don't have a type that precisely + * defined 8, 16, or 32 bit types (which this include file does + * not support anyways). Default definitions have been given. + * + * 11) The criteria for defining (u)int_fast(*)_t isn't something I + * would trust to any particular compiler vendor or the ANSI C + * committee. It is well known that "compatible systems" are + * commonly created that have very different performance + * characteristics from the systems they are compatible with, + * especially those whose vendors make both the compiler and the + * system. Default definitions have been given, but its strongly + * recommended that users never use these definitions for any + * reason (they do *NOT* deliver any serious guarantee of + * improved performance -- not in this file, nor any vendor's + * stdint.h). + * + * 12) The following macros: + * + * PRINTF_INTMAX_MODIFIER + * PRINTF_INT64_MODIFIER + * PRINTF_INT32_MODIFIER + * PRINTF_INT16_MODIFIER + * PRINTF_LEAST64_MODIFIER + * PRINTF_LEAST32_MODIFIER + * PRINTF_LEAST16_MODIFIER + * PRINTF_INTPTR_MODIFIER + * + * are strings which have been defined as the modifiers required + * for the "d", "u" and "x" printf formats to correctly output + * (u)intmax_t, (u)int64_t, (u)int32_t, (u)int16_t, (u)least64_t, + * (u)least32_t, (u)least16_t and (u)intptr_t types respectively. + * PRINTF_INTPTR_MODIFIER is not defined for some systems which + * provide their own stdint.h. PRINTF_INT64_MODIFIER is not + * defined if INT64_MAX is not defined. These are an extension + * beyond what C99 specifies must be in stdint.h. + * + * In addition, the following macros are defined: + * + * PRINTF_INTMAX_HEX_WIDTH + * PRINTF_INT64_HEX_WIDTH + * PRINTF_INT32_HEX_WIDTH + * PRINTF_INT16_HEX_WIDTH + * PRINTF_INT8_HEX_WIDTH + * PRINTF_INTMAX_DEC_WIDTH + * PRINTF_INT64_DEC_WIDTH + * PRINTF_INT32_DEC_WIDTH + * PRINTF_INT16_DEC_WIDTH + * PRINTF_UINT8_DEC_WIDTH + * PRINTF_UINTMAX_DEC_WIDTH + * PRINTF_UINT64_DEC_WIDTH + * PRINTF_UINT32_DEC_WIDTH + * PRINTF_UINT16_DEC_WIDTH + * PRINTF_UINT8_DEC_WIDTH + * + * Which specifies the maximum number of characters required to + * print the number of that type in either hexadecimal or decimal. + * These are an extension beyond what C99 specifies must be in + * stdint.h. + * + * Compilers tested (all with 0 warnings at their highest respective + * settings): Borland Turbo C 2.0, WATCOM C/C++ 11.0 (16 bits and 32 + * bits), Microsoft Visual C++ 6.0 (32 bit), Microsoft Visual Studio + * .net (VC7), Intel C++ 4.0, GNU gcc v3.3.3 + * + * This file should be considered a work in progress. Suggestions for + * improvements, especially those which increase coverage are strongly + * encouraged. + * + * Acknowledgements + * + * The following people have made significant contributions to the + * development and testing of this file: + * + * Chris Howie + * John Steele Scott + * Dave Thorup + * John Dill + * Florian Wobbe + * Christopher Sean Morrison + * Mikkel Fahnoe Jorgensen + * + */ + +#include +#include +#include + +/* + * For gcc with _STDINT_H, fill in the PRINTF_INT*_MODIFIER macros, and + * do nothing else. On the Mac OS X version of gcc this is _STDINT_H_. + */ + +#if ((defined(__SUNPRO_C) && __SUNPRO_C >= 0x570) || (defined(_MSC_VER) && _MSC_VER >= 1600) || (defined(__STDC__) && __STDC__ && defined(__STDC_VERSION__) && __STDC_VERSION__ >= 199901L) || (defined (__WATCOMC__) && (defined (_STDINT_H_INCLUDED) || __WATCOMC__ >= 1250)) || (defined(__GNUC__) && (__GNUC__ > 3 || defined(_STDINT_H) || defined(_STDINT_H_) || defined (__UINT_FAST64_TYPE__)) )) && !defined (_PSTDINT_H_INCLUDED) +#include +#define _PSTDINT_H_INCLUDED +# if defined(__GNUC__) && (defined(__x86_64__) || defined(__ppc64__)) && !(defined(__APPLE__) && defined(__MACH__)) +# ifndef PRINTF_INT64_MODIFIER +# define PRINTF_INT64_MODIFIER "l" +# endif +# ifndef PRINTF_INT32_MODIFIER +# define PRINTF_INT32_MODIFIER "" +# endif +# else +# ifndef PRINTF_INT64_MODIFIER +# define PRINTF_INT64_MODIFIER "ll" +# endif +# ifndef PRINTF_INT32_MODIFIER +# if (UINT_MAX == UINT32_MAX) +# define PRINTF_INT32_MODIFIER "" +# else +# define PRINTF_INT32_MODIFIER "l" +# endif +# endif +# endif +# ifndef PRINTF_INT16_MODIFIER +# define PRINTF_INT16_MODIFIER "h" +# endif +# ifndef PRINTF_INTMAX_MODIFIER +# define PRINTF_INTMAX_MODIFIER PRINTF_INT64_MODIFIER +# endif +# ifndef PRINTF_INT64_HEX_WIDTH +# define PRINTF_INT64_HEX_WIDTH "16" +# endif +# ifndef PRINTF_UINT64_HEX_WIDTH +# define PRINTF_UINT64_HEX_WIDTH "16" +# endif +# ifndef PRINTF_INT32_HEX_WIDTH +# define PRINTF_INT32_HEX_WIDTH "8" +# endif +# ifndef PRINTF_UINT32_HEX_WIDTH +# define PRINTF_UINT32_HEX_WIDTH "8" +# endif +# ifndef PRINTF_INT16_HEX_WIDTH +# define PRINTF_INT16_HEX_WIDTH "4" +# endif +# ifndef PRINTF_UINT16_HEX_WIDTH +# define PRINTF_UINT16_HEX_WIDTH "4" +# endif +# ifndef PRINTF_INT8_HEX_WIDTH +# define PRINTF_INT8_HEX_WIDTH "2" +# endif +# ifndef PRINTF_UINT8_HEX_WIDTH +# define PRINTF_UINT8_HEX_WIDTH "2" +# endif +# ifndef PRINTF_INT64_DEC_WIDTH +# define PRINTF_INT64_DEC_WIDTH "19" +# endif +# ifndef PRINTF_UINT64_DEC_WIDTH +# define PRINTF_UINT64_DEC_WIDTH "20" +# endif +# ifndef PRINTF_INT32_DEC_WIDTH +# define PRINTF_INT32_DEC_WIDTH "10" +# endif +# ifndef PRINTF_UINT32_DEC_WIDTH +# define PRINTF_UINT32_DEC_WIDTH "10" +# endif +# ifndef PRINTF_INT16_DEC_WIDTH +# define PRINTF_INT16_DEC_WIDTH "5" +# endif +# ifndef PRINTF_UINT16_DEC_WIDTH +# define PRINTF_UINT16_DEC_WIDTH "5" +# endif +# ifndef PRINTF_INT8_DEC_WIDTH +# define PRINTF_INT8_DEC_WIDTH "3" +# endif +# ifndef PRINTF_UINT8_DEC_WIDTH +# define PRINTF_UINT8_DEC_WIDTH "3" +# endif +# ifndef PRINTF_INTMAX_HEX_WIDTH +# define PRINTF_INTMAX_HEX_WIDTH PRINTF_UINT64_HEX_WIDTH +# endif +# ifndef PRINTF_UINTMAX_HEX_WIDTH +# define PRINTF_UINTMAX_HEX_WIDTH PRINTF_UINT64_HEX_WIDTH +# endif +# ifndef PRINTF_INTMAX_DEC_WIDTH +# define PRINTF_INTMAX_DEC_WIDTH PRINTF_UINT64_DEC_WIDTH +# endif +# ifndef PRINTF_UINTMAX_DEC_WIDTH +# define PRINTF_UINTMAX_DEC_WIDTH PRINTF_UINT64_DEC_WIDTH +# endif + +/* + * Something really weird is going on with Open Watcom. Just pull some of + * these duplicated definitions from Open Watcom's stdint.h file for now. + */ + +# if defined (__WATCOMC__) && __WATCOMC__ >= 1250 +# if !defined (INT64_C) +# define INT64_C(x) (x + (INT64_MAX - INT64_MAX)) +# endif +# if !defined (UINT64_C) +# define UINT64_C(x) (x + (UINT64_MAX - UINT64_MAX)) +# endif +# if !defined (INT32_C) +# define INT32_C(x) (x + (INT32_MAX - INT32_MAX)) +# endif +# if !defined (UINT32_C) +# define UINT32_C(x) (x + (UINT32_MAX - UINT32_MAX)) +# endif +# if !defined (INT16_C) +# define INT16_C(x) (x) +# endif +# if !defined (UINT16_C) +# define UINT16_C(x) (x) +# endif +# if !defined (INT8_C) +# define INT8_C(x) (x) +# endif +# if !defined (UINT8_C) +# define UINT8_C(x) (x) +# endif +# if !defined (UINT64_MAX) +# define UINT64_MAX 18446744073709551615ULL +# endif +# if !defined (INT64_MAX) +# define INT64_MAX 9223372036854775807LL +# endif +# if !defined (UINT32_MAX) +# define UINT32_MAX 4294967295UL +# endif +# if !defined (INT32_MAX) +# define INT32_MAX 2147483647L +# endif +# if !defined (INTMAX_MAX) +# define INTMAX_MAX INT64_MAX +# endif +# if !defined (INTMAX_MIN) +# define INTMAX_MIN INT64_MIN +# endif +# endif +#endif + +/* + * I have no idea what is the truly correct thing to do on older Solaris. + * From some online discussions, this seems to be what is being + * recommended. For people who actually are developing on older Solaris, + * what I would like to know is, does this define all of the relevant + * macros of a complete stdint.h? Remember, in pstdint.h 64 bit is + * considered optional. + */ + +#if (defined(__SUNPRO_C) && __SUNPRO_C >= 0x420) && !defined(_PSTDINT_H_INCLUDED) +#include +#define _PSTDINT_H_INCLUDED +#endif + +#ifndef _PSTDINT_H_INCLUDED +#define _PSTDINT_H_INCLUDED + +#ifndef SIZE_MAX +# define SIZE_MAX (~(size_t)0) +#endif + +/* + * Deduce the type assignments from limits.h under the assumption that + * integer sizes in bits are powers of 2, and follow the ANSI + * definitions. + */ + +#ifndef UINT8_MAX +# define UINT8_MAX 0xff +#endif +#if !defined(uint8_t) && !defined(_UINT8_T) && !defined(vxWorks) +# if (UCHAR_MAX == UINT8_MAX) || defined (S_SPLINT_S) + typedef unsigned char uint8_t; +# define UINT8_C(v) ((uint8_t) v) +# else +# error "Platform not supported" +# endif +#endif + +#ifndef INT8_MAX +# define INT8_MAX 0x7f +#endif +#ifndef INT8_MIN +# define INT8_MIN INT8_C(0x80) +#endif +#if !defined(int8_t) && !defined(_INT8_T) && !defined(vxWorks) +# if (SCHAR_MAX == INT8_MAX) || defined (S_SPLINT_S) + typedef signed char int8_t; +# define INT8_C(v) ((int8_t) v) +# else +# error "Platform not supported" +# endif +#endif + +#ifndef UINT16_MAX +# define UINT16_MAX 0xffff +#endif +#if !defined(uint16_t) && !defined(_UINT16_T) && !defined(vxWorks) +#if (UINT_MAX == UINT16_MAX) || defined (S_SPLINT_S) + typedef unsigned int uint16_t; +# ifndef PRINTF_INT16_MODIFIER +# define PRINTF_INT16_MODIFIER "" +# endif +# define UINT16_C(v) ((uint16_t) (v)) +#elif (USHRT_MAX == UINT16_MAX) + typedef unsigned short uint16_t; +# define UINT16_C(v) ((uint16_t) (v)) +# ifndef PRINTF_INT16_MODIFIER +# define PRINTF_INT16_MODIFIER "h" +# endif +#else +#error "Platform not supported" +#endif +#endif + +#ifndef INT16_MAX +# define INT16_MAX 0x7fff +#endif +#ifndef INT16_MIN +# define INT16_MIN INT16_C(0x8000) +#endif +#if !defined(int16_t) && !defined(_INT16_T) && !defined(vxWorks) +#if (INT_MAX == INT16_MAX) || defined (S_SPLINT_S) + typedef signed int int16_t; +# define INT16_C(v) ((int16_t) (v)) +# ifndef PRINTF_INT16_MODIFIER +# define PRINTF_INT16_MODIFIER "" +# endif +#elif (SHRT_MAX == INT16_MAX) + typedef signed short int16_t; +# define INT16_C(v) ((int16_t) (v)) +# ifndef PRINTF_INT16_MODIFIER +# define PRINTF_INT16_MODIFIER "h" +# endif +#else +#error "Platform not supported" +#endif +#endif + +#ifndef UINT32_MAX +# define UINT32_MAX (0xffffffffUL) +#endif +#if !defined(uint32_t) && !defined(_UINT32_T) && !defined(vxWorks) +#if (ULONG_MAX == UINT32_MAX) || defined (S_SPLINT_S) + typedef unsigned long uint32_t; +# define UINT32_C(v) v ## UL +# ifndef PRINTF_INT32_MODIFIER +# define PRINTF_INT32_MODIFIER "l" +# endif +#elif (UINT_MAX == UINT32_MAX) + typedef unsigned int uint32_t; +# ifndef PRINTF_INT32_MODIFIER +# define PRINTF_INT32_MODIFIER "" +# endif +# define UINT32_C(v) v ## U +#elif (USHRT_MAX == UINT32_MAX) + typedef unsigned short uint32_t; +# define UINT32_C(v) ((unsigned short) (v)) +# ifndef PRINTF_INT32_MODIFIER +# define PRINTF_INT32_MODIFIER "" +# endif +#else +#error "Platform not supported" +#endif +#endif + +#ifndef INT32_MAX +# define INT32_MAX (0x7fffffffL) +#endif +#ifndef INT32_MIN +# define INT32_MIN INT32_C(0x80000000) +#endif +#if !defined(int32_t) && !defined(_INT32_T) && !defined(vxWorks) +#if (LONG_MAX == INT32_MAX) || defined (S_SPLINT_S) + typedef signed long int32_t; +# define INT32_C(v) v ## L +# ifndef PRINTF_INT32_MODIFIER +# define PRINTF_INT32_MODIFIER "l" +# endif +#elif (INT_MAX == INT32_MAX) + typedef signed int int32_t; +# define INT32_C(v) v +# ifndef PRINTF_INT32_MODIFIER +# define PRINTF_INT32_MODIFIER "" +# endif +#elif (SHRT_MAX == INT32_MAX) + typedef signed short int32_t; +# define INT32_C(v) ((short) (v)) +# ifndef PRINTF_INT32_MODIFIER +# define PRINTF_INT32_MODIFIER "" +# endif +#else +#error "Platform not supported" +#endif +#endif + +/* + * The macro stdint_int64_defined is temporarily used to record + * whether or not 64 integer support is available. It must be + * defined for any 64 integer extensions for new platforms that are + * added. + */ + +#undef stdint_int64_defined +#if (defined(__STDC__) && defined(__STDC_VERSION__)) || defined (S_SPLINT_S) +# if (__STDC__ && __STDC_VERSION__ >= 199901L) || defined (S_SPLINT_S) +# define stdint_int64_defined + typedef long long int64_t; + typedef unsigned long long uint64_t; +# define UINT64_C(v) v ## ULL +# define INT64_C(v) v ## LL +# ifndef PRINTF_INT64_MODIFIER +# define PRINTF_INT64_MODIFIER "ll" +# endif +# endif +#endif + +#if !defined (stdint_int64_defined) +# if defined(__GNUC__) && !defined(vxWorks) +# define stdint_int64_defined + __extension__ typedef long long int64_t; + __extension__ typedef unsigned long long uint64_t; +# define UINT64_C(v) v ## ULL +# define INT64_C(v) v ## LL +# ifndef PRINTF_INT64_MODIFIER +# define PRINTF_INT64_MODIFIER "ll" +# endif +# elif defined(__MWERKS__) || defined (__SUNPRO_C) || defined (__SUNPRO_CC) || defined (__APPLE_CC__) || defined (_LONG_LONG) || defined (_CRAYC) || defined (S_SPLINT_S) +# define stdint_int64_defined + typedef long long int64_t; + typedef unsigned long long uint64_t; +# define UINT64_C(v) v ## ULL +# define INT64_C(v) v ## LL +# ifndef PRINTF_INT64_MODIFIER +# define PRINTF_INT64_MODIFIER "ll" +# endif +# elif (defined(__WATCOMC__) && defined(__WATCOM_INT64__)) || (defined(_MSC_VER) && _INTEGRAL_MAX_BITS >= 64) || (defined (__BORLANDC__) && __BORLANDC__ > 0x460) || defined (__alpha) || defined (__DECC) +# define stdint_int64_defined + typedef __int64 int64_t; + typedef unsigned __int64 uint64_t; +# define UINT64_C(v) v ## UI64 +# define INT64_C(v) v ## I64 +# ifndef PRINTF_INT64_MODIFIER +# define PRINTF_INT64_MODIFIER "I64" +# endif +# endif +#endif + +#if !defined (LONG_LONG_MAX) && defined (INT64_C) +# define LONG_LONG_MAX INT64_C (9223372036854775807) +#endif +#ifndef ULONG_LONG_MAX +# define ULONG_LONG_MAX UINT64_C (18446744073709551615) +#endif + +#if !defined (INT64_MAX) && defined (INT64_C) +# define INT64_MAX INT64_C (9223372036854775807) +#endif +#if !defined (INT64_MIN) && defined (INT64_C) +# define INT64_MIN INT64_C (-9223372036854775808) +#endif +#if !defined (UINT64_MAX) && defined (INT64_C) +# define UINT64_MAX UINT64_C (18446744073709551615) +#endif + +/* + * Width of hexadecimal for number field. + */ + +#ifndef PRINTF_INT64_HEX_WIDTH +# define PRINTF_INT64_HEX_WIDTH "16" +#endif +#ifndef PRINTF_INT32_HEX_WIDTH +# define PRINTF_INT32_HEX_WIDTH "8" +#endif +#ifndef PRINTF_INT16_HEX_WIDTH +# define PRINTF_INT16_HEX_WIDTH "4" +#endif +#ifndef PRINTF_INT8_HEX_WIDTH +# define PRINTF_INT8_HEX_WIDTH "2" +#endif +#ifndef PRINTF_INT64_DEC_WIDTH +# define PRINTF_INT64_DEC_WIDTH "19" +#endif +#ifndef PRINTF_INT32_DEC_WIDTH +# define PRINTF_INT32_DEC_WIDTH "10" +#endif +#ifndef PRINTF_INT16_DEC_WIDTH +# define PRINTF_INT16_DEC_WIDTH "5" +#endif +#ifndef PRINTF_INT8_DEC_WIDTH +# define PRINTF_INT8_DEC_WIDTH "3" +#endif +#ifndef PRINTF_UINT64_DEC_WIDTH +# define PRINTF_UINT64_DEC_WIDTH "20" +#endif +#ifndef PRINTF_UINT32_DEC_WIDTH +# define PRINTF_UINT32_DEC_WIDTH "10" +#endif +#ifndef PRINTF_UINT16_DEC_WIDTH +# define PRINTF_UINT16_DEC_WIDTH "5" +#endif +#ifndef PRINTF_UINT8_DEC_WIDTH +# define PRINTF_UINT8_DEC_WIDTH "3" +#endif + +/* + * Ok, lets not worry about 128 bit integers for now. Moore's law says + * we don't need to worry about that until about 2040 at which point + * we'll have bigger things to worry about. + */ + +#ifdef stdint_int64_defined + typedef int64_t intmax_t; + typedef uint64_t uintmax_t; +# define INTMAX_MAX INT64_MAX +# define INTMAX_MIN INT64_MIN +# define UINTMAX_MAX UINT64_MAX +# define UINTMAX_C(v) UINT64_C(v) +# define INTMAX_C(v) INT64_C(v) +# ifndef PRINTF_INTMAX_MODIFIER +# define PRINTF_INTMAX_MODIFIER PRINTF_INT64_MODIFIER +# endif +# ifndef PRINTF_INTMAX_HEX_WIDTH +# define PRINTF_INTMAX_HEX_WIDTH PRINTF_INT64_HEX_WIDTH +# endif +# ifndef PRINTF_INTMAX_DEC_WIDTH +# define PRINTF_INTMAX_DEC_WIDTH PRINTF_INT64_DEC_WIDTH +# endif +#else + typedef int32_t intmax_t; + typedef uint32_t uintmax_t; +# define INTMAX_MAX INT32_MAX +# define UINTMAX_MAX UINT32_MAX +# define UINTMAX_C(v) UINT32_C(v) +# define INTMAX_C(v) INT32_C(v) +# ifndef PRINTF_INTMAX_MODIFIER +# define PRINTF_INTMAX_MODIFIER PRINTF_INT32_MODIFIER +# endif +# ifndef PRINTF_INTMAX_HEX_WIDTH +# define PRINTF_INTMAX_HEX_WIDTH PRINTF_INT32_HEX_WIDTH +# endif +# ifndef PRINTF_INTMAX_DEC_WIDTH +# define PRINTF_INTMAX_DEC_WIDTH PRINTF_INT32_DEC_WIDTH +# endif +#endif + +/* + * Because this file currently only supports platforms which have + * precise powers of 2 as bit sizes for the default integers, the + * least definitions are all trivial. Its possible that a future + * version of this file could have different definitions. + */ + +#ifndef stdint_least_defined + typedef int8_t int_least8_t; + typedef uint8_t uint_least8_t; + typedef int16_t int_least16_t; + typedef uint16_t uint_least16_t; + typedef int32_t int_least32_t; + typedef uint32_t uint_least32_t; +# define PRINTF_LEAST32_MODIFIER PRINTF_INT32_MODIFIER +# define PRINTF_LEAST16_MODIFIER PRINTF_INT16_MODIFIER +# define UINT_LEAST8_MAX UINT8_MAX +# define INT_LEAST8_MAX INT8_MAX +# define UINT_LEAST16_MAX UINT16_MAX +# define INT_LEAST16_MAX INT16_MAX +# define UINT_LEAST32_MAX UINT32_MAX +# define INT_LEAST32_MAX INT32_MAX +# define INT_LEAST8_MIN INT8_MIN +# define INT_LEAST16_MIN INT16_MIN +# define INT_LEAST32_MIN INT32_MIN +# ifdef stdint_int64_defined + typedef int64_t int_least64_t; + typedef uint64_t uint_least64_t; +# define PRINTF_LEAST64_MODIFIER PRINTF_INT64_MODIFIER +# define UINT_LEAST64_MAX UINT64_MAX +# define INT_LEAST64_MAX INT64_MAX +# define INT_LEAST64_MIN INT64_MIN +# endif +#endif +#undef stdint_least_defined + +/* + * The ANSI C committee pretending to know or specify anything about + * performance is the epitome of misguided arrogance. The mandate of + * this file is to *ONLY* ever support that absolute minimum + * definition of the fast integer types, for compatibility purposes. + * No extensions, and no attempt to suggest what may or may not be a + * faster integer type will ever be made in this file. Developers are + * warned to stay away from these types when using this or any other + * stdint.h. + */ + +typedef int_least8_t int_fast8_t; +typedef uint_least8_t uint_fast8_t; +typedef int_least16_t int_fast16_t; +typedef uint_least16_t uint_fast16_t; +typedef int_least32_t int_fast32_t; +typedef uint_least32_t uint_fast32_t; +#define UINT_FAST8_MAX UINT_LEAST8_MAX +#define INT_FAST8_MAX INT_LEAST8_MAX +#define UINT_FAST16_MAX UINT_LEAST16_MAX +#define INT_FAST16_MAX INT_LEAST16_MAX +#define UINT_FAST32_MAX UINT_LEAST32_MAX +#define INT_FAST32_MAX INT_LEAST32_MAX +#define INT_FAST8_MIN INT_LEAST8_MIN +#define INT_FAST16_MIN INT_LEAST16_MIN +#define INT_FAST32_MIN INT_LEAST32_MIN +#ifdef stdint_int64_defined + typedef int_least64_t int_fast64_t; + typedef uint_least64_t uint_fast64_t; +# define UINT_FAST64_MAX UINT_LEAST64_MAX +# define INT_FAST64_MAX INT_LEAST64_MAX +# define INT_FAST64_MIN INT_LEAST64_MIN +#endif + +#undef stdint_int64_defined + +/* + * Whatever piecemeal, per compiler thing we can do about the wchar_t + * type limits. + */ + +#if defined(__WATCOMC__) || defined(_MSC_VER) || defined (__GNUC__) && !defined(vxWorks) +# include +# ifndef WCHAR_MIN +# define WCHAR_MIN 0 +# endif +# ifndef WCHAR_MAX +# define WCHAR_MAX ((wchar_t)-1) +# endif +#endif + +/* + * Whatever piecemeal, per compiler/platform thing we can do about the + * (u)intptr_t types and limits. + */ + +#if (defined (_MSC_VER) && defined (_UINTPTR_T_DEFINED)) || defined (_UINTPTR_T) +# define STDINT_H_UINTPTR_T_DEFINED +#endif + +#ifndef STDINT_H_UINTPTR_T_DEFINED +# if defined (__alpha__) || defined (__ia64__) || defined (__x86_64__) || defined (_WIN64) || defined (__ppc64__) +# define stdint_intptr_bits 64 +# elif defined (__WATCOMC__) || defined (__TURBOC__) +# if defined(__TINY__) || defined(__SMALL__) || defined(__MEDIUM__) +# define stdint_intptr_bits 16 +# else +# define stdint_intptr_bits 32 +# endif +# elif defined (__i386__) || defined (_WIN32) || defined (WIN32) || defined (__ppc64__) +# define stdint_intptr_bits 32 +# elif defined (__INTEL_COMPILER) +/* TODO -- what did Intel do about x86-64? */ +# else +/* #error "This platform might not be supported yet" */ +# endif + +# ifdef stdint_intptr_bits +# define stdint_intptr_glue3_i(a,b,c) a##b##c +# define stdint_intptr_glue3(a,b,c) stdint_intptr_glue3_i(a,b,c) +# ifndef PRINTF_INTPTR_MODIFIER +# define PRINTF_INTPTR_MODIFIER stdint_intptr_glue3(PRINTF_INT,stdint_intptr_bits,_MODIFIER) +# endif +# ifndef PTRDIFF_MAX +# define PTRDIFF_MAX stdint_intptr_glue3(INT,stdint_intptr_bits,_MAX) +# endif +# ifndef PTRDIFF_MIN +# define PTRDIFF_MIN stdint_intptr_glue3(INT,stdint_intptr_bits,_MIN) +# endif +# ifndef UINTPTR_MAX +# define UINTPTR_MAX stdint_intptr_glue3(UINT,stdint_intptr_bits,_MAX) +# endif +# ifndef INTPTR_MAX +# define INTPTR_MAX stdint_intptr_glue3(INT,stdint_intptr_bits,_MAX) +# endif +# ifndef INTPTR_MIN +# define INTPTR_MIN stdint_intptr_glue3(INT,stdint_intptr_bits,_MIN) +# endif +# ifndef INTPTR_C +# define INTPTR_C(x) stdint_intptr_glue3(INT,stdint_intptr_bits,_C)(x) +# endif +# ifndef UINTPTR_C +# define UINTPTR_C(x) stdint_intptr_glue3(UINT,stdint_intptr_bits,_C)(x) +# endif + typedef stdint_intptr_glue3(uint,stdint_intptr_bits,_t) uintptr_t; + typedef stdint_intptr_glue3( int,stdint_intptr_bits,_t) intptr_t; +# else +/* TODO -- This following is likely wrong for some platforms, and does + nothing for the definition of uintptr_t. */ + typedef ptrdiff_t intptr_t; +# endif +# define STDINT_H_UINTPTR_T_DEFINED +#endif + +/* + * Assumes sig_atomic_t is signed and we have a 2s complement machine. + */ + +#ifndef SIG_ATOMIC_MAX +# define SIG_ATOMIC_MAX ((((sig_atomic_t) 1) << (sizeof (sig_atomic_t)*CHAR_BIT-1)) - 1) +#endif + +#endif + +#if defined (__TEST_PSTDINT_FOR_CORRECTNESS) + +/* + * Please compile with the maximum warning settings to make sure macros are + * not defined more than once. + */ + +#include +#include +#include + +#define glue3_aux(x,y,z) x ## y ## z +#define glue3(x,y,z) glue3_aux(x,y,z) + +#define DECLU(bits) glue3(uint,bits,_t) glue3(u,bits,) = glue3(UINT,bits,_C) (0); +#define DECLI(bits) glue3(int,bits,_t) glue3(i,bits,) = glue3(INT,bits,_C) (0); + +#define DECL(us,bits) glue3(DECL,us,) (bits) + +#define TESTUMAX(bits) glue3(u,bits,) = ~glue3(u,bits,); if (glue3(UINT,bits,_MAX) != glue3(u,bits,)) printf ("Something wrong with UINT%d_MAX\n", bits) + +#define REPORTERROR(msg) { err_n++; if (err_first <= 0) err_first = __LINE__; printf msg; } + +int main () { + int err_n = 0; + int err_first = 0; + DECL(I,8) + DECL(U,8) + DECL(I,16) + DECL(U,16) + DECL(I,32) + DECL(U,32) +#ifdef INT64_MAX + DECL(I,64) + DECL(U,64) +#endif + intmax_t imax = INTMAX_C(0); + uintmax_t umax = UINTMAX_C(0); + char str0[256], str1[256]; + + sprintf (str0, "%" PRINTF_INT32_MODIFIER "d", INT32_C(2147483647)); + if (0 != strcmp (str0, "2147483647")) REPORTERROR (("Something wrong with PRINTF_INT32_MODIFIER : %s\n", str0)); + if (atoi(PRINTF_INT32_DEC_WIDTH) != (int) strlen(str0)) REPORTERROR (("Something wrong with PRINTF_INT32_DEC_WIDTH : %s\n", PRINTF_INT32_DEC_WIDTH)); + sprintf (str0, "%" PRINTF_INT32_MODIFIER "u", UINT32_C(4294967295)); + if (0 != strcmp (str0, "4294967295")) REPORTERROR (("Something wrong with PRINTF_INT32_MODIFIER : %s\n", str0)); + if (atoi(PRINTF_UINT32_DEC_WIDTH) != (int) strlen(str0)) REPORTERROR (("Something wrong with PRINTF_UINT32_DEC_WIDTH : %s\n", PRINTF_UINT32_DEC_WIDTH)); +#ifdef INT64_MAX + sprintf (str1, "%" PRINTF_INT64_MODIFIER "d", INT64_C(9223372036854775807)); + if (0 != strcmp (str1, "9223372036854775807")) REPORTERROR (("Something wrong with PRINTF_INT32_MODIFIER : %s\n", str1)); + if (atoi(PRINTF_INT64_DEC_WIDTH) != (int) strlen(str1)) REPORTERROR (("Something wrong with PRINTF_INT64_DEC_WIDTH : %s, %d\n", PRINTF_INT64_DEC_WIDTH, (int) strlen(str1))); + sprintf (str1, "%" PRINTF_INT64_MODIFIER "u", UINT64_C(18446744073709550591)); + if (0 != strcmp (str1, "18446744073709550591")) REPORTERROR (("Something wrong with PRINTF_INT32_MODIFIER : %s\n", str1)); + if (atoi(PRINTF_UINT64_DEC_WIDTH) != (int) strlen(str1)) REPORTERROR (("Something wrong with PRINTF_UINT64_DEC_WIDTH : %s, %d\n", PRINTF_UINT64_DEC_WIDTH, (int) strlen(str1))); +#endif + + sprintf (str0, "%d %x\n", 0, ~0); + + sprintf (str1, "%d %x\n", i8, ~0); + if (0 != strcmp (str0, str1)) REPORTERROR (("Something wrong with i8 : %s\n", str1)); + sprintf (str1, "%u %x\n", u8, ~0); + if (0 != strcmp (str0, str1)) REPORTERROR (("Something wrong with u8 : %s\n", str1)); + sprintf (str1, "%d %x\n", i16, ~0); + if (0 != strcmp (str0, str1)) REPORTERROR (("Something wrong with i16 : %s\n", str1)); + sprintf (str1, "%u %x\n", u16, ~0); + if (0 != strcmp (str0, str1)) REPORTERROR (("Something wrong with u16 : %s\n", str1)); + sprintf (str1, "%" PRINTF_INT32_MODIFIER "d %x\n", i32, ~0); + if (0 != strcmp (str0, str1)) REPORTERROR (("Something wrong with i32 : %s\n", str1)); + sprintf (str1, "%" PRINTF_INT32_MODIFIER "u %x\n", u32, ~0); + if (0 != strcmp (str0, str1)) REPORTERROR (("Something wrong with u32 : %s\n", str1)); +#ifdef INT64_MAX + sprintf (str1, "%" PRINTF_INT64_MODIFIER "d %x\n", i64, ~0); + if (0 != strcmp (str0, str1)) REPORTERROR (("Something wrong with i64 : %s\n", str1)); +#endif + sprintf (str1, "%" PRINTF_INTMAX_MODIFIER "d %x\n", imax, ~0); + if (0 != strcmp (str0, str1)) REPORTERROR (("Something wrong with imax : %s\n", str1)); + sprintf (str1, "%" PRINTF_INTMAX_MODIFIER "u %x\n", umax, ~0); + if (0 != strcmp (str0, str1)) REPORTERROR (("Something wrong with umax : %s\n", str1)); + + TESTUMAX(8); + TESTUMAX(16); + TESTUMAX(32); +#ifdef INT64_MAX + TESTUMAX(64); +#endif + +#define STR(v) #v +#define Q(v) printf ("sizeof " STR(v) " = %u\n", (unsigned) sizeof (v)); + if (err_n) { + printf ("pstdint.h is not correct. Please use sizes below to correct it:\n"); + } + + Q(int) + Q(unsigned) + Q(long int) + Q(short int) + Q(int8_t) + Q(int16_t) + Q(int32_t) +#ifdef INT64_MAX + Q(int64_t) +#endif + + return EXIT_SUCCESS; +} + +#endif diff --git a/engine/inc/assimp/Compiler/pushpack1.h b/engine/inc/assimp/Compiler/pushpack1.h new file mode 100644 index 00000000..94ee1e47 --- /dev/null +++ b/engine/inc/assimp/Compiler/pushpack1.h @@ -0,0 +1,43 @@ + + +// =============================================================================== +// May be included multiple times - sets structure packing to 1 +// for all supported compilers. #include reverts the changes. +// +// Currently this works on the following compilers: +// MSVC 7,8,9 +// GCC +// BORLAND (complains about 'pack state changed but not reverted', but works) +// Clang +// +// +// USAGE: +// +// struct StructToBePacked { +// } PACK_STRUCT; +// +// =============================================================================== + +#ifdef AI_PUSHPACK_IS_DEFINED +# error poppack1.h must be included after pushpack1.h +#endif + +#if defined(_MSC_VER) || defined(__BORLANDC__) || defined (__BCPLUSPLUS__) +# pragma pack(push,1) +# define PACK_STRUCT +#elif defined( __GNUC__ ) +# if !defined(HOST_MINGW) +# define PACK_STRUCT __attribute__((__packed__)) +# else +# define PACK_STRUCT __attribute__((gcc_struct, __packed__)) +# endif +#else +# error Compiler not supported +#endif + +#if defined(_MSC_VER) +// C4103: Packing was changed after the inclusion of the header, probably missing #pragma pop +# pragma warning (disable : 4103) +#endif + +#define AI_PUSHPACK_IS_DEFINED diff --git a/engine/inc/assimp/CreateAnimMesh.h b/engine/inc/assimp/CreateAnimMesh.h new file mode 100644 index 00000000..ad625cb9 --- /dev/null +++ b/engine/inc/assimp/CreateAnimMesh.h @@ -0,0 +1,58 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +/** @file CreateAnimMesh.h + * Create AnimMesh from Mesh + */ +#ifndef INCLUDED_AI_CREATE_ANIM_MESH_H +#define INCLUDED_AI_CREATE_ANIM_MESH_H + +#include + +namespace Assimp { + +/** Create aiAnimMesh from aiMesh. */ +ASSIMP_API aiAnimMesh *aiCreateAnimMesh(const aiMesh *mesh); + +} // end of namespace Assimp +#endif // INCLUDED_AI_CREATE_ANIM_MESH_H + diff --git a/engine/inc/assimp/DefaultIOStream.h b/engine/inc/assimp/DefaultIOStream.h new file mode 100644 index 00000000..fcd6061b --- /dev/null +++ b/engine/inc/assimp/DefaultIOStream.h @@ -0,0 +1,142 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +/** @file Default file I/O using fXXX()-family of functions */ +#ifndef AI_DEFAULTIOSTREAM_H_INC +#define AI_DEFAULTIOSTREAM_H_INC + +#include +#include +#include +#include + +namespace Assimp { + +// ---------------------------------------------------------------------------------- +//! @class DefaultIOStream +//! @brief Default IO implementation, use standard IO operations +//! @note An instance of this class can exist without a valid file handle +//! attached to it. All calls fail, but the instance can nevertheless be +//! used with no restrictions. +class ASSIMP_API DefaultIOStream : public IOStream +{ + friend class DefaultIOSystem; +#if __ANDROID__ +# if __ANDROID_API__ > 9 +# if defined(AI_CONFIG_ANDROID_JNI_ASSIMP_MANAGER_SUPPORT) + friend class AndroidJNIIOSystem; +# endif // defined(AI_CONFIG_ANDROID_JNI_ASSIMP_MANAGER_SUPPORT) +# endif // __ANDROID_API__ > 9 +#endif // __ANDROID__ + +protected: + DefaultIOStream(); + DefaultIOStream(FILE* pFile, const std::string &strFilename); + +public: + /** Destructor public to allow simple deletion to close the file. */ + ~DefaultIOStream (); + + // ------------------------------------------------------------------- + /// Read from stream + size_t Read(void* pvBuffer, + size_t pSize, + size_t pCount); + + + // ------------------------------------------------------------------- + /// Write to stream + size_t Write(const void* pvBuffer, + size_t pSize, + size_t pCount); + + // ------------------------------------------------------------------- + /// Seek specific position + aiReturn Seek(size_t pOffset, + aiOrigin pOrigin); + + // ------------------------------------------------------------------- + /// Get current seek position + size_t Tell() const; + + // ------------------------------------------------------------------- + /// Get size of file + size_t FileSize() const; + + // ------------------------------------------------------------------- + /// Flush file contents + void Flush(); + +private: + // File data-structure, using clib + FILE* mFile; + // Filename + std::string mFilename; + + // Cached file size + mutable size_t mCachedSize; +}; + +// ---------------------------------------------------------------------------------- +inline DefaultIOStream::DefaultIOStream () : + mFile (NULL), + mFilename (""), + mCachedSize(SIZE_MAX) +{ + // empty +} + +// ---------------------------------------------------------------------------------- +inline DefaultIOStream::DefaultIOStream (FILE* pFile, + const std::string &strFilename) : + mFile(pFile), + mFilename(strFilename), + mCachedSize(SIZE_MAX) +{ + // empty +} +// ---------------------------------------------------------------------------------- + +} // ns assimp + +#endif //!!AI_DEFAULTIOSTREAM_H_INC + diff --git a/engine/inc/assimp/DefaultIOSystem.h b/engine/inc/assimp/DefaultIOSystem.h new file mode 100644 index 00000000..23471d25 --- /dev/null +++ b/engine/inc/assimp/DefaultIOSystem.h @@ -0,0 +1,94 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +/** @file Default implementation of IOSystem using the standard C file functions */ +#ifndef AI_DEFAULTIOSYSTEM_H_INC +#define AI_DEFAULTIOSYSTEM_H_INC + +#include + +namespace Assimp { + +// --------------------------------------------------------------------------- +/** Default implementation of IOSystem using the standard C file functions */ +class ASSIMP_API DefaultIOSystem : public IOSystem +{ +public: + // ------------------------------------------------------------------- + /** Tests for the existence of a file at the given path. */ + bool Exists( const char* pFile) const; + + // ------------------------------------------------------------------- + /** Returns the directory separator. */ + char getOsSeparator() const; + + // ------------------------------------------------------------------- + /** Open a new file with a given path. */ + IOStream* Open( const char* pFile, const char* pMode = "rb"); + + // ------------------------------------------------------------------- + /** Closes the given file and releases all resources associated with it. */ + void Close( IOStream* pFile); + + // ------------------------------------------------------------------- + /** Compare two paths */ + bool ComparePaths (const char* one, const char* second) const; + + /** @brief get the file name of a full filepath + * example: /tmp/archive.tar.gz -> archive.tar.gz + */ + static std::string fileName( const std::string &path ); + + /** @brief get the complete base name of a full filepath + * example: /tmp/archive.tar.gz -> archive.tar + */ + static std::string completeBaseName( const std::string &path); + + /** @brief get the path of a full filepath + * example: /tmp/archive.tar.gz -> /tmp/ + */ + static std::string absolutePath( const std::string &path); +}; + +} //!ns Assimp + +#endif //AI_DEFAULTIOSYSTEM_H_INC diff --git a/engine/inc/assimp/DefaultLogger.hpp b/engine/inc/assimp/DefaultLogger.hpp new file mode 100644 index 00000000..1f0c899b --- /dev/null +++ b/engine/inc/assimp/DefaultLogger.hpp @@ -0,0 +1,188 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ +/** @file DefaultLogger.hpp +*/ + +#ifndef INCLUDED_AI_DEFAULTLOGGER +#define INCLUDED_AI_DEFAULTLOGGER + +#include "Logger.hpp" +#include "LogStream.hpp" +#include "NullLogger.hpp" +#include + +namespace Assimp { +// ------------------------------------------------------------------------------------ +class IOStream; +struct LogStreamInfo; + +/** default name of logfile */ +#define ASSIMP_DEFAULT_LOG_NAME "AssimpLog.txt" + +// ------------------------------------------------------------------------------------ +/** @brief CPP-API: Primary logging facility of Assimp. + * + * The library stores its primary #Logger as a static member of this class. + * #get() returns this primary logger. By default the underlying implementation is + * just a #NullLogger which rejects all log messages. By calling #create(), logging + * is turned on. To capture the log output multiple log streams (#LogStream) can be + * attach to the logger. Some default streams for common streaming locations (such as + * a file, std::cout, OutputDebugString()) are also provided. + * + * If you wish to customize the logging at an even deeper level supply your own + * implementation of #Logger to #set(). + * @note The whole logging stuff causes a small extra overhead for all imports. */ +class ASSIMP_API DefaultLogger : + public Logger { + +public: + + // ---------------------------------------------------------------------- + /** @brief Creates a logging instance. + * @param name Name for log file. Only valid in combination + * with the aiDefaultLogStream_FILE flag. + * @param severity Log severity, VERBOSE turns on debug messages + * @param defStreams Default log streams to be attached. Any bitwise + * combination of the aiDefaultLogStream enumerated values. + * If #aiDefaultLogStream_FILE is specified but an empty string is + * passed for 'name', no log file is created at all. + * @param io IOSystem to be used to open external files (such as the + * log file). Pass NULL to rely on the default implementation. + * This replaces the default #NullLogger with a #DefaultLogger instance. */ + static Logger *create(const char* name = ASSIMP_DEFAULT_LOG_NAME, + LogSeverity severity = NORMAL, + unsigned int defStreams = aiDefaultLogStream_DEBUGGER | aiDefaultLogStream_FILE, + IOSystem* io = NULL); + + // ---------------------------------------------------------------------- + /** @brief Setup a custom #Logger implementation. + * + * Use this if the provided #DefaultLogger class doesn't fit into + * your needs. If the provided message formatting is OK for you, + * it's much easier to use #create() and to attach your own custom + * output streams to it. + * @param logger Pass NULL to setup a default NullLogger*/ + static void set (Logger *logger); + + // ---------------------------------------------------------------------- + /** @brief Getter for singleton instance + * @return Only instance. This is never null, but it could be a + * NullLogger. Use isNullLogger to check this.*/ + static Logger *get(); + + // ---------------------------------------------------------------------- + /** @brief Return whether a #NullLogger is currently active + * @return true if the current logger is a #NullLogger. + * Use create() or set() to setup a logger that does actually do + * something else than just rejecting all log messages. */ + static bool isNullLogger(); + + // ---------------------------------------------------------------------- + /** @brief Kills the current singleton logger and replaces it with a + * #NullLogger instance. */ + static void kill(); + + // ---------------------------------------------------------------------- + /** @copydoc Logger::attachStream */ + bool attachStream(LogStream *pStream, + unsigned int severity); + + // ---------------------------------------------------------------------- + /** @copydoc Logger::detatchStream */ + bool detatchStream(LogStream *pStream, + unsigned int severity); + +private: + // ---------------------------------------------------------------------- + /** @briefPrivate construction for internal use by create(). + * @param severity Logging granularity */ + explicit DefaultLogger(LogSeverity severity); + + // ---------------------------------------------------------------------- + /** @briefDestructor */ + ~DefaultLogger(); + + /** @brief Logs debug infos, only been written when severity level VERBOSE is set */ + void OnDebug(const char* message); + + /** @brief Logs an info message */ + void OnInfo(const char* message); + + /** @brief Logs a warning message */ + void OnWarn(const char* message); + + /** @brief Logs an error message */ + void OnError(const char* message); + + // ---------------------------------------------------------------------- + /** @brief Writes a message to all streams */ + void WriteToStreams(const char* message, ErrorSeverity ErrorSev ); + + // ---------------------------------------------------------------------- + /** @brief Returns the thread id. + * @note This is an OS specific feature, if not supported, a + * zero will be returned. + */ + unsigned int GetThreadID(); + +private: + // Aliases for stream container + typedef std::vector StreamArray; + typedef std::vector::iterator StreamIt; + typedef std::vector::const_iterator ConstStreamIt; + + //! only logging instance + static Logger *m_pLogger; + static NullLogger s_pNullLogger; + + //! Attached streams + StreamArray m_StreamArray; + + bool noRepeatMsg; + char lastMsg[MAX_LOG_MESSAGE_LENGTH*2]; + size_t lastLen; +}; +// ------------------------------------------------------------------------------------ + +} // Namespace Assimp + +#endif // !! INCLUDED_AI_DEFAULTLOGGER diff --git a/engine/inc/assimp/Defines.h b/engine/inc/assimp/Defines.h new file mode 100644 index 00000000..15e1d83c --- /dev/null +++ b/engine/inc/assimp/Defines.h @@ -0,0 +1,49 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2012, assimp team +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +// We need those constants, workaround for any platforms where nobody defined them yet +#if (!defined SIZE_MAX) +# define SIZE_MAX (~((size_t)0)) +#endif + +#if (!defined UINT_MAX) +# define UINT_MAX (~((unsigned int)0)) +#endif + diff --git a/engine/inc/assimp/Exceptional.h b/engine/inc/assimp/Exceptional.h new file mode 100644 index 00000000..5109b8f0 --- /dev/null +++ b/engine/inc/assimp/Exceptional.h @@ -0,0 +1,125 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2008, assimp team +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +#ifndef INCLUDED_EXCEPTIONAL_H +#define INCLUDED_EXCEPTIONAL_H + +#include +#include +using std::runtime_error; + +#ifdef _MSC_VER +# pragma warning(disable : 4275) +#endif + +// --------------------------------------------------------------------------- +/** FOR IMPORTER PLUGINS ONLY: Simple exception class to be thrown if an + * unrecoverable error occurs while importing. Loading APIs return + * NULL instead of a valid aiScene then. */ +class DeadlyImportError + : public runtime_error +{ +public: + /** Constructor with arguments */ + explicit DeadlyImportError( const std::string& errorText) + : runtime_error(errorText) + { + } + +private: +}; + +typedef DeadlyImportError DeadlyExportError; + +#ifdef _MSC_VER +# pragma warning(default : 4275) +#endif + +// --------------------------------------------------------------------------- +template +struct ExceptionSwallower { + T operator ()() const { + return T(); + } +}; + +// --------------------------------------------------------------------------- +template +struct ExceptionSwallower { + T* operator ()() const { + return NULL; + } +}; + +// --------------------------------------------------------------------------- +template <> +struct ExceptionSwallower { + aiReturn operator ()() const { + try { + throw; + } + catch (std::bad_alloc&) { + return aiReturn_OUTOFMEMORY; + } + catch (...) { + return aiReturn_FAILURE; + } + } +}; + +// --------------------------------------------------------------------------- +template <> +struct ExceptionSwallower { + void operator ()() const { + return; + } +}; + +#define ASSIMP_BEGIN_EXCEPTION_REGION()\ +{\ + try { + +#define ASSIMP_END_EXCEPTION_REGION(type)\ + } catch(...) {\ + return ExceptionSwallower()();\ + }\ +} + +#endif // INCLUDED_EXCEPTIONAL_H diff --git a/engine/inc/assimp/Exporter.hpp b/engine/inc/assimp/Exporter.hpp new file mode 100644 index 00000000..e7e43d8b --- /dev/null +++ b/engine/inc/assimp/Exporter.hpp @@ -0,0 +1,484 @@ +/* +--------------------------------------------------------------------------- +Open Asset Import Library (assimp) +--------------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the following +conditions are met: + +* Redistributions of source code must retain the above +copyright notice, this list of conditions and the +following disclaimer. + +* Redistributions in binary form must reproduce the above +copyright notice, this list of conditions and the +following disclaimer in the documentation and/or other +materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its +contributors may be used to endorse or promote products +derived from this software without specific prior +written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. +--------------------------------------------------------------------------- +*/ + +/** @file Exporter.hpp +* @brief Defines the CPP-API for the Assimp export interface +*/ +#pragma once +#ifndef AI_EXPORT_HPP_INC +#define AI_EXPORT_HPP_INC + +#ifndef ASSIMP_BUILD_NO_EXPORT + +#include "cexport.h" +#include + +namespace Assimp { + +class ExporterPimpl; +class IOSystem; + +// ---------------------------------------------------------------------------------- +/** CPP-API: The Exporter class forms an C++ interface to the export functionality + * of the Open Asset Import Library. Note that the export interface is available + * only if Assimp has been built with ASSIMP_BUILD_NO_EXPORT not defined. + * + * The interface is modeled after the importer interface and mostly + * symmetric. The same rules for threading etc. apply. + * + * In a nutshell, there are two export interfaces: #Export, which writes the + * output file(s) either to the regular file system or to a user-supplied + * #IOSystem, and #ExportToBlob which returns a linked list of memory + * buffers (blob), each referring to one output file (in most cases + * there will be only one output file of course, but this extra complexity is + * needed since Assimp aims at supporting a wide range of file formats). + * + * #ExportToBlob is especially useful if you intend to work + * with the data in-memory. +*/ +class ASSIMP_API ExportProperties; + +class ASSIMP_API Exporter { +public: + /** Function pointer type of a Export worker function */ + typedef void (*fpExportFunc)(const char*, IOSystem*, const aiScene*, const ExportProperties*); + + /** Internal description of an Assimp export format option */ + struct ExportFormatEntry + { + /// Public description structure to be returned by aiGetExportFormatDescription() + aiExportFormatDesc mDescription; + + // Worker function to do the actual exporting + fpExportFunc mExportFunction; + + // Post-processing steps to be executed PRIOR to invoking mExportFunction + unsigned int mEnforcePP; + + // Constructor to fill all entries + ExportFormatEntry( const char* pId, const char* pDesc, const char* pExtension, fpExportFunc pFunction, unsigned int pEnforcePP = 0u) + { + mDescription.id = pId; + mDescription.description = pDesc; + mDescription.fileExtension = pExtension; + mExportFunction = pFunction; + mEnforcePP = pEnforcePP; + } + + ExportFormatEntry() : + mExportFunction() + , mEnforcePP() + { + mDescription.id = NULL; + mDescription.description = NULL; + mDescription.fileExtension = NULL; + } + }; + + +public: + Exporter(); + ~Exporter(); + +public: + // ------------------------------------------------------------------- + /** Supplies a custom IO handler to the exporter to use to open and + * access files. + * + * If you need #Export to use custom IO logic to access the files, + * you need to supply a custom implementation of IOSystem and + * IOFile to the exporter. + * + * #Exporter takes ownership of the object and will destroy it + * afterwards. The previously assigned handler will be deleted. + * Pass NULL to take again ownership of your IOSystem and reset Assimp + * to use its default implementation, which uses plain file IO. + * + * @param pIOHandler The IO handler to be used in all file accesses + * of the Importer. */ + void SetIOHandler( IOSystem* pIOHandler); + + // ------------------------------------------------------------------- + /** Retrieves the IO handler that is currently set. + * You can use #IsDefaultIOHandler() to check whether the returned + * interface is the default IO handler provided by ASSIMP. The default + * handler is active as long the application doesn't supply its own + * custom IO handler via #SetIOHandler(). + * @return A valid IOSystem interface, never NULL. */ + IOSystem* GetIOHandler() const; + + // ------------------------------------------------------------------- + /** Checks whether a default IO handler is active + * A default handler is active as long the application doesn't + * supply its own custom IO handler via #SetIOHandler(). + * @return true by default */ + bool IsDefaultIOHandler() const; + + // ------------------------------------------------------------------- + /** Exports the given scene to a chosen file format. Returns the exported + * data as a binary blob which you can write into a file or something. + * When you're done with the data, simply let the #Exporter instance go + * out of scope to have it released automatically. + * @param pScene The scene to export. Stays in possession of the caller, + * is not changed by the function. + * @param pFormatId ID string to specify to which format you want to + * export to. Use + * #GetExportFormatCount / #GetExportFormatDescription to learn which + * export formats are available. + * @param pPreprocessing See the documentation for #Export + * @return the exported data or NULL in case of error. + * @note If the Exporter instance did already hold a blob from + * a previous call to #ExportToBlob, it will be disposed. + * Any IO handlers set via #SetIOHandler are ignored here. + * @note Use aiCopyScene() to get a modifiable copy of a previously + * imported scene. */ + const aiExportDataBlob* ExportToBlob(const aiScene* pScene, const char* pFormatId, unsigned int pPreprocessing = 0u, const ExportProperties* = NULL); + const aiExportDataBlob* ExportToBlob( const aiScene* pScene, const std::string& pFormatId, unsigned int pPreprocessing = 0u, const ExportProperties* pProperties = NULL); + + // ------------------------------------------------------------------- + /** Convenience function to export directly to a file. Use + * #SetIOSystem to supply a custom IOSystem to gain fine-grained control + * about the output data flow of the export process. + * @param pBlob A data blob obtained from a previous call to #aiExportScene. Must not be NULL. + * @param pPath Full target file name. Target must be accessible. + * @param pPreprocessing Accepts any choice of the #aiPostProcessSteps enumerated + * flags, but in reality only a subset of them makes sense here. Specifying + * 'preprocessing' flags is useful if the input scene does not conform to + * Assimp's default conventions as specified in the @link data Data Structures Page @endlink. + * In short, this means the geometry data should use a right-handed coordinate systems, face + * winding should be counter-clockwise and the UV coordinate origin is assumed to be in + * the upper left. The #aiProcess_MakeLeftHanded, #aiProcess_FlipUVs and + * #aiProcess_FlipWindingOrder flags are used in the import side to allow users + * to have those defaults automatically adapted to their conventions. Specifying those flags + * for exporting has the opposite effect, respectively. Some other of the + * #aiPostProcessSteps enumerated values may be useful as well, but you'll need + * to try out what their effect on the exported file is. Many formats impose + * their own restrictions on the structure of the geometry stored therein, + * so some preprocessing may have little or no effect at all, or may be + * redundant as exporters would apply them anyhow. A good example + * is triangulation - whilst you can enforce it by specifying + * the #aiProcess_Triangulate flag, most export formats support only + * triangulate data so they would run the step even if it wasn't requested. + * + * If assimp detects that the input scene was directly taken from the importer side of + * the library (i.e. not copied using aiCopyScene and potentially modified afterwards), + * any post-processing steps already applied to the scene will not be applied again, unless + * they show non-idempotent behavior (#aiProcess_MakeLeftHanded, #aiProcess_FlipUVs and + * #aiProcess_FlipWindingOrder). + * @return AI_SUCCESS if everything was fine. + * @note Use aiCopyScene() to get a modifiable copy of a previously + * imported scene.*/ + aiReturn Export( const aiScene* pScene, const char* pFormatId, const char* pPath, unsigned int pPreprocessing = 0u, const ExportProperties* pProperties = NULL); + aiReturn Export( const aiScene* pScene, const std::string& pFormatId, const std::string& pPath, unsigned int pPreprocessing = 0u, const ExportProperties* pProperties = NULL); + + // ------------------------------------------------------------------- + /** Returns an error description of an error that occurred in #Export + * or #ExportToBlob + * + * Returns an empty string if no error occurred. + * @return A description of the last error, an empty string if no + * error occurred. The string is never NULL. + * + * @note The returned function remains valid until one of the + * following methods is called: #Export, #ExportToBlob, #FreeBlob */ + const char* GetErrorString() const; + + // ------------------------------------------------------------------- + /** Return the blob obtained from the last call to #ExportToBlob */ + const aiExportDataBlob* GetBlob() const; + + // ------------------------------------------------------------------- + /** Orphan the blob from the last call to #ExportToBlob. This means + * the caller takes ownership and is thus responsible for calling + * the C API function #aiReleaseExportBlob to release it. */ + const aiExportDataBlob* GetOrphanedBlob() const; + + // ------------------------------------------------------------------- + /** Frees the current blob. + * + * The function does nothing if no blob has previously been + * previously produced via #ExportToBlob. #FreeBlob is called + * automatically by the destructor. The only reason to call + * it manually would be to reclaim as much storage as possible + * without giving up the #Exporter instance yet. */ + void FreeBlob( ); + + // ------------------------------------------------------------------- + /** Returns the number of export file formats available in the current + * Assimp build. Use #Exporter::GetExportFormatDescription to + * retrieve infos of a specific export format. + * + * This includes built-in exporters as well as exporters registered + * using #RegisterExporter. + **/ + size_t GetExportFormatCount() const; + + // ------------------------------------------------------------------- + /** Returns a description of the nth export file format. Use # + * #Exporter::GetExportFormatCount to learn how many export + * formats are supported. + * + * The returned pointer is of static storage duration if the + * pIndex pertains to a built-in exporter (i.e. one not registered + * via #RegistrerExporter). It is restricted to the life-time of the + * #Exporter instance otherwise. + * + * @param pIndex Index of the export format to retrieve information + * for. Valid range is 0 to #Exporter::GetExportFormatCount + * @return A description of that specific export format. + * NULL if pIndex is out of range. */ + const aiExportFormatDesc* GetExportFormatDescription( size_t pIndex ) const; + + // ------------------------------------------------------------------- + /** Register a custom exporter. Custom export formats are limited to + * to the current #Exporter instance and do not affect the + * library globally. The indexes under which the format's + * export format description can be queried are assigned + * monotonously. + * @param desc Exporter description. + * @return aiReturn_SUCCESS if the export format was successfully + * registered. A common cause that would prevent an exporter + * from being registered is that its format id is already + * occupied by another format. */ + aiReturn RegisterExporter(const ExportFormatEntry& desc); + + // ------------------------------------------------------------------- + /** Remove an export format previously registered with #RegisterExporter + * from the #Exporter instance (this can also be used to drop + * built-in exporters because those are implicitly registered + * using #RegisterExporter). + * @param id Format id to be unregistered, this refers to the + * 'id' field of #aiExportFormatDesc. + * @note Calling this method on a format description not yet registered + * has no effect.*/ + void UnregisterExporter(const char* id); + +protected: + // Just because we don't want you to know how we're hacking around. + ExporterPimpl* pimpl; +}; + +class ASSIMP_API ExportProperties { +public: + // Data type to store the key hash + typedef unsigned int KeyType; + + // typedefs for our four configuration maps. + // We don't need more, so there is no need for a generic solution + typedef std::map IntPropertyMap; + typedef std::map FloatPropertyMap; + typedef std::map StringPropertyMap; + typedef std::map MatrixPropertyMap; + +public: + /** Standard constructor + * @see ExportProperties() + */ + ExportProperties(); + + // ------------------------------------------------------------------- + /** Copy constructor. + * + * This copies the configuration properties of another ExportProperties. + * @see ExportProperties(const ExportProperties& other) + */ + ExportProperties(const ExportProperties& other); + + // ------------------------------------------------------------------- + /** Set an integer configuration property. + * @param szName Name of the property. All supported properties + * are defined in the aiConfig.g header (all constants share the + * prefix AI_CONFIG_XXX and are simple strings). + * @param iValue New value of the property + * @return true if the property was set before. The new value replaces + * the previous value in this case. + * @note Property of different types (float, int, string ..) are kept + * on different stacks, so calling SetPropertyInteger() for a + * floating-point property has no effect - the loader will call + * GetPropertyFloat() to read the property, but it won't be there. + */ + bool SetPropertyInteger(const char* szName, int iValue); + + // ------------------------------------------------------------------- + /** Set a boolean configuration property. Boolean properties + * are stored on the integer stack internally so it's possible + * to set them via #SetPropertyBool and query them with + * #GetPropertyBool and vice versa. + * @see SetPropertyInteger() + */ + bool SetPropertyBool(const char* szName, bool value) { + return SetPropertyInteger(szName,value); + } + + // ------------------------------------------------------------------- + /** Set a floating-point configuration property. + * @see SetPropertyInteger() + */ + bool SetPropertyFloat(const char* szName, ai_real fValue); + + // ------------------------------------------------------------------- + /** Set a string configuration property. + * @see SetPropertyInteger() + */ + bool SetPropertyString(const char* szName, const std::string& sValue); + + // ------------------------------------------------------------------- + /** Set a matrix configuration property. + * @see SetPropertyInteger() + */ + bool SetPropertyMatrix(const char* szName, const aiMatrix4x4& sValue); + + // ------------------------------------------------------------------- + /** Get a configuration property. + * @param szName Name of the property. All supported properties + * are defined in the aiConfig.g header (all constants share the + * prefix AI_CONFIG_XXX). + * @param iErrorReturn Value that is returned if the property + * is not found. + * @return Current value of the property + * @note Property of different types (float, int, string ..) are kept + * on different lists, so calling SetPropertyInteger() for a + * floating-point property has no effect - the loader will call + * GetPropertyFloat() to read the property, but it won't be there. + */ + int GetPropertyInteger(const char* szName, + int iErrorReturn = 0xffffffff) const; + + // ------------------------------------------------------------------- + /** Get a boolean configuration property. Boolean properties + * are stored on the integer stack internally so it's possible + * to set them via #SetPropertyBool and query them with + * #GetPropertyBool and vice versa. + * @see GetPropertyInteger() + */ + bool GetPropertyBool(const char* szName, bool bErrorReturn = false) const { + return GetPropertyInteger(szName,bErrorReturn)!=0; + } + + // ------------------------------------------------------------------- + /** Get a floating-point configuration property + * @see GetPropertyInteger() + */ + ai_real GetPropertyFloat(const char* szName, + ai_real fErrorReturn = 10e10f) const; + + // ------------------------------------------------------------------- + /** Get a string configuration property + * + * The return value remains valid until the property is modified. + * @see GetPropertyInteger() + */ + const std::string GetPropertyString(const char* szName, + const std::string& sErrorReturn = "") const; + + // ------------------------------------------------------------------- + /** Get a matrix configuration property + * + * The return value remains valid until the property is modified. + * @see GetPropertyInteger() + */ + const aiMatrix4x4 GetPropertyMatrix(const char* szName, + const aiMatrix4x4& sErrorReturn = aiMatrix4x4()) const; + + // ------------------------------------------------------------------- + /** Determine a integer configuration property has been set. + * @see HasPropertyInteger() + */ + bool HasPropertyInteger(const char* szName) const; + + /** Determine a boolean configuration property has been set. + * @see HasPropertyBool() + */ + bool HasPropertyBool(const char* szName) const; + + /** Determine a boolean configuration property has been set. + * @see HasPropertyFloat() + */ + bool HasPropertyFloat(const char* szName) const; + + /** Determine a String configuration property has been set. + * @see HasPropertyString() + */ + bool HasPropertyString(const char* szName) const; + + /** Determine a Matrix configuration property has been set. + * @see HasPropertyMatrix() + */ + bool HasPropertyMatrix(const char* szName) const; + +protected: + + /** List of integer properties */ + IntPropertyMap mIntProperties; + + /** List of floating-point properties */ + FloatPropertyMap mFloatProperties; + + /** List of string properties */ + StringPropertyMap mStringProperties; + + /** List of Matrix properties */ + MatrixPropertyMap mMatrixProperties; +}; + +// ---------------------------------------------------------------------------------- +inline +const aiExportDataBlob* Exporter::ExportToBlob( const aiScene* pScene, const std::string& pFormatId, + unsigned int pPreprocessing, const ExportProperties* pProperties) +{ + return ExportToBlob(pScene,pFormatId.c_str(),pPreprocessing, pProperties); +} + +// ---------------------------------------------------------------------------------- +inline +aiReturn Exporter :: Export( const aiScene* pScene, const std::string& pFormatId, + const std::string& pPath, unsigned int pPreprocessing, + const ExportProperties* pProperties) +{ + return Export(pScene,pFormatId.c_str(),pPath.c_str(),pPreprocessing, pProperties); +} + +} // namespace Assimp + +#endif // ASSIMP_BUILD_NO_EXPORT +#endif // AI_EXPORT_HPP_INC diff --git a/engine/inc/assimp/GenericProperty.h b/engine/inc/assimp/GenericProperty.h new file mode 100644 index 00000000..96c74b4c --- /dev/null +++ b/engine/inc/assimp/GenericProperty.h @@ -0,0 +1,127 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +#ifndef AI_GENERIC_PROPERTY_H_INCLUDED +#define AI_GENERIC_PROPERTY_H_INCLUDED + +#include +#include +#include "Hash.h" +#include + + +// ------------------------------------------------------------------------------------------------ +template +inline bool SetGenericProperty(std::map< unsigned int, T >& list, + const char* szName, const T& value) +{ + ai_assert(NULL != szName); + const uint32_t hash = SuperFastHash(szName); + + typename std::map::iterator it = list.find(hash); + if (it == list.end()) { + list.insert(std::pair( hash, value )); + return false; + } + (*it).second = value; + return true; +} + +// ------------------------------------------------------------------------------------------------ +template +inline const T& GetGenericProperty(const std::map< unsigned int, T >& list, + const char* szName, const T& errorReturn) +{ + ai_assert(NULL != szName); + const uint32_t hash = SuperFastHash(szName); + + typename std::map::const_iterator it = list.find(hash); + if (it == list.end()) + return errorReturn; + + return (*it).second; +} + +// ------------------------------------------------------------------------------------------------ +// Special version for pointer types - they will be deleted when replaced with another value +// passing NULL removes the whole property +template +inline void SetGenericPropertyPtr(std::map< unsigned int, T* >& list, + const char* szName, T* value, bool* bWasExisting = NULL) +{ + ai_assert(NULL != szName); + const uint32_t hash = SuperFastHash(szName); + + typename std::map::iterator it = list.find(hash); + if (it == list.end()) { + if (bWasExisting) + *bWasExisting = false; + + list.insert(std::pair( hash, value )); + return; + } + if ((*it).second != value) { + delete (*it).second; + (*it).second = value; + } + if (!value) { + list.erase(it); + } + if (bWasExisting) + *bWasExisting = true; +} + +// ------------------------------------------------------------------------------------------------ +template +inline bool HasGenericProperty(const std::map< unsigned int, T >& list, + const char* szName) +{ + ai_assert(NULL != szName); + const uint32_t hash = SuperFastHash(szName); + + typename std::map::const_iterator it = list.find(hash); + if (it == list.end()) return false; + + return true; +} + +#endif // !! AI_GENERIC_PROPERTY_H_INCLUDED diff --git a/engine/inc/assimp/Hash.h b/engine/inc/assimp/Hash.h new file mode 100644 index 00000000..eb5df757 --- /dev/null +++ b/engine/inc/assimp/Hash.h @@ -0,0 +1,118 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +#ifndef AI_HASH_H_INCLUDED +#define AI_HASH_H_INCLUDED + +#include +#include + +// ------------------------------------------------------------------------------------------------ +// Hashing function taken from +// http://www.azillionmonkeys.com/qed/hash.html +// (incremental version) +// +// This code is Copyright 2004-2008 by Paul Hsieh. It is used here in the belief that +// Assimp's license is considered compatible with Pauls's derivative license as specified +// on his web page. +// +// (stdint.h should have been been included here) +// ------------------------------------------------------------------------------------------------ +#undef get16bits +#if (defined(__GNUC__) && defined(__i386__)) || defined(__WATCOMC__) \ + || defined(_MSC_VER) || defined (__BORLANDC__) || defined (__TURBOC__) +#define get16bits(d) (*((const uint16_t *) (d))) +#endif + +#if !defined (get16bits) +#define get16bits(d) ((((uint32_t)(((const uint8_t *)(d))[1])) << 8)\ + +(uint32_t)(((const uint8_t *)(d))[0]) ) +#endif + +// ------------------------------------------------------------------------------------------------ +inline uint32_t SuperFastHash (const char * data, uint32_t len = 0, uint32_t hash = 0) { +uint32_t tmp; +int rem; + + if (!data) return 0; + if (!len)len = (uint32_t)::strlen(data); + + rem = len & 3; + len >>= 2; + + /* Main loop */ + for (;len > 0; len--) { + hash += get16bits (data); + tmp = (get16bits (data+2) << 11) ^ hash; + hash = (hash << 16) ^ tmp; + data += 2*sizeof (uint16_t); + hash += hash >> 11; + } + + /* Handle end cases */ + switch (rem) { + case 3: hash += get16bits (data); + hash ^= hash << 16; + hash ^= data[sizeof (uint16_t)] << 18; + hash += hash >> 11; + break; + case 2: hash += get16bits (data); + hash ^= hash << 11; + hash += hash >> 17; + break; + case 1: hash += *data; + hash ^= hash << 10; + hash += hash >> 1; + } + + /* Force "avalanching" of final 127 bits */ + hash ^= hash << 3; + hash += hash >> 5; + hash ^= hash << 4; + hash += hash >> 17; + hash ^= hash << 25; + hash += hash >> 6; + + return hash; +} + +#endif // !! AI_HASH_H_INCLUDED diff --git a/engine/inc/assimp/IOStream.hpp b/engine/inc/assimp/IOStream.hpp new file mode 100644 index 00000000..eb2a0f21 --- /dev/null +++ b/engine/inc/assimp/IOStream.hpp @@ -0,0 +1,142 @@ +/* +--------------------------------------------------------------------------- +Open Asset Import Library (assimp) +--------------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the following +conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. +--------------------------------------------------------------------------- +*/ +/** @file IOStream.hpp + * @brief File I/O wrappers for C++. + */ + +#pragma once +#ifndef AI_IOSTREAM_H_INC +#define AI_IOSTREAM_H_INC + +#include "types.h" + +#ifndef __cplusplus +# error This header requires C++ to be used. aiFileIO.h is the \ + corresponding C interface. +#endif + +namespace Assimp { + +// ---------------------------------------------------------------------------------- +/** @brief CPP-API: Class to handle file I/O for C++ + * + * Derive an own implementation from this interface to provide custom IO handling + * to the Importer. If you implement this interface, be sure to also provide an + * implementation for IOSystem that creates instances of your custom IO class. +*/ +class ASSIMP_API IOStream +#ifndef SWIG + : public Intern::AllocateFromAssimpHeap +#endif +{ +protected: + /** Constructor protected, use IOSystem::Open() to create an instance. */ + IOStream(); + +public: + // ------------------------------------------------------------------- + /** @brief Destructor. Deleting the object closes the underlying file, + * alternatively you may use IOSystem::Close() to release the file. + */ + virtual ~IOStream(); + + // ------------------------------------------------------------------- + /** @brief Read from the file + * + * See fread() for more details + * This fails for write-only files */ + virtual size_t Read(void* pvBuffer, + size_t pSize, + size_t pCount) = 0; + + // ------------------------------------------------------------------- + /** @brief Write to the file + * + * See fwrite() for more details + * This fails for read-only files */ + virtual size_t Write(const void* pvBuffer, + size_t pSize, + size_t pCount) = 0; + + // ------------------------------------------------------------------- + /** @brief Set the read/write cursor of the file + * + * Note that the offset is _negative_ for aiOrigin_END. + * See fseek() for more details */ + virtual aiReturn Seek(size_t pOffset, + aiOrigin pOrigin) = 0; + + // ------------------------------------------------------------------- + /** @brief Get the current position of the read/write cursor + * + * See ftell() for more details */ + virtual size_t Tell() const = 0; + + // ------------------------------------------------------------------- + /** @brief Returns filesize + * Returns the filesize. */ + virtual size_t FileSize() const = 0; + + // ------------------------------------------------------------------- + /** @brief Flush the contents of the file buffer (for writers) + * See fflush() for more details. + */ + virtual void Flush() = 0; +}; //! class IOStream + +// ---------------------------------------------------------------------------------- +inline +IOStream::IOStream() { + // empty +} + +// ---------------------------------------------------------------------------------- +inline +IOStream::~IOStream() { + // empty +} +// ---------------------------------------------------------------------------------- + +} //!namespace Assimp + +#endif //!!AI_IOSTREAM_H_INC diff --git a/engine/inc/assimp/IOStreamBuffer.h b/engine/inc/assimp/IOStreamBuffer.h new file mode 100644 index 00000000..c93a191d --- /dev/null +++ b/engine/inc/assimp/IOStreamBuffer.h @@ -0,0 +1,352 @@ +#pragma once + +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above +copyright notice, this list of conditions and the +following disclaimer. + +* Redistributions in binary form must reproduce the above +copyright notice, this list of conditions and the +following disclaimer in the documentation and/or other +materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its +contributors may be used to endorse or promote products +derived from this software without specific prior +written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +#include +#include + +#include "ParsingUtils.h" + +#include + +namespace Assimp { + +// --------------------------------------------------------------------------- +/** + * Implementation of a cached stream buffer. + */ +template +class IOStreamBuffer { +public: + /// @brief The class constructor. + IOStreamBuffer( size_t cache = 4096 * 4096 ); + + /// @brief The class destructor. + ~IOStreamBuffer(); + + /// @brief Will open the cached access for a given stream. + /// @param stream The stream to cache. + /// @return true if successful. + bool open( IOStream *stream ); + + /// @brief Will close the cached access. + /// @return true if successful. + bool close(); + + /// @brief Returns the file-size. + /// @return The file-size. + size_t size() const; + + /// @brief Returns the cache size. + /// @return The cache size. + size_t cacheSize() const; + + /// @brief Will read the next block. + /// @return true if successful. + bool readNextBlock(); + + /// @brief Returns the number of blocks to read. + /// @return The number of blocks. + size_t getNumBlocks() const; + + /// @brief Returns the current block index. + /// @return The current block index. + size_t getCurrentBlockIndex() const; + + /// @brief Returns the current file pos. + /// @return The current file pos. + size_t getFilePos() const; + + /// @brief Will read the next line. + /// @param buffer The buffer for the next line. + /// @return true if successful. + bool getNextDataLine( std::vector &buffer, T continuationToken ); + + /// @brief Will read the next line ascii or binary end line char. + /// @param buffer The buffer for the next line. + /// @return true if successful. + bool getNextLine(std::vector &buffer); + + /// @brief Will read the next block. + /// @param buffer The buffer for the next block. + /// @return true if successful. + bool getNextBlock( std::vector &buffer ); + +private: + IOStream *m_stream; + size_t m_filesize; + size_t m_cacheSize; + size_t m_numBlocks; + size_t m_blockIdx; + std::vector m_cache; + size_t m_cachePos; + size_t m_filePos; +}; + +template +inline +IOStreamBuffer::IOStreamBuffer( size_t cache ) +: m_stream( nullptr ) +, m_filesize( 0 ) +, m_cacheSize( cache ) +, m_numBlocks( 0 ) +, m_blockIdx( 0 ) +, m_cachePos( 0 ) +, m_filePos( 0 ) { + m_cache.resize( cache ); + std::fill( m_cache.begin(), m_cache.end(), '\n' ); +} + +template +inline +IOStreamBuffer::~IOStreamBuffer() { + // empty +} + +template +inline +bool IOStreamBuffer::open( IOStream *stream ) { + // file still opened! + if ( nullptr != m_stream ) { + return false; + } + + // Invalid stream pointer + if ( nullptr == stream ) { + return false; + } + + m_stream = stream; + m_filesize = m_stream->FileSize(); + if ( m_filesize == 0 ) { + return false; + } + if ( m_filesize < m_cacheSize ) { + m_cacheSize = m_filesize; + } + + m_numBlocks = m_filesize / m_cacheSize; + if ( ( m_filesize % m_cacheSize ) > 0 ) { + m_numBlocks++; + } + + return true; +} + +template +inline +bool IOStreamBuffer::close() { + if ( nullptr == m_stream ) { + return false; + } + + // init counters and state vars + m_stream = nullptr; + m_filesize = 0; + m_numBlocks = 0; + m_blockIdx = 0; + m_cachePos = 0; + m_filePos = 0; + + return true; +} + +template +inline +size_t IOStreamBuffer::size() const { + return m_filesize; +} + +template +inline +size_t IOStreamBuffer::cacheSize() const { + return m_cacheSize; +} + +template +inline +bool IOStreamBuffer::readNextBlock() { + m_stream->Seek( m_filePos, aiOrigin_SET ); + size_t readLen = m_stream->Read( &m_cache[ 0 ], sizeof( T ), m_cacheSize ); + if ( readLen == 0 ) { + return false; + } + if ( readLen < m_cacheSize ) { + m_cacheSize = readLen; + } + m_filePos += m_cacheSize; + m_cachePos = 0; + m_blockIdx++; + + return true; +} + +template +inline +size_t IOStreamBuffer::getNumBlocks() const { + return m_numBlocks; +} + +template +inline +size_t IOStreamBuffer::getCurrentBlockIndex() const { + return m_blockIdx; +} + +template +inline +size_t IOStreamBuffer::getFilePos() const { + return m_filePos; +} + +template +inline +bool IOStreamBuffer::getNextDataLine( std::vector &buffer, T continuationToken ) { + buffer.resize( m_cacheSize ); + if ( m_cachePos == m_cacheSize || 0 == m_filePos ) { + if ( !readNextBlock() ) { + return false; + } + } + + bool continuationFound( false ); + size_t i = 0; + for( ;; ) { + if ( continuationToken == m_cache[ m_cachePos ] ) { + continuationFound = true; + ++m_cachePos; + } + if ( IsLineEnd( m_cache[ m_cachePos ] ) ) { + if ( !continuationFound ) { + // the end of the data line + break; + } else { + // skip line end + while ( m_cache[m_cachePos] != '\n') { + ++m_cachePos; + } + ++m_cachePos; + continuationFound = false; + } + } + + buffer[ i ] = m_cache[ m_cachePos ]; + ++m_cachePos; + ++i; + if ( m_cachePos >= m_cacheSize ) { + if ( !readNextBlock() ) { + return false; + } + } + } + + buffer[ i ] = '\n'; + ++m_cachePos; + + return true; +} + +static inline +bool isEndOfCache( size_t pos, size_t cacheSize ) { + return ( pos == cacheSize ); +} + +template +inline +bool IOStreamBuffer::getNextLine(std::vector &buffer) { + buffer.resize(m_cacheSize); + if ( isEndOfCache( m_cachePos, m_cacheSize ) || 0 == m_filePos) { + if (!readNextBlock()) { + return false; + } + } + + if (IsLineEnd(m_cache[m_cachePos])) { + // skip line end + while (m_cache[m_cachePos] != '\n') { + ++m_cachePos; + } + ++m_cachePos; + if ( isEndOfCache( m_cachePos, m_cacheSize ) ) { + if ( !readNextBlock() ) { + return false; + } + } + } + + size_t i( 0 ); + while (!IsLineEnd(m_cache[ m_cachePos ])) { + buffer[i] = m_cache[ m_cachePos ]; + ++m_cachePos; + ++i; + if (m_cachePos >= m_cacheSize) { + if (!readNextBlock()) { + return false; + } + } + } + buffer[i] = '\n'; + ++m_cachePos; + + return true; +} + +template +inline +bool IOStreamBuffer::getNextBlock( std::vector &buffer) { + // Return the last block-value if getNextLine was used before + if ( 0 != m_cachePos ) { + buffer = std::vector( m_cache.begin() + m_cachePos, m_cache.end() ); + m_cachePos = 0; + } else { + if ( !readNextBlock() ) { + return false; + } + + buffer = std::vector(m_cache.begin(), m_cache.end()); + } + + return true; +} + +} // !ns Assimp diff --git a/engine/inc/assimp/IOSystem.hpp b/engine/inc/assimp/IOSystem.hpp new file mode 100644 index 00000000..1530492c --- /dev/null +++ b/engine/inc/assimp/IOSystem.hpp @@ -0,0 +1,360 @@ +/* +--------------------------------------------------------------------------- +Open Asset Import Library (assimp) +--------------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the following +conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. +--------------------------------------------------------------------------- +*/ + +/** @file IOSystem.hpp + * @brief File system wrapper for C++. Inherit this class to supply + * custom file handling logic to the Import library. +*/ + +#pragma once +#ifndef AI_IOSYSTEM_H_INC +#define AI_IOSYSTEM_H_INC + +#ifndef __cplusplus +# error This header requires C++ to be used. aiFileIO.h is the \ + corresponding C interface. +#endif + +#include "types.h" + +#ifdef _WIN32 +# include +# include +# include +#else +# include +# include +# include +#endif // _WIN32 + +#include + +namespace Assimp { + + class IOStream; + +// --------------------------------------------------------------------------- +/** @brief CPP-API: Interface to the file system. + * + * Derive an own implementation from this interface to supply custom file handling + * to the importer library. If you implement this interface, you also want to + * supply a custom implementation for IOStream. + * + * @see Importer::SetIOHandler() + */ +class ASSIMP_API IOSystem +#ifndef SWIG + : public Intern::AllocateFromAssimpHeap +#endif +{ +public: + + // ------------------------------------------------------------------- + /** @brief Default constructor. + * + * Create an instance of your derived class and assign it to an + * #Assimp::Importer instance by calling Importer::SetIOHandler(). + */ + IOSystem(); + + // ------------------------------------------------------------------- + /** @brief Virtual destructor. + * + * It is safe to be called from within DLL Assimp, we're constructed + * on Assimp's heap. + */ + virtual ~IOSystem(); + + +public: + + // ------------------------------------------------------------------- + /** @brief For backward compatibility + * @see Exists(const char*) + */ + AI_FORCE_INLINE bool Exists( const std::string& pFile) const; + + // ------------------------------------------------------------------- + /** @brief Tests for the existence of a file at the given path. + * + * @param pFile Path to the file + * @return true if there is a file with this path, else false. + */ + virtual bool Exists( const char* pFile) const = 0; + + // ------------------------------------------------------------------- + /** @brief Returns the system specific directory separator + * @return System specific directory separator + */ + virtual char getOsSeparator() const = 0; + + // ------------------------------------------------------------------- + /** @brief Open a new file with a given path. + * + * When the access to the file is finished, call Close() to release + * all associated resources (or the virtual dtor of the IOStream). + * + * @param pFile Path to the file + * @param pMode Desired file I/O mode. Required are: "wb", "w", "wt", + * "rb", "r", "rt". + * + * @return New IOStream interface allowing the lib to access + * the underlying file. + * @note When implementing this class to provide custom IO handling, + * you probably have to supply an own implementation of IOStream as well. + */ + virtual IOStream* Open(const char* pFile, + const char* pMode = "rb") = 0; + + // ------------------------------------------------------------------- + /** @brief For backward compatibility + * @see Open(const char*, const char*) + */ + inline IOStream* Open(const std::string& pFile, + const std::string& pMode = std::string("rb")); + + // ------------------------------------------------------------------- + /** @brief Closes the given file and releases all resources + * associated with it. + * @param pFile The file instance previously created by Open(). + */ + virtual void Close( IOStream* pFile) = 0; + + // ------------------------------------------------------------------- + /** @brief Compares two paths and check whether the point to + * identical files. + * + * The dummy implementation of this virtual member performs a + * case-insensitive comparison of the given strings. The default IO + * system implementation uses OS mechanisms to convert relative into + * absolute paths, so the result can be trusted. + * @param one First file + * @param second Second file + * @return true if the paths point to the same file. The file needn't + * be existing, however. + */ + virtual bool ComparePaths (const char* one, + const char* second) const; + + // ------------------------------------------------------------------- + /** @brief For backward compatibility + * @see ComparePaths(const char*, const char*) + */ + inline bool ComparePaths (const std::string& one, + const std::string& second) const; + + // ------------------------------------------------------------------- + /** @brief Pushes a new directory onto the directory stack. + * @param path Path to push onto the stack. + * @return True, when push was successful, false if path is empty. + */ + virtual bool PushDirectory( const std::string &path ); + + // ------------------------------------------------------------------- + /** @brief Returns the top directory from the stack. + * @return The directory on the top of the stack. + * Returns empty when no directory was pushed to the stack. + */ + virtual const std::string &CurrentDirectory() const; + + // ------------------------------------------------------------------- + /** @brief Returns the number of directories stored on the stack. + * @return The number of directories of the stack. + */ + virtual size_t StackSize() const; + + // ------------------------------------------------------------------- + /** @brief Pops the top directory from the stack. + * @return True, when a directory was on the stack. False if no + * directory was on the stack. + */ + virtual bool PopDirectory(); + + // ------------------------------------------------------------------- + /** @brief CReates an new directory at the given path. + * @param path [in] The path to create. + * @return True, when a directory was created. False if the directory + * cannot be created. + */ + virtual bool CreateDirectory( const std::string &path ); + + // ------------------------------------------------------------------- + /** @brief Will change the current directory to the given path. + * @param path [in] The path to change to. + * @return True, when the directory has changed successfully. + */ + virtual bool ChangeDirectory( const std::string &path ); + + virtual bool DeleteFile( const std::string &file ); + +private: + std::vector m_pathStack; +}; + +// ---------------------------------------------------------------------------- +AI_FORCE_INLINE +IOSystem::IOSystem() +: m_pathStack() { + // empty +} + +// ---------------------------------------------------------------------------- +AI_FORCE_INLINE +IOSystem::~IOSystem() { + // empty +} + +// ---------------------------------------------------------------------------- +// For compatibility, the interface of some functions taking a std::string was +// changed to const char* to avoid crashes between binary incompatible STL +// versions. This code her is inlined, so it shouldn't cause any problems. +// ---------------------------------------------------------------------------- + +// ---------------------------------------------------------------------------- +AI_FORCE_INLINE +IOStream* IOSystem::Open(const std::string& pFile, const std::string& pMode) { + // NOTE: + // For compatibility, interface was changed to const char* to + // avoid crashes between binary incompatible STL versions + return Open(pFile.c_str(),pMode.c_str()); +} + +// ---------------------------------------------------------------------------- +AI_FORCE_INLINE +bool IOSystem::Exists( const std::string& pFile) const { + // NOTE: + // For compatibility, interface was changed to const char* to + // avoid crashes between binary incompatible STL versions + return Exists(pFile.c_str()); +} + +// ---------------------------------------------------------------------------- +AI_FORCE_INLINE +bool IOSystem::ComparePaths (const std::string& one, const std::string& second) const { + // NOTE: + // For compatibility, interface was changed to const char* to + // avoid crashes between binary incompatible STL versions + return ComparePaths(one.c_str(),second.c_str()); +} + +// ---------------------------------------------------------------------------- +AI_FORCE_INLINE +bool IOSystem::PushDirectory( const std::string &path ) { + if ( path.empty() ) { + return false; + } + + m_pathStack.push_back( path ); + + return true; +} + +// ---------------------------------------------------------------------------- +AI_FORCE_INLINE +const std::string &IOSystem::CurrentDirectory() const { + if ( m_pathStack.empty() ) { + static const std::string Dummy(""); + return Dummy; + } + return m_pathStack[ m_pathStack.size()-1 ]; +} + +// ---------------------------------------------------------------------------- +AI_FORCE_INLINE +size_t IOSystem::StackSize() const { + return m_pathStack.size(); +} + +// ---------------------------------------------------------------------------- +AI_FORCE_INLINE +bool IOSystem::PopDirectory() { + if ( m_pathStack.empty() ) { + return false; + } + + m_pathStack.pop_back(); + + return true; +} + +// ---------------------------------------------------------------------------- +AI_FORCE_INLINE +bool IOSystem::CreateDirectory( const std::string &path ) { + if ( path.empty() ) { + return false; + } + +#ifdef _WIN32 + return 0 != ::_mkdir( path.c_str() ); +#else + return 0 != ::mkdir( path.c_str(), 0777 ); +#endif // _WIN32 +} + +// ---------------------------------------------------------------------------- +AI_FORCE_INLINE +bool IOSystem::ChangeDirectory( const std::string &path ) { + if ( path.empty() ) { + return false; + } + +#ifdef _WIN32 + return 0 != ::_chdir( path.c_str() ); +#else + return 0 != ::chdir( path.c_str() ); +#endif // _WIN32 +} + + +// ---------------------------------------------------------------------------- +AI_FORCE_INLINE +bool IOSystem::DeleteFile( const std::string &file ) { + if ( file.empty() ) { + return false; + } + const int retCode( ::remove( file.c_str() ) ); + return ( 0 == retCode ); +} +} //!ns Assimp + +#endif //AI_IOSYSTEM_H_INC diff --git a/engine/inc/assimp/Importer.hpp b/engine/inc/assimp/Importer.hpp new file mode 100644 index 00000000..7445c979 --- /dev/null +++ b/engine/inc/assimp/Importer.hpp @@ -0,0 +1,659 @@ +/* +--------------------------------------------------------------------------- +Open Asset Import Library (assimp) +--------------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the following +conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. +--------------------------------------------------------------------------- +*/ + +/** @file Importer.hpp + * @brief Defines the C++-API to the Open Asset Import Library. + */ +#pragma once +#ifndef AI_ASSIMP_HPP_INC +#define AI_ASSIMP_HPP_INC + +#ifndef __cplusplus +# error This header requires C++ to be used. Use assimp.h for plain C. +#endif // __cplusplus + +// Public ASSIMP data structures +#include + +namespace Assimp { + // ======================================================================= + // Public interface to Assimp + class Importer; + class IOStream; + class IOSystem; + class ProgressHandler; + + // ======================================================================= + // Plugin development + // + // Include the following headers for the declarations: + // BaseImporter.h + // BaseProcess.h + class BaseImporter; + class BaseProcess; + class SharedPostProcessInfo; + class BatchLoader; + + // ======================================================================= + // Holy stuff, only for members of the high council of the Jedi. + class ImporterPimpl; +} //! namespace Assimp + +#define AI_PROPERTY_WAS_NOT_EXISTING 0xffffffff + +struct aiScene; + +// importerdesc.h +struct aiImporterDesc; + +/** @namespace Assimp Assimp's CPP-API and all internal APIs */ +namespace Assimp { + +// ---------------------------------------------------------------------------------- +/** CPP-API: The Importer class forms an C++ interface to the functionality of the +* Open Asset Import Library. +* +* Create an object of this class and call ReadFile() to import a file. +* If the import succeeds, the function returns a pointer to the imported data. +* The data remains property of the object, it is intended to be accessed +* read-only. The imported data will be destroyed along with the Importer +* object. If the import fails, ReadFile() returns a NULL pointer. In this +* case you can retrieve a human-readable error description be calling +* GetErrorString(). You can call ReadFile() multiple times with a single Importer +* instance. Actually, constructing Importer objects involves quite many +* allocations and may take some time, so it's better to reuse them as often as +* possible. +* +* If you need the Importer to do custom file handling to access the files, +* implement IOSystem and IOStream and supply an instance of your custom +* IOSystem implementation by calling SetIOHandler() before calling ReadFile(). +* If you do not assign a custion IO handler, a default handler using the +* standard C++ IO logic will be used. +* +* @note One Importer instance is not thread-safe. If you use multiple +* threads for loading, each thread should maintain its own Importer instance. +*/ +class ASSIMP_API Importer { +public: + /** + * @brief The upper limit for hints. + */ + static const unsigned int MaxLenHint = 200; + +public: + + // ------------------------------------------------------------------- + /** Constructor. Creates an empty importer object. + * + * Call ReadFile() to start the import process. The configuration + * property table is initially empty. + */ + Importer(); + + // ------------------------------------------------------------------- + /** Copy constructor. + * + * This copies the configuration properties of another Importer. + * If this Importer owns a scene it won't be copied. + * Call ReadFile() to start the import process. + */ + Importer(const Importer& other)=delete; + + // ------------------------------------------------------------------- + /** Assignment operator has been deleted + */ + Importer &operator=(const Importer &) = delete; + + // ------------------------------------------------------------------- + /** Destructor. The object kept ownership of the imported data, + * which now will be destroyed along with the object. + */ + ~Importer(); + + + // ------------------------------------------------------------------- + /** Registers a new loader. + * + * @param pImp Importer to be added. The Importer instance takes + * ownership of the pointer, so it will be automatically deleted + * with the Importer instance. + * @return AI_SUCCESS if the loader has been added. The registration + * fails if there is already a loader for a specific file extension. + */ + aiReturn RegisterLoader(BaseImporter* pImp); + + // ------------------------------------------------------------------- + /** Unregisters a loader. + * + * @param pImp Importer to be unregistered. + * @return AI_SUCCESS if the loader has been removed. The function + * fails if the loader is currently in use (this could happen + * if the #Importer instance is used by more than one thread) or + * if it has not yet been registered. + */ + aiReturn UnregisterLoader(BaseImporter* pImp); + + // ------------------------------------------------------------------- + /** Registers a new post-process step. + * + * At the moment, there's a small limitation: new post processing + * steps are added to end of the list, or in other words, executed + * last, after all built-in steps. + * @param pImp Post-process step to be added. The Importer instance + * takes ownership of the pointer, so it will be automatically + * deleted with the Importer instance. + * @return AI_SUCCESS if the step has been added correctly. + */ + aiReturn RegisterPPStep(BaseProcess* pImp); + + // ------------------------------------------------------------------- + /** Unregisters a post-process step. + * + * @param pImp Step to be unregistered. + * @return AI_SUCCESS if the step has been removed. The function + * fails if the step is currently in use (this could happen + * if the #Importer instance is used by more than one thread) or + * if it has not yet been registered. + */ + aiReturn UnregisterPPStep(BaseProcess* pImp); + + // ------------------------------------------------------------------- + /** Set an integer configuration property. + * @param szName Name of the property. All supported properties + * are defined in the aiConfig.g header (all constants share the + * prefix AI_CONFIG_XXX and are simple strings). + * @param iValue New value of the property + * @return true if the property was set before. The new value replaces + * the previous value in this case. + * @note Property of different types (float, int, string ..) are kept + * on different stacks, so calling SetPropertyInteger() for a + * floating-point property has no effect - the loader will call + * GetPropertyFloat() to read the property, but it won't be there. + */ + bool SetPropertyInteger(const char* szName, int iValue); + + // ------------------------------------------------------------------- + /** Set a boolean configuration property. Boolean properties + * are stored on the integer stack internally so it's possible + * to set them via #SetPropertyBool and query them with + * #GetPropertyBool and vice versa. + * @see SetPropertyInteger() + */ + bool SetPropertyBool(const char* szName, bool value) { + return SetPropertyInteger(szName,value); + } + + // ------------------------------------------------------------------- + /** Set a floating-point configuration property. + * @see SetPropertyInteger() + */ + bool SetPropertyFloat(const char* szName, ai_real fValue); + + // ------------------------------------------------------------------- + /** Set a string configuration property. + * @see SetPropertyInteger() + */ + bool SetPropertyString(const char* szName, const std::string& sValue); + + // ------------------------------------------------------------------- + /** Set a matrix configuration property. + * @see SetPropertyInteger() + */ + bool SetPropertyMatrix(const char* szName, const aiMatrix4x4& sValue); + + // ------------------------------------------------------------------- + /** Get a configuration property. + * @param szName Name of the property. All supported properties + * are defined in the aiConfig.g header (all constants share the + * prefix AI_CONFIG_XXX). + * @param iErrorReturn Value that is returned if the property + * is not found. + * @return Current value of the property + * @note Property of different types (float, int, string ..) are kept + * on different lists, so calling SetPropertyInteger() for a + * floating-point property has no effect - the loader will call + * GetPropertyFloat() to read the property, but it won't be there. + */ + int GetPropertyInteger(const char* szName, + int iErrorReturn = 0xffffffff) const; + + // ------------------------------------------------------------------- + /** Get a boolean configuration property. Boolean properties + * are stored on the integer stack internally so it's possible + * to set them via #SetPropertyBool and query them with + * #GetPropertyBool and vice versa. + * @see GetPropertyInteger() + */ + bool GetPropertyBool(const char* szName, bool bErrorReturn = false) const { + return GetPropertyInteger(szName,bErrorReturn)!=0; + } + + // ------------------------------------------------------------------- + /** Get a floating-point configuration property + * @see GetPropertyInteger() + */ + ai_real GetPropertyFloat(const char* szName, + ai_real fErrorReturn = 10e10) const; + + // ------------------------------------------------------------------- + /** Get a string configuration property + * + * The return value remains valid until the property is modified. + * @see GetPropertyInteger() + */ + const std::string GetPropertyString(const char* szName, + const std::string& sErrorReturn = "") const; + + // ------------------------------------------------------------------- + /** Get a matrix configuration property + * + * The return value remains valid until the property is modified. + * @see GetPropertyInteger() + */ + const aiMatrix4x4 GetPropertyMatrix(const char* szName, + const aiMatrix4x4& sErrorReturn = aiMatrix4x4()) const; + + // ------------------------------------------------------------------- + /** Supplies a custom IO handler to the importer to use to open and + * access files. If you need the importer to use custom IO logic to + * access the files, you need to provide a custom implementation of + * IOSystem and IOFile to the importer. Then create an instance of + * your custom IOSystem implementation and supply it by this function. + * + * The Importer takes ownership of the object and will destroy it + * afterwards. The previously assigned handler will be deleted. + * Pass NULL to take again ownership of your IOSystem and reset Assimp + * to use its default implementation. + * + * @param pIOHandler The IO handler to be used in all file accesses + * of the Importer. + */ + void SetIOHandler( IOSystem* pIOHandler); + + // ------------------------------------------------------------------- + /** Retrieves the IO handler that is currently set. + * You can use #IsDefaultIOHandler() to check whether the returned + * interface is the default IO handler provided by ASSIMP. The default + * handler is active as long the application doesn't supply its own + * custom IO handler via #SetIOHandler(). + * @return A valid IOSystem interface, never NULL. + */ + IOSystem* GetIOHandler() const; + + // ------------------------------------------------------------------- + /** Checks whether a default IO handler is active + * A default handler is active as long the application doesn't + * supply its own custom IO handler via #SetIOHandler(). + * @return true by default + */ + bool IsDefaultIOHandler() const; + + // ------------------------------------------------------------------- + /** Supplies a custom progress handler to the importer. This + * interface exposes a #Update() callback, which is called + * more or less periodically (please don't sue us if it + * isn't as periodically as you'd like it to have ...). + * This can be used to implement progress bars and loading + * timeouts. + * @param pHandler Progress callback interface. Pass NULL to + * disable progress reporting. + * @note Progress handlers can be used to abort the loading + * at almost any time.*/ + void SetProgressHandler ( ProgressHandler* pHandler ); + + // ------------------------------------------------------------------- + /** Retrieves the progress handler that is currently set. + * You can use #IsDefaultProgressHandler() to check whether the returned + * interface is the default handler provided by ASSIMP. The default + * handler is active as long the application doesn't supply its own + * custom handler via #SetProgressHandler(). + * @return A valid ProgressHandler interface, never NULL. + */ + ProgressHandler* GetProgressHandler() const; + + // ------------------------------------------------------------------- + /** Checks whether a default progress handler is active + * A default handler is active as long the application doesn't + * supply its own custom progress handler via #SetProgressHandler(). + * @return true by default + */ + bool IsDefaultProgressHandler() const; + + // ------------------------------------------------------------------- + /** @brief Check whether a given set of post-processing flags + * is supported. + * + * Some flags are mutually exclusive, others are probably + * not available because your excluded them from your + * Assimp builds. Calling this function is recommended if + * you're unsure. + * + * @param pFlags Bitwise combination of the aiPostProcess flags. + * @return true if this flag combination is fine. + */ + bool ValidateFlags(unsigned int pFlags) const; + + // ------------------------------------------------------------------- + /** Reads the given file and returns its contents if successful. + * + * If the call succeeds, the contents of the file are returned as a + * pointer to an aiScene object. The returned data is intended to be + * read-only, the importer object keeps ownership of the data and will + * destroy it upon destruction. If the import fails, NULL is returned. + * A human-readable error description can be retrieved by calling + * GetErrorString(). The previous scene will be deleted during this call. + * @param pFile Path and filename to the file to be imported. + * @param pFlags Optional post processing steps to be executed after + * a successful import. Provide a bitwise combination of the + * #aiPostProcessSteps flags. If you wish to inspect the imported + * scene first in order to fine-tune your post-processing setup, + * consider to use #ApplyPostProcessing(). + * @return A pointer to the imported data, NULL if the import failed. + * The pointer to the scene remains in possession of the Importer + * instance. Use GetOrphanedScene() to take ownership of it. + * + * @note Assimp is able to determine the file format of a file + * automatically. + */ + const aiScene* ReadFile( + const char* pFile, + unsigned int pFlags); + + // ------------------------------------------------------------------- + /** Reads the given file from a memory buffer and returns its + * contents if successful. + * + * If the call succeeds, the contents of the file are returned as a + * pointer to an aiScene object. The returned data is intended to be + * read-only, the importer object keeps ownership of the data and will + * destroy it upon destruction. If the import fails, NULL is returned. + * A human-readable error description can be retrieved by calling + * GetErrorString(). The previous scene will be deleted during this call. + * Calling this method doesn't affect the active IOSystem. + * @param pBuffer Pointer to the file data + * @param pLength Length of pBuffer, in bytes + * @param pFlags Optional post processing steps to be executed after + * a successful import. Provide a bitwise combination of the + * #aiPostProcessSteps flags. If you wish to inspect the imported + * scene first in order to fine-tune your post-processing setup, + * consider to use #ApplyPostProcessing(). + * @param pHint An additional hint to the library. If this is a non + * empty string, the library looks for a loader to support + * the file extension specified by pHint and passes the file to + * the first matching loader. If this loader is unable to completely + * the request, the library continues and tries to determine the + * file format on its own, a task that may or may not be successful. + * Check the return value, and you'll know ... + * @return A pointer to the imported data, NULL if the import failed. + * The pointer to the scene remains in possession of the Importer + * instance. Use GetOrphanedScene() to take ownership of it. + * + * @note This is a straightforward way to decode models from memory + * buffers, but it doesn't handle model formats that spread their + * data across multiple files or even directories. Examples include + * OBJ or MD3, which outsource parts of their material info into + * external scripts. If you need full functionality, provide + * a custom IOSystem to make Assimp find these files and use + * the regular ReadFile() API. + */ + const aiScene* ReadFileFromMemory( + const void* pBuffer, + size_t pLength, + unsigned int pFlags, + const char* pHint = ""); + + // ------------------------------------------------------------------- + /** Apply post-processing to an already-imported scene. + * + * This is strictly equivalent to calling #ReadFile() with the same + * flags. However, you can use this separate function to inspect + * the imported scene first to fine-tune your post-processing setup. + * @param pFlags Provide a bitwise combination of the + * #aiPostProcessSteps flags. + * @return A pointer to the post-processed data. This is still the + * same as the pointer returned by #ReadFile(). However, if + * post-processing fails, the scene could now be NULL. + * That's quite a rare case, post processing steps are not really + * designed to 'fail'. To be exact, the #aiProcess_ValidateDS + * flag is currently the only post processing step which can actually + * cause the scene to be reset to NULL. + * + * @note The method does nothing if no scene is currently bound + * to the #Importer instance. */ + const aiScene* ApplyPostProcessing(unsigned int pFlags); + + const aiScene* ApplyCustomizedPostProcessing( BaseProcess *rootProcess, bool requestValidation ); + + // ------------------------------------------------------------------- + /** @brief Reads the given file and returns its contents if successful. + * + * This function is provided for backward compatibility. + * See the const char* version for detailed docs. + * @see ReadFile(const char*, pFlags) */ + const aiScene* ReadFile( + const std::string& pFile, + unsigned int pFlags); + + // ------------------------------------------------------------------- + /** Frees the current scene. + * + * The function does nothing if no scene has previously been + * read via ReadFile(). FreeScene() is called automatically by the + * destructor and ReadFile() itself. */ + void FreeScene( ); + + // ------------------------------------------------------------------- + /** Returns an error description of an error that occurred in ReadFile(). + * + * Returns an empty string if no error occurred. + * @return A description of the last error, an empty string if no + * error occurred. The string is never NULL. + * + * @note The returned function remains valid until one of the + * following methods is called: #ReadFile(), #FreeScene(). */ + const char* GetErrorString() const; + + // ------------------------------------------------------------------- + /** Returns the scene loaded by the last successful call to ReadFile() + * + * @return Current scene or NULL if there is currently no scene loaded */ + const aiScene* GetScene() const; + + // ------------------------------------------------------------------- + /** Returns the scene loaded by the last successful call to ReadFile() + * and releases the scene from the ownership of the Importer + * instance. The application is now responsible for deleting the + * scene. Any further calls to GetScene() or GetOrphanedScene() + * will return NULL - until a new scene has been loaded via ReadFile(). + * + * @return Current scene or NULL if there is currently no scene loaded + * @note Use this method with maximal caution, and only if you have to. + * By design, aiScene's are exclusively maintained, allocated and + * deallocated by Assimp and no one else. The reasoning behind this + * is the golden rule that deallocations should always be done + * by the module that did the original allocation because heaps + * are not necessarily shared. GetOrphanedScene() enforces you + * to delete the returned scene by yourself, but this will only + * be fine if and only if you're using the same heap as assimp. + * On Windows, it's typically fine provided everything is linked + * against the multithreaded-dll version of the runtime library. + * It will work as well for static linkage with Assimp.*/ + aiScene* GetOrphanedScene(); + + // ------------------------------------------------------------------- + /** Returns whether a given file extension is supported by ASSIMP. + * + * @param szExtension Extension to be checked. + * Must include a trailing dot '.'. Example: ".3ds", ".md3". + * Cases-insensitive. + * @return true if the extension is supported, false otherwise */ + bool IsExtensionSupported(const char* szExtension) const; + + // ------------------------------------------------------------------- + /** @brief Returns whether a given file extension is supported by ASSIMP. + * + * This function is provided for backward compatibility. + * See the const char* version for detailed and up-to-date docs. + * @see IsExtensionSupported(const char*) */ + inline bool IsExtensionSupported(const std::string& szExtension) const; + + // ------------------------------------------------------------------- + /** Get a full list of all file extensions supported by ASSIMP. + * + * If a file extension is contained in the list this does of course not + * mean that ASSIMP is able to load all files with this extension --- + * it simply means there is an importer loaded which claims to handle + * files with this file extension. + * @param szOut String to receive the extension list. + * Format of the list: "*.3ds;*.obj;*.dae". This is useful for + * use with the WinAPI call GetOpenFileName(Ex). */ + void GetExtensionList(aiString& szOut) const; + + // ------------------------------------------------------------------- + /** @brief Get a full list of all file extensions supported by ASSIMP. + * + * This function is provided for backward compatibility. + * See the aiString version for detailed and up-to-date docs. + * @see GetExtensionList(aiString&)*/ + inline void GetExtensionList(std::string& szOut) const; + + // ------------------------------------------------------------------- + /** Get the number of importers currently registered with Assimp. */ + size_t GetImporterCount() const; + + // ------------------------------------------------------------------- + /** Get meta data for the importer corresponding to a specific index.. + * + * For the declaration of #aiImporterDesc, include . + * @param index Index to query, must be within [0,GetImporterCount()) + * @return Importer meta data structure, NULL if the index does not + * exist or if the importer doesn't offer meta information ( + * importers may do this at the cost of being hated by their peers).*/ + const aiImporterDesc* GetImporterInfo(size_t index) const; + + // ------------------------------------------------------------------- + /** Find the importer corresponding to a specific index. + * + * @param index Index to query, must be within [0,GetImporterCount()) + * @return Importer instance. NULL if the index does not + * exist. */ + BaseImporter* GetImporter(size_t index) const; + + // ------------------------------------------------------------------- + /** Find the importer corresponding to a specific file extension. + * + * This is quite similar to #IsExtensionSupported except a + * BaseImporter instance is returned. + * @param szExtension Extension to check for. The following formats + * are recognized (BAH being the file extension): "BAH" (comparison + * is case-insensitive), ".bah", "*.bah" (wild card and dot + * characters at the beginning of the extension are skipped). + * @return NULL if no importer is found*/ + BaseImporter* GetImporter (const char* szExtension) const; + + // ------------------------------------------------------------------- + /** Find the importer index corresponding to a specific file extension. + * + * @param szExtension Extension to check for. The following formats + * are recognized (BAH being the file extension): "BAH" (comparison + * is case-insensitive), ".bah", "*.bah" (wild card and dot + * characters at the beginning of the extension are skipped). + * @return (size_t)-1 if no importer is found */ + size_t GetImporterIndex (const char* szExtension) const; + + // ------------------------------------------------------------------- + /** Returns the storage allocated by ASSIMP to hold the scene data + * in memory. + * + * This refers to the currently loaded file, see #ReadFile(). + * @param in Data structure to be filled. + * @note The returned memory statistics refer to the actual + * size of the use data of the aiScene. Heap-related overhead + * is (naturally) not included.*/ + void GetMemoryRequirements(aiMemoryInfo& in) const; + + // ------------------------------------------------------------------- + /** Enables "extra verbose" mode. + * + * 'Extra verbose' means the data structure is validated after *every* + * single post processing step to make sure everyone modifies the data + * structure in a well-defined manner. This is a debug feature and not + * intended for use in production environments. */ + void SetExtraVerbose(bool bDo); + + // ------------------------------------------------------------------- + /** Private, do not use. */ + ImporterPimpl* Pimpl() { return pimpl; } + const ImporterPimpl* Pimpl() const { return pimpl; } + +protected: + + // Just because we don't want you to know how we're hacking around. + ImporterPimpl* pimpl; +}; //! class Importer + + +// ---------------------------------------------------------------------------- +// For compatibility, the interface of some functions taking a std::string was +// changed to const char* to avoid crashes between binary incompatible STL +// versions. This code her is inlined, so it shouldn't cause any problems. +// ---------------------------------------------------------------------------- + +// ---------------------------------------------------------------------------- +AI_FORCE_INLINE const aiScene* Importer::ReadFile( const std::string& pFile,unsigned int pFlags){ + return ReadFile(pFile.c_str(),pFlags); +} +// ---------------------------------------------------------------------------- +AI_FORCE_INLINE void Importer::GetExtensionList(std::string& szOut) const { + aiString s; + GetExtensionList(s); + szOut = s.data; +} +// ---------------------------------------------------------------------------- +AI_FORCE_INLINE bool Importer::IsExtensionSupported(const std::string& szExtension) const { + return IsExtensionSupported(szExtension.c_str()); +} + +} // !namespace Assimp + +#endif // AI_ASSIMP_HPP_INC diff --git a/engine/inc/assimp/LineSplitter.h b/engine/inc/assimp/LineSplitter.h new file mode 100644 index 00000000..e5ac98d8 --- /dev/null +++ b/engine/inc/assimp/LineSplitter.h @@ -0,0 +1,244 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +/** @file LineSplitter.h + * @brief LineSplitter, a helper class to iterate through all lines + * of a file easily. Works with StreamReader. + */ +#ifndef INCLUDED_LINE_SPLITTER_H +#define INCLUDED_LINE_SPLITTER_H + +#include + +#include "StreamReader.h" +#include "ParsingUtils.h" + +namespace Assimp { + +// ------------------------------------------------------------------------------------------------ +/** Usage: +@code +for(LineSplitter splitter(stream);splitter;++splitter) { + + if (*splitter == "hi!") { + ... + } + else if (splitter->substr(0,5) == "hello") { + ... + // access the third token in the line (tokens are space-separated) + if (strtol(splitter[2]) > 5) { .. } + } + + std::cout << "Current line is: " << splitter.get_index() << std::endl; +} +@endcode +*/ +// ------------------------------------------------------------------------------------------------ +class LineSplitter { +public: + typedef size_t line_idx; + + // ----------------------------------------- + /** construct from existing stream reader + note: trim is *always* assumed true if skyp_empty_lines==true + */ + LineSplitter(StreamReaderLE& stream, bool skip_empty_lines = true, bool trim = true) + : idx( 0 ) + , stream(stream) + , swallow() + , skip_empty_lines(skip_empty_lines) + , trim(trim) { + cur.reserve(1024); + operator++(); + + idx = 0; + } + + ~LineSplitter() { + // empty + } + +public: + + // ----------------------------------------- + /** pseudo-iterator increment */ + LineSplitter& operator++() { + if(swallow) { + swallow = false; + return *this; + } + if (!*this) { + throw std::logic_error("End of file, no more lines to be retrieved."); + } + char s; + cur.clear(); + while(stream.GetRemainingSize() && (s = stream.GetI1(),1)) { + if (s == '\n' || s == '\r') { + if (skip_empty_lines) { + while (stream.GetRemainingSize() && ((s = stream.GetI1()) == ' ' || s == '\r' || s == '\n')); + if (stream.GetRemainingSize()) { + stream.IncPtr(-1); + } + } + else { + // skip both potential line terminators but don't read past this line. + if (stream.GetRemainingSize() && (s == '\r' && stream.GetI1() != '\n')) { + stream.IncPtr(-1); + } + if (trim) { + while (stream.GetRemainingSize() && ((s = stream.GetI1()) == ' ' || s == '\t')); + if (stream.GetRemainingSize()) { + stream.IncPtr(-1); + } + } + } + break; + } + cur += s; + } + ++idx; + return *this; + } + + // ----------------------------------------- + LineSplitter& operator++(int) { + return ++(*this); + } + + // ----------------------------------------- + /** get a pointer to the beginning of a particular token */ + const char* operator[] (size_t idx) const { + const char* s = operator->()->c_str(); + + SkipSpaces(&s); + for(size_t i = 0; i < idx; ++i) { + + for(;!IsSpace(*s); ++s) { + if(IsLineEnd(*s)) { + throw std::range_error("Token index out of range, EOL reached"); + } + } + SkipSpaces(&s); + } + return s; + } + + // ----------------------------------------- + /** extract the start positions of N tokens from the current line*/ + template + void get_tokens(const char* (&tokens)[N]) const { + const char* s = operator->()->c_str(); + + SkipSpaces(&s); + for(size_t i = 0; i < N; ++i) { + if(IsLineEnd(*s)) { + + throw std::range_error("Token count out of range, EOL reached"); + + } + tokens[i] = s; + + for(;*s && !IsSpace(*s); ++s); + SkipSpaces(&s); + } + } + + // ----------------------------------------- + /** member access */ + const std::string* operator -> () const { + return &cur; + } + + std::string operator* () const { + return cur; + } + + // ----------------------------------------- + /** boolean context */ + operator bool() const { + return stream.GetRemainingSize()>0; + } + + // ----------------------------------------- + /** line indices are zero-based, empty lines are included */ + operator line_idx() const { + return idx; + } + + line_idx get_index() const { + return idx; + } + + // ----------------------------------------- + /** access the underlying stream object */ + StreamReaderLE& get_stream() { + return stream; + } + + // ----------------------------------------- + /** !strcmp((*this)->substr(0,strlen(check)),check) */ + bool match_start(const char* check) { + const size_t len = strlen(check); + + return len <= cur.length() && std::equal(check,check+len,cur.begin()); + } + + + // ----------------------------------------- + /** swallow the next call to ++, return the previous value. */ + void swallow_next_increment() { + swallow = true; + } + +private: + LineSplitter( const LineSplitter & ); + LineSplitter &operator = ( const LineSplitter & ); + +private: + line_idx idx; + std::string cur; + StreamReaderLE& stream; + bool swallow, skip_empty_lines, trim; +}; + +} +#endif // INCLUDED_LINE_SPLITTER_H diff --git a/engine/inc/assimp/LogAux.h b/engine/inc/assimp/LogAux.h new file mode 100644 index 00000000..b8aa2e2d --- /dev/null +++ b/engine/inc/assimp/LogAux.h @@ -0,0 +1,131 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +/** @file LogAux.h + * @brief Common logging usage patterns for importer implementations + */ +#ifndef INCLUDED_AI_LOGAUX_H +#define INCLUDED_AI_LOGAUX_H + +#include +#include +#include + +namespace Assimp { + +template +class LogFunctions { +public: + // ------------------------------------------------------------------------------------------------ + static void ThrowException(const std::string& msg) + { + throw DeadlyImportError(Prefix()+msg); + } + + // ------------------------------------------------------------------------------------------------ + static void LogWarn(const Formatter::format& message) { + if (!DefaultLogger::isNullLogger()) { + DefaultLogger::get()->warn(Prefix()+(std::string)message); + } + } + + // ------------------------------------------------------------------------------------------------ + static void LogError(const Formatter::format& message) { + if (!DefaultLogger::isNullLogger()) { + DefaultLogger::get()->error(Prefix()+(std::string)message); + } + } + + // ------------------------------------------------------------------------------------------------ + static void LogInfo(const Formatter::format& message) { + if (!DefaultLogger::isNullLogger()) { + DefaultLogger::get()->info(Prefix()+(std::string)message); + } + } + + // ------------------------------------------------------------------------------------------------ + static void LogDebug(const Formatter::format& message) { + if (!DefaultLogger::isNullLogger()) { + DefaultLogger::get()->debug(Prefix()+(std::string)message); + } + } + + // https://sourceforge.net/tracker/?func=detail&atid=1067632&aid=3358562&group_id=226462 +#if !defined(__GNUC__) || !defined(__APPLE__) || __GNUC__ > 4 || (__GNUC__ == 4 && __GNUC_MINOR__ >= 6) + + // ------------------------------------------------------------------------------------------------ + static void LogWarn (const char* message) { + if (!DefaultLogger::isNullLogger()) { + LogWarn(Formatter::format(message)); + } + } + + // ------------------------------------------------------------------------------------------------ + static void LogError (const char* message) { + if (!DefaultLogger::isNullLogger()) { + LogError(Formatter::format(message)); + } + } + + // ------------------------------------------------------------------------------------------------ + static void LogInfo (const char* message) { + if (!DefaultLogger::isNullLogger()) { + LogInfo(Formatter::format(message)); + } + } + + // ------------------------------------------------------------------------------------------------ + static void LogDebug (const char* message) { + if (!DefaultLogger::isNullLogger()) { + LogDebug(Formatter::format(message)); + } + } + +#endif + +private: + static const char* Prefix(); + +}; + +} // ! Assimp +#endif diff --git a/engine/inc/assimp/LogStream.hpp b/engine/inc/assimp/LogStream.hpp new file mode 100644 index 00000000..00a979da --- /dev/null +++ b/engine/inc/assimp/LogStream.hpp @@ -0,0 +1,111 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +/** @file LogStream.hpp + * @brief Abstract base class 'LogStream', representing an output log stream. + */ +#ifndef INCLUDED_AI_LOGSTREAM_H +#define INCLUDED_AI_LOGSTREAM_H + +#include "types.h" + +namespace Assimp { + +class IOSystem; + +// ------------------------------------------------------------------------------------ +/** @brief CPP-API: Abstract interface for log stream implementations. + * + * Several default implementations are provided, see #aiDefaultLogStream for more + * details. Writing your own implementation of LogStream is just necessary if these + * are not enough for your purpose. */ +class ASSIMP_API LogStream +#ifndef SWIG + : public Intern::AllocateFromAssimpHeap +#endif +{ +protected: + /** @brief Default constructor */ + LogStream(); + +public: + /** @brief Virtual destructor */ + virtual ~LogStream(); + + // ------------------------------------------------------------------- + /** @brief Overwrite this for your own output methods + * + * Log messages *may* consist of multiple lines and you shouldn't + * expect a consistent formatting. If you want custom formatting + * (e.g. generate HTML), supply a custom instance of Logger to + * #DefaultLogger:set(). Usually you can *expect* that a log message + * is exactly one line and terminated with a single \n character. + * @param message Message to be written */ + virtual void write(const char* message) = 0; + + // ------------------------------------------------------------------- + /** @brief Creates a default log stream + * @param streams Type of the default stream + * @param name For aiDefaultLogStream_FILE: name of the output file + * @param io For aiDefaultLogStream_FILE: IOSystem to be used to open the output + * file. Pass NULL for the default implementation. + * @return New LogStream instance. */ + static LogStream* createDefaultStream(aiDefaultLogStream stream, + const char* name = "AssimpLog.txt", + IOSystem* io = NULL); + +}; // !class LogStream + +inline +LogStream::LogStream() { + // empty +} + +inline +LogStream::~LogStream() { + // empty +} + +// ------------------------------------------------------------------------------------ +} // Namespace Assimp + +#endif diff --git a/engine/inc/assimp/Logger.hpp b/engine/inc/assimp/Logger.hpp new file mode 100644 index 00000000..56516ca4 --- /dev/null +++ b/engine/inc/assimp/Logger.hpp @@ -0,0 +1,269 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +/** @file Logger.hpp + * @brief Abstract base class 'Logger', base of the logging system. + */ +#ifndef INCLUDED_AI_LOGGER_H +#define INCLUDED_AI_LOGGER_H + +#include "types.h" + +namespace Assimp { + +class LogStream; + +// Maximum length of a log message. Longer messages are rejected. +#define MAX_LOG_MESSAGE_LENGTH 1024u + +// ---------------------------------------------------------------------------------- +/** @brief CPP-API: Abstract interface for logger implementations. + * Assimp provides a default implementation and uses it for almost all + * logging stuff ('DefaultLogger'). This class defines just basic logging + * behaviour and is not of interest for you. Instead, take a look at #DefaultLogger. */ +class ASSIMP_API Logger +#ifndef SWIG + : public Intern::AllocateFromAssimpHeap +#endif +{ +public: + + // ---------------------------------------------------------------------- + /** @enum LogSeverity + * @brief Log severity to describe the granularity of logging. + */ + enum LogSeverity + { + NORMAL, //!< Normal granularity of logging + VERBOSE //!< Debug infos will be logged, too + }; + + // ---------------------------------------------------------------------- + /** @enum ErrorSeverity + * @brief Description for severity of a log message. + * + * Every LogStream has a bitwise combination of these flags. + * A LogStream doesn't receive any messages of a specific type + * if it doesn't specify the corresponding ErrorSeverity flag. + */ + enum ErrorSeverity + { + Debugging = 1, //!< Debug log message + Info = 2, //!< Info log message + Warn = 4, //!< Warn log message + Err = 8 //!< Error log message + }; + +public: + + /** @brief Virtual destructor */ + virtual ~Logger(); + + // ---------------------------------------------------------------------- + /** @brief Writes a debug message + * @param message Debug message*/ + void debug(const char* message); + inline void debug(const std::string &message); + + // ---------------------------------------------------------------------- + /** @brief Writes a info message + * @param message Info message*/ + void info(const char* message); + inline void info(const std::string &message); + + // ---------------------------------------------------------------------- + /** @brief Writes a warning message + * @param message Warn message*/ + void warn(const char* message); + inline void warn(const std::string &message); + + // ---------------------------------------------------------------------- + /** @brief Writes an error message + * @param message Error message*/ + void error(const char* message); + inline void error(const std::string &message); + + // ---------------------------------------------------------------------- + /** @brief Set a new log severity. + * @param log_severity New severity for logging*/ + void setLogSeverity(LogSeverity log_severity); + + // ---------------------------------------------------------------------- + /** @brief Get the current log severity*/ + LogSeverity getLogSeverity() const; + + // ---------------------------------------------------------------------- + /** @brief Attach a new log-stream + * + * The logger takes ownership of the stream and is responsible + * for its destruction (which is done using ::delete when the logger + * itself is destroyed). Call detachStream to detach a stream and to + * gain ownership of it again. + * @param pStream Log-stream to attach + * @param severity Message filter, specified which types of log + * messages are dispatched to the stream. Provide a bitwise + * combination of the ErrorSeverity flags. + * @return true if the stream has been attached, false otherwise.*/ + virtual bool attachStream(LogStream *pStream, + unsigned int severity = Debugging | Err | Warn | Info) = 0; + + // ---------------------------------------------------------------------- + /** @brief Detach a still attached stream from the logger (or + * modify the filter flags bits) + * @param pStream Log-stream instance for detaching + * @param severity Provide a bitwise combination of the ErrorSeverity + * flags. This value is &~ed with the current flags of the stream, + * if the result is 0 the stream is detached from the Logger and + * the caller retakes the possession of the stream. + * @return true if the stream has been detached, false otherwise.*/ + virtual bool detatchStream(LogStream *pStream, + unsigned int severity = Debugging | Err | Warn | Info) = 0; + +protected: + + /** Default constructor */ + Logger(); + + /** Construction with a given log severity */ + explicit Logger(LogSeverity severity); + + // ---------------------------------------------------------------------- + /** @brief Called as a request to write a specific debug message + * @param message Debug message. Never longer than + * MAX_LOG_MESSAGE_LENGTH characters (excluding the '0'). + * @note The message string is only valid until the scope of + * the function is left. + */ + virtual void OnDebug(const char* message)= 0; + + // ---------------------------------------------------------------------- + /** @brief Called as a request to write a specific info message + * @param message Info message. Never longer than + * MAX_LOG_MESSAGE_LENGTH characters (ecxluding the '0'). + * @note The message string is only valid until the scope of + * the function is left. + */ + virtual void OnInfo(const char* message) = 0; + + // ---------------------------------------------------------------------- + /** @brief Called as a request to write a specific warn message + * @param message Warn message. Never longer than + * MAX_LOG_MESSAGE_LENGTH characters (exluding the '0'). + * @note The message string is only valid until the scope of + * the function is left. + */ + virtual void OnWarn(const char* essage) = 0; + + // ---------------------------------------------------------------------- + /** @brief Called as a request to write a specific error message + * @param message Error message. Never longer than + * MAX_LOG_MESSAGE_LENGTH characters (exluding the '0'). + * @note The message string is only valid until the scope of + * the function is left. + */ + virtual void OnError(const char* message) = 0; + +protected: + + //! Logger severity + LogSeverity m_Severity; +}; + +// ---------------------------------------------------------------------------------- +// Default constructor +inline Logger::Logger() { + setLogSeverity(NORMAL); +} + +// ---------------------------------------------------------------------------------- +// Virtual destructor +inline Logger::~Logger() +{ +} + +// ---------------------------------------------------------------------------------- +// Construction with given logging severity +inline Logger::Logger(LogSeverity severity) { + setLogSeverity(severity); +} + +// ---------------------------------------------------------------------------------- +// Log severity setter +inline void Logger::setLogSeverity(LogSeverity log_severity){ + m_Severity = log_severity; +} + +// ---------------------------------------------------------------------------------- +// Log severity getter +inline Logger::LogSeverity Logger::getLogSeverity() const { + return m_Severity; +} + +// ---------------------------------------------------------------------------------- +inline void Logger::debug(const std::string &message) +{ + return debug(message.c_str()); +} + +// ---------------------------------------------------------------------------------- +inline void Logger::error(const std::string &message) +{ + return error(message.c_str()); +} + +// ---------------------------------------------------------------------------------- +inline void Logger::warn(const std::string &message) +{ + return warn(message.c_str()); +} + +// ---------------------------------------------------------------------------------- +inline void Logger::info(const std::string &message) +{ + return info(message.c_str()); +} + +// ---------------------------------------------------------------------------------- + +} // Namespace Assimp + +#endif // !! INCLUDED_AI_LOGGER_H diff --git a/engine/inc/assimp/Macros.h b/engine/inc/assimp/Macros.h new file mode 100644 index 00000000..4a2d0756 --- /dev/null +++ b/engine/inc/assimp/Macros.h @@ -0,0 +1,49 @@ +/* +--------------------------------------------------------------------------- +Open Asset Import Library (assimp) +--------------------------------------------------------------------------- + +Copyright (c) 2006-2012, assimp team + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the following +conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. +--------------------------------------------------------------------------- +*/ + +/* Helper macro to set a pointer to NULL in debug builds + */ +#if (defined ASSIMP_BUILD_DEBUG) +# define AI_DEBUG_INVALIDATE_PTR(x) x = NULL; +#else +# define AI_DEBUG_INVALIDATE_PTR(x) +#endif + diff --git a/engine/inc/assimp/MathFunctions.h b/engine/inc/assimp/MathFunctions.h new file mode 100644 index 00000000..cb3b6960 --- /dev/null +++ b/engine/inc/assimp/MathFunctions.h @@ -0,0 +1,77 @@ +/* +--------------------------------------------------------------------------- +Open Asset Import Library (assimp) +--------------------------------------------------------------------------- + +Copyright (c) 2006-2016, assimp team + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the following +conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. +--------------------------------------------------------------------------- +*/ + +/** @file MathFunctions.h + * @brief Implementation of the math functions (gcd and lcm) + * + * Copied from BoostWorkaround/math + */ + +namespace Assimp { +namespace Math { + +// TODO: use binary GCD for unsigned integers .... +template < typename IntegerType > +IntegerType gcd( IntegerType a, IntegerType b ) +{ + const IntegerType zero = (IntegerType)0; + while ( true ) + { + if ( a == zero ) + return b; + b %= a; + + if ( b == zero ) + return a; + a %= b; + } +} + +template < typename IntegerType > +IntegerType lcm( IntegerType a, IntegerType b ) +{ + const IntegerType t = gcd (a,b); + if (!t)return t; + return a / t * b; +} + +} +} diff --git a/engine/inc/assimp/MemoryIOWrapper.h b/engine/inc/assimp/MemoryIOWrapper.h new file mode 100644 index 00000000..bfcfff9c --- /dev/null +++ b/engine/inc/assimp/MemoryIOWrapper.h @@ -0,0 +1,199 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +/** @file MemoryIOWrapper.h + * Handy IOStream/IOSystem implemetation to read directly from a memory buffer */ +#ifndef AI_MEMORYIOSTREAM_H_INC +#define AI_MEMORYIOSTREAM_H_INC + +#include +#include +#include +#include + +namespace Assimp { +#define AI_MEMORYIO_MAGIC_FILENAME "$$$___magic___$$$" +#define AI_MEMORYIO_MAGIC_FILENAME_LENGTH 17 + +// ---------------------------------------------------------------------------------- +/** Implementation of IOStream to read directly from a memory buffer */ +// ---------------------------------------------------------------------------------- +class MemoryIOStream : public IOStream +{ + //friend class MemoryIOSystem; +public: + MemoryIOStream (const uint8_t* buff, size_t len, bool own = false) + : buffer (buff) + , length(len) + , pos((size_t)0) + , own(own) + { + } + +public: + + ~MemoryIOStream () { + if(own) { + delete[] buffer; + } + } + + // ------------------------------------------------------------------- + // Read from stream + size_t Read(void* pvBuffer, size_t pSize, size_t pCount) { + const size_t cnt = std::min(pCount,(length-pos)/pSize),ofs = pSize*cnt; + + memcpy(pvBuffer,buffer+pos,ofs); + pos += ofs; + + return cnt; + } + + // ------------------------------------------------------------------- + // Write to stream + size_t Write(const void* /*pvBuffer*/, size_t /*pSize*/,size_t /*pCount*/) { + ai_assert(false); // won't be needed + return 0; + } + + // ------------------------------------------------------------------- + // Seek specific position + aiReturn Seek(size_t pOffset, aiOrigin pOrigin) { + if (aiOrigin_SET == pOrigin) { + if (pOffset > length) { + return AI_FAILURE; + } + pos = pOffset; + } + else if (aiOrigin_END == pOrigin) { + if (pOffset > length) { + return AI_FAILURE; + } + pos = length-pOffset; + } + else { + if (pOffset+pos > length) { + return AI_FAILURE; + } + pos += pOffset; + } + return AI_SUCCESS; + } + + // ------------------------------------------------------------------- + // Get current seek position + size_t Tell() const { + return pos; + } + + // ------------------------------------------------------------------- + // Get size of file + size_t FileSize() const { + return length; + } + + // ------------------------------------------------------------------- + // Flush file contents + void Flush() { + ai_assert(false); // won't be needed + } + +private: + const uint8_t* buffer; + size_t length,pos; + bool own; +}; + +// --------------------------------------------------------------------------- +/** Dummy IO system to read from a memory buffer */ +class MemoryIOSystem : public IOSystem +{ +public: + /** Constructor. */ + MemoryIOSystem (const uint8_t* buff, size_t len) + : buffer (buff), length(len) { + } + + /** Destructor. */ + ~MemoryIOSystem() { + } + + // ------------------------------------------------------------------- + /** Tests for the existence of a file at the given path. */ + bool Exists( const char* pFile) const { + return !strncmp(pFile,AI_MEMORYIO_MAGIC_FILENAME,AI_MEMORYIO_MAGIC_FILENAME_LENGTH); + } + + // ------------------------------------------------------------------- + /** Returns the directory separator. */ + char getOsSeparator() const { + return '/'; // why not? it doesn't care + } + + // ------------------------------------------------------------------- + /** Open a new file with a given path. */ + IOStream* Open( const char* pFile, const char* /*pMode*/ = "rb") { + if (strncmp(pFile,AI_MEMORYIO_MAGIC_FILENAME,AI_MEMORYIO_MAGIC_FILENAME_LENGTH)) { + return NULL; + } + return new MemoryIOStream(buffer,length); + } + + // ------------------------------------------------------------------- + /** Closes the given file and releases all resources associated with it. */ + void Close( IOStream* pFile) { + delete pFile; + } + + // ------------------------------------------------------------------- + /** Compare two paths */ + bool ComparePaths (const char* /*one*/, const char* /*second*/) const { + return false; + } + +private: + const uint8_t* buffer; + size_t length; +}; +} // end namespace Assimp + +#endif diff --git a/engine/inc/assimp/NullLogger.hpp b/engine/inc/assimp/NullLogger.hpp new file mode 100644 index 00000000..776f301a --- /dev/null +++ b/engine/inc/assimp/NullLogger.hpp @@ -0,0 +1,99 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +/** @file NullLogger.hpp + * @brief Dummy logger +*/ + +#ifndef INCLUDED_AI_NULLLOGGER_H +#define INCLUDED_AI_NULLLOGGER_H + +#include "Logger.hpp" + +namespace Assimp { + +// --------------------------------------------------------------------------- +/** @brief CPP-API: Empty logging implementation. + * + * Does nothing! Used by default if the application hasn't requested a + * custom logger via #DefaultLogger::set() or #DefaultLogger::create(); */ +class ASSIMP_API NullLogger + : public Logger { + +public: + + /** @brief Logs a debug message */ + void OnDebug(const char* message) { + (void)message; //this avoids compiler warnings + } + + /** @brief Logs an info message */ + void OnInfo(const char* message) { + (void)message; //this avoids compiler warnings + } + + /** @brief Logs a warning message */ + void OnWarn(const char* message) { + (void)message; //this avoids compiler warnings + } + + /** @brief Logs an error message */ + void OnError(const char* message) { + (void)message; //this avoids compiler warnings + } + + /** @brief Detach a still attached stream from logger */ + bool attachStream(LogStream *pStream, unsigned int severity) { + (void)pStream; (void)severity; //this avoids compiler warnings + return false; + } + + /** @brief Detach a still attached stream from logger */ + bool detatchStream(LogStream *pStream, unsigned int severity) { + (void)pStream; (void)severity; //this avoids compiler warnings + return false; + } + +private: +}; +} +#endif // !! AI_NULLLOGGER_H_INCLUDED diff --git a/engine/inc/assimp/ParsingUtils.h b/engine/inc/assimp/ParsingUtils.h new file mode 100644 index 00000000..4553072d --- /dev/null +++ b/engine/inc/assimp/ParsingUtils.h @@ -0,0 +1,260 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + + +/** @file ParsingUtils.h + * @brief Defines helper functions for text parsing + */ +#ifndef AI_PARSING_UTILS_H_INC +#define AI_PARSING_UTILS_H_INC + +#include "StringComparison.h" +#include "StringUtils.h" +#include + +namespace Assimp { + +// NOTE: the functions below are mostly intended as replacement for +// std::upper, std::lower, std::isupper, std::islower, std::isspace. +// we don't bother of locales. We don't want them. We want reliable +// (i.e. identical) results across all locales. + +// The functions below accept any character type, but know only +// about ASCII. However, UTF-32 is the only safe ASCII superset to +// use since it doesn't have multi-byte sequences. + +static const unsigned int BufferSize = 4096; + +// --------------------------------------------------------------------------------- +template +AI_FORCE_INLINE +char_t ToLower( char_t in ) { + return (in >= (char_t)'A' && in <= (char_t)'Z') ? (char_t)(in+0x20) : in; +} + +// --------------------------------------------------------------------------------- +template +AI_FORCE_INLINE +char_t ToUpper( char_t in) { + return (in >= (char_t)'a' && in <= (char_t)'z') ? (char_t)(in-0x20) : in; +} + +// --------------------------------------------------------------------------------- +template +AI_FORCE_INLINE +bool IsUpper( char_t in) { + return (in >= (char_t)'A' && in <= (char_t)'Z'); +} + +// --------------------------------------------------------------------------------- +template +AI_FORCE_INLINE +bool IsLower( char_t in) { + return (in >= (char_t)'a' && in <= (char_t)'z'); +} + +// --------------------------------------------------------------------------------- +template +AI_FORCE_INLINE +bool IsSpace( char_t in) { + return (in == (char_t)' ' || in == (char_t)'\t'); +} + +// --------------------------------------------------------------------------------- +template +AI_FORCE_INLINE +bool IsLineEnd( char_t in) { + return (in==(char_t)'\r'||in==(char_t)'\n'||in==(char_t)'\0'||in==(char_t)'\f'); +} + +// --------------------------------------------------------------------------------- +template +AI_FORCE_INLINE +bool IsSpaceOrNewLine( char_t in) { + return IsSpace(in) || IsLineEnd(in); +} + +// --------------------------------------------------------------------------------- +template +AI_FORCE_INLINE +bool SkipSpaces( const char_t* in, const char_t** out) { + while( *in == ( char_t )' ' || *in == ( char_t )'\t' ) { + ++in; + } + *out = in; + return !IsLineEnd(*in); +} + +// --------------------------------------------------------------------------------- +template +AI_FORCE_INLINE +bool SkipSpaces( const char_t** inout) { + return SkipSpaces(*inout,inout); +} + +// --------------------------------------------------------------------------------- +template +AI_FORCE_INLINE +bool SkipLine( const char_t* in, const char_t** out) { + while( *in != ( char_t )'\r' && *in != ( char_t )'\n' && *in != ( char_t )'\0' ) { + ++in; + } + + // files are opened in binary mode. Ergo there are both NL and CR + while( *in == ( char_t )'\r' || *in == ( char_t )'\n' ) { + ++in; + } + *out = in; + return *in != (char_t)'\0'; +} + +// --------------------------------------------------------------------------------- +template +AI_FORCE_INLINE +bool SkipLine( const char_t** inout) { + return SkipLine(*inout,inout); +} + +// --------------------------------------------------------------------------------- +template +AI_FORCE_INLINE +bool SkipSpacesAndLineEnd( const char_t* in, const char_t** out) { + while( *in == ( char_t )' ' || *in == ( char_t )'\t' || *in == ( char_t )'\r' || *in == ( char_t )'\n' ) { + ++in; + } + *out = in; + return *in != '\0'; +} + +// --------------------------------------------------------------------------------- +template +AI_FORCE_INLINE +bool SkipSpacesAndLineEnd( const char_t** inout) { + return SkipSpacesAndLineEnd(*inout,inout); +} + +// --------------------------------------------------------------------------------- +template +AI_FORCE_INLINE +bool GetNextLine( const char_t*& buffer, char_t out[ BufferSize ] ) { + if( ( char_t )'\0' == *buffer ) { + return false; + } + + char* _out = out; + char* const end = _out + BufferSize; + while( !IsLineEnd( *buffer ) && _out < end ) { + *_out++ = *buffer++; + } + *_out = (char_t)'\0'; + + while( IsLineEnd( *buffer ) && '\0' != *buffer ) { + ++buffer; + } + + return true; +} + +// --------------------------------------------------------------------------------- +template +AI_FORCE_INLINE bool IsNumeric( char_t in) +{ + return ( in >= '0' && in <= '9' ) || '-' == in || '+' == in; +} + +// --------------------------------------------------------------------------------- +template +AI_FORCE_INLINE +bool TokenMatch(char_t*& in, const char* token, unsigned int len) +{ + if (!::strncmp(token,in,len) && IsSpaceOrNewLine(in[len])) { + if (in[len] != '\0') { + in += len+1; + } else { + // If EOF after the token make sure we don't go past end of buffer + in += len; + } + return true; + } + + return false; +} +// --------------------------------------------------------------------------------- +/** @brief Case-ignoring version of TokenMatch + * @param in Input + * @param token Token to check for + * @param len Number of characters to check + */ +AI_FORCE_INLINE +bool TokenMatchI(const char*& in, const char* token, unsigned int len) { + if (!ASSIMP_strincmp(token,in,len) && IsSpaceOrNewLine(in[len])) { + in += len+1; + return true; + } + return false; +} + +// --------------------------------------------------------------------------------- +AI_FORCE_INLINE +void SkipToken(const char*& in) { + SkipSpaces(&in); + while ( !IsSpaceOrNewLine( *in ) ) { + ++in; + } +} + +// --------------------------------------------------------------------------------- +AI_FORCE_INLINE +std::string GetNextToken(const char*& in) { + SkipSpacesAndLineEnd(&in); + const char* cur = in; + while ( !IsSpaceOrNewLine( *in ) ) { + ++in; + } + return std::string(cur,(size_t)(in-cur)); +} + +// --------------------------------------------------------------------------------- + +} // ! namespace Assimp + +#endif // ! AI_PARSING_UTILS_H_INC diff --git a/engine/inc/assimp/Profiler.h b/engine/inc/assimp/Profiler.h new file mode 100644 index 00000000..272085ea --- /dev/null +++ b/engine/inc/assimp/Profiler.h @@ -0,0 +1,99 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +/** @file Profiler.h + * @brief Utility to measure the respective runtime of each import step + */ +#ifndef INCLUDED_PROFILER_H +#define INCLUDED_PROFILER_H + +#include +#include +#include "TinyFormatter.h" + +#include + +namespace Assimp { +namespace Profiling { + +using namespace Formatter; + +// ------------------------------------------------------------------------------------------------ +/** Simple wrapper around boost::timer to simplify reporting. Timings are automatically + * dumped to the log file. + */ +class Profiler { +public: + Profiler() { + // empty + } + +public: + + /** Start a named timer */ + void BeginRegion(const std::string& region) { + regions[region] = std::chrono::system_clock::now(); + DefaultLogger::get()->debug((format("START `"),region,"`")); + } + + + /** End a specific named timer and write its end time to the log */ + void EndRegion(const std::string& region) { + RegionMap::const_iterator it = regions.find(region); + if (it == regions.end()) { + return; + } + + std::chrono::duration elapsedSeconds = std::chrono::system_clock::now() - regions[region]; + DefaultLogger::get()->debug((format("END `"),region,"`, dt= ", elapsedSeconds.count()," s")); + } + +private: + typedef std::map> RegionMap; + RegionMap regions; +}; + +} +} + +#endif + diff --git a/engine/inc/assimp/ProgressHandler.hpp b/engine/inc/assimp/ProgressHandler.hpp new file mode 100644 index 00000000..b1d095b7 --- /dev/null +++ b/engine/inc/assimp/ProgressHandler.hpp @@ -0,0 +1,127 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +/** @file ProgressHandler.hpp + * @brief Abstract base class 'ProgressHandler'. + */ +#pragma once +#ifndef AI_PROGRESSHANDLER_H_INC +#define AI_PROGRESSHANDLER_H_INC + +#include "types.h" + +namespace Assimp { + +// ------------------------------------------------------------------------------------ +/** @brief CPP-API: Abstract interface for custom progress report receivers. + * + * Each #Importer instance maintains its own #ProgressHandler. The default + * implementation provided by Assimp doesn't do anything at all. */ +class ASSIMP_API ProgressHandler +#ifndef SWIG + : public Intern::AllocateFromAssimpHeap +#endif +{ +protected: + /** @brief Default constructor */ + ProgressHandler () { + } +public: + /** @brief Virtual destructor */ + virtual ~ProgressHandler () { + } + + // ------------------------------------------------------------------- + /** @brief Progress callback. + * @param percentage An estimate of the current loading progress, + * in percent. Or -1.f if such an estimate is not available. + * + * There are restriction on what you may do from within your + * implementation of this method: no exceptions may be thrown and no + * non-const #Importer methods may be called. It is + * not generally possible to predict the number of callbacks + * fired during a single import. + * + * @return Return false to abort loading at the next possible + * occasion (loaders and Assimp are generally allowed to perform + * all needed cleanup tasks prior to returning control to the + * caller). If the loading is aborted, #Importer::ReadFile() + * returns always NULL. + * */ + virtual bool Update(float percentage = -1.f) = 0; + + // ------------------------------------------------------------------- + /** @brief Progress callback for file loading steps + * @param numberOfSteps The number of total post-processing + * steps + * @param currentStep The index of the current post-processing + * step that will run, or equal to numberOfSteps if all of + * them has finished. This number is always strictly monotone + * increasing, although not necessarily linearly. + * + * @note This is currently only used at the start and the end + * of the file parsing. + * */ + virtual void UpdateFileRead(int currentStep /*= 0*/, int numberOfSteps /*= 0*/) { + float f = numberOfSteps ? currentStep / (float)numberOfSteps : 1.0f; + Update( f * 0.5f ); + } + + // ------------------------------------------------------------------- + /** @brief Progress callback for post-processing steps + * @param numberOfSteps The number of total post-processing + * steps + * @param currentStep The index of the current post-processing + * step that will run, or equal to numberOfSteps if all of + * them has finished. This number is always strictly monotone + * increasing, although not necessarily linearly. + * */ + virtual void UpdatePostProcess(int currentStep /*= 0*/, int numberOfSteps /*= 0*/) { + float f = numberOfSteps ? currentStep / (float)numberOfSteps : 1.0f; + Update( f * 0.5f + 0.5f ); + } + +}; // !class ProgressHandler +// ------------------------------------------------------------------------------------ +} // Namespace Assimp + +#endif // AI_PROGRESSHANDLER_H_INC diff --git a/engine/inc/assimp/RemoveComments.h b/engine/inc/assimp/RemoveComments.h new file mode 100644 index 00000000..08299f22 --- /dev/null +++ b/engine/inc/assimp/RemoveComments.h @@ -0,0 +1,91 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +/** @file Declares a helper class, "CommentRemover", which can be + * used to remove comments (single and multi line) from a text file. + */ +#ifndef AI_REMOVE_COMMENTS_H_INC +#define AI_REMOVE_COMMENTS_H_INC + + +#include + +namespace Assimp { + +// --------------------------------------------------------------------------- +/** \brief Helper class to remove single and multi line comments from a file + * + * Some mesh formats like MD5 have comments that are quite similar + * to those in C or C++ so this code has been moved to a separate + * module. + */ +class ASSIMP_API CommentRemover +{ + // class cannot be instanced + CommentRemover() {} + +public: + + //! Remove single-line comments. The end of a line is + //! expected to be either NL or CR or NLCR. + //! \param szComment The start sequence of the comment, e.g. "//" + //! \param szBuffer Buffer to work with + //! \param chReplacement Character to be used as replacement + //! for commented lines. By default this is ' ' + static void RemoveLineComments(const char* szComment, + char* szBuffer, char chReplacement = ' '); + + //! Remove multi-line comments. The end of a line is + //! expected to be either NL or CR or NLCR. Multi-line comments + //! may not be nested (as in C). + //! \param szCommentStart The start sequence of the comment, e.g. "/*" + //! \param szCommentEnd The end sequence of the comment, e.g. "*/" + //! \param szBuffer Buffer to work with + //! \param chReplacement Character to be used as replacement + //! for commented lines. By default this is ' ' + static void RemoveMultiLineComments(const char* szCommentStart, + const char* szCommentEnd,char* szBuffer, + char chReplacement = ' '); +}; +} // ! Assimp + +#endif // !! AI_REMOVE_COMMENTS_H_INC diff --git a/engine/inc/assimp/SGSpatialSort.h b/engine/inc/assimp/SGSpatialSort.h new file mode 100644 index 00000000..203e3251 --- /dev/null +++ b/engine/inc/assimp/SGSpatialSort.h @@ -0,0 +1,142 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +/** Small helper classes to optimize finding vertices close to a given location + */ +#ifndef AI_D3DSSPATIALSORT_H_INC +#define AI_D3DSSPATIALSORT_H_INC + +#include +#include +#include + +namespace Assimp { + +// ---------------------------------------------------------------------------------- +/** Specialized version of SpatialSort to support smoothing groups + * This is used in by the 3DS, ASE and LWO loaders. 3DS and ASE share their + * normal computation code in SmoothingGroups.inl, the LWO loader has its own + * implementation to handle all details of its file format correctly. + */ +// ---------------------------------------------------------------------------------- +class ASSIMP_API SGSpatialSort +{ +public: + + SGSpatialSort(); + + // ------------------------------------------------------------------- + /** Construction from a given face array, handling smoothing groups + * properly + */ + explicit SGSpatialSort(const std::vector& vPositions); + + // ------------------------------------------------------------------- + /** Add a vertex to the spatial sort + * @param vPosition Vertex position to be added + * @param index Index of the vrtex + * @param smoothingGroup SmoothingGroup for this vertex + */ + void Add(const aiVector3D& vPosition, unsigned int index, + unsigned int smoothingGroup); + + // ------------------------------------------------------------------- + /** Prepare the spatial sorter for use. This step runs in O(logn) + */ + void Prepare(); + + /** Destructor */ + ~SGSpatialSort(); + + // ------------------------------------------------------------------- + /** Returns an iterator for all positions close to the given position. + * @param pPosition The position to look for vertices. + * @param pSG Only included vertices with at least one shared smooth group + * @param pRadius Maximal distance from the position a vertex may have + * to be counted in. + * @param poResults The container to store the indices of the found + * positions. Will be emptied by the call so it may contain anything. + * @param exactMatch Specifies whether smoothing groups are bit masks + * (false) or integral values (true). In the latter case, a vertex + * cannot belong to more than one smoothing group. + * @return An iterator to iterate over all vertices in the given area. + */ + // ------------------------------------------------------------------- + void FindPositions( const aiVector3D& pPosition, uint32_t pSG, + float pRadius, std::vector& poResults, + bool exactMatch = false) const; + +protected: + /** Normal of the sorting plane, normalized. The center is always at (0, 0, 0) */ + aiVector3D mPlaneNormal; + + // ------------------------------------------------------------------- + /** An entry in a spatially sorted position array. Consists of a + * vertex index, its position and its precalculated distance from + * the reference plane */ + // ------------------------------------------------------------------- + struct Entry + { + unsigned int mIndex; ///< The vertex referred by this entry + aiVector3D mPosition; ///< Position + uint32_t mSmoothGroups; + float mDistance; ///< Distance of this vertex to the sorting plane + + Entry() { /** intentionally not initialized.*/ } + Entry( unsigned int pIndex, const aiVector3D& pPosition, float pDistance,uint32_t pSG) + : + mIndex( pIndex), + mPosition( pPosition), + mSmoothGroups (pSG), + mDistance( pDistance) + { } + + bool operator < (const Entry& e) const { return mDistance < e.mDistance; } + }; + + // all positions, sorted by distance to the sorting plane + std::vector mPositions; +}; + +} // end of namespace Assimp + +#endif // AI_SPATIALSORT_H_INC diff --git a/engine/inc/assimp/SceneCombiner.h b/engine/inc/assimp/SceneCombiner.h new file mode 100644 index 00000000..ec278824 --- /dev/null +++ b/engine/inc/assimp/SceneCombiner.h @@ -0,0 +1,401 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +/** @file Declares a helper class, "SceneCombiner" providing various + * utilities to merge scenes. + */ +#ifndef AI_SCENE_COMBINER_H_INC +#define AI_SCENE_COMBINER_H_INC + +#include +#include +#include +#include +#include +#include +#include + +#include + +struct aiScene; +struct aiNode; +struct aiMaterial; +struct aiTexture; +struct aiCamera; +struct aiLight; +struct aiMetadata; +struct aiBone; +struct aiMesh; +struct aiAnimation; +struct aiNodeAnim; + +namespace Assimp { + +// --------------------------------------------------------------------------- +/** \brief Helper data structure for SceneCombiner. + * + * Describes to which node a scene must be attached to. + */ +struct AttachmentInfo +{ + AttachmentInfo() + : scene (NULL) + , attachToNode (NULL) + {} + + AttachmentInfo(aiScene* _scene, aiNode* _attachToNode) + : scene (_scene) + , attachToNode (_attachToNode) + {} + + aiScene* scene; + aiNode* attachToNode; +}; + +// --------------------------------------------------------------------------- +struct NodeAttachmentInfo +{ + NodeAttachmentInfo() + : node (NULL) + , attachToNode (NULL) + , resolved (false) + , src_idx (SIZE_MAX) + {} + + NodeAttachmentInfo(aiNode* _scene, aiNode* _attachToNode,size_t idx) + : node (_scene) + , attachToNode (_attachToNode) + , resolved (false) + , src_idx (idx) + {} + + aiNode* node; + aiNode* attachToNode; + bool resolved; + size_t src_idx; +}; + +// --------------------------------------------------------------------------- +/** @def AI_INT_MERGE_SCENE_GEN_UNIQUE_NAMES + * Generate unique names for all named scene items + */ +#define AI_INT_MERGE_SCENE_GEN_UNIQUE_NAMES 0x1 + +/** @def AI_INT_MERGE_SCENE_GEN_UNIQUE_MATNAMES + * Generate unique names for materials, too. + * This is not absolutely required to pass the validation. + */ +#define AI_INT_MERGE_SCENE_GEN_UNIQUE_MATNAMES 0x2 + +/** @def AI_INT_MERGE_SCENE_DUPLICATES_DEEP_CPY + * Use deep copies of duplicate scenes + */ +#define AI_INT_MERGE_SCENE_DUPLICATES_DEEP_CPY 0x4 + +/** @def AI_INT_MERGE_SCENE_RESOLVE_CROSS_ATTACHMENTS + * If attachment nodes are not found in the given master scene, + * search the other imported scenes for them in an any order. + */ +#define AI_INT_MERGE_SCENE_RESOLVE_CROSS_ATTACHMENTS 0x8 + +/** @def AI_INT_MERGE_SCENE_GEN_UNIQUE_NAMES_IF_NECESSARY + * Can be combined with AI_INT_MERGE_SCENE_GEN_UNIQUE_NAMES. + * Unique names are generated, but only if this is absolutely + * required to avoid name conflicts. + */ +#define AI_INT_MERGE_SCENE_GEN_UNIQUE_NAMES_IF_NECESSARY 0x10 + +typedef std::pair BoneSrcIndex; + +// --------------------------------------------------------------------------- +/** @brief Helper data structure for SceneCombiner::MergeBones. + */ +struct BoneWithHash : public std::pair { + std::vector pSrcBones; +}; + +// --------------------------------------------------------------------------- +/** @brief Utility for SceneCombiner + */ +struct SceneHelper +{ + SceneHelper () + : scene (NULL) + , idlen (0) + { + id[0] = 0; + } + + explicit SceneHelper (aiScene* _scene) + : scene (_scene) + , idlen (0) + { + id[0] = 0; + } + + AI_FORCE_INLINE aiScene* operator-> () const + { + return scene; + } + + // scene we're working on + aiScene* scene; + + // prefix to be added to all identifiers in the scene ... + char id [32]; + + // and its strlen() + unsigned int idlen; + + // hash table to quickly check whether a name is contained in the scene + std::set hashes; +}; + +// --------------------------------------------------------------------------- +/** \brief Static helper class providing various utilities to merge two + * scenes. It is intended as internal utility and NOT for use by + * applications. + * + * The class is currently being used by various postprocessing steps + * and loaders (ie. LWS). + */ +class ASSIMP_API SceneCombiner { + // class cannot be instanced + SceneCombiner() { + // empty + } + + ~SceneCombiner() { + // empty + } + +public: + // ------------------------------------------------------------------- + /** Merges two or more scenes. + * + * @param dest Receives a pointer to the destination scene. If the + * pointer doesn't point to NULL when the function is called, the + * existing scene is cleared and refilled. + * @param src Non-empty list of scenes to be merged. The function + * deletes the input scenes afterwards. There may be duplicate scenes. + * @param flags Combination of the AI_INT_MERGE_SCENE flags defined above + */ + static void MergeScenes(aiScene** dest,std::vector& src, + unsigned int flags = 0); + + // ------------------------------------------------------------------- + /** Merges two or more scenes and attaches all scenes to a specific + * position in the node graph of the master scene. + * + * @param dest Receives a pointer to the destination scene. If the + * pointer doesn't point to NULL when the function is called, the + * existing scene is cleared and refilled. + * @param master Master scene. It will be deleted afterwards. All + * other scenes will be inserted in its node graph. + * @param src Non-empty list of scenes to be merged along with their + * corresponding attachment points in the master scene. The function + * deletes the input scenes afterwards. There may be duplicate scenes. + * @param flags Combination of the AI_INT_MERGE_SCENE flags defined above + */ + static void MergeScenes(aiScene** dest, aiScene* master, + std::vector& src, + unsigned int flags = 0); + + // ------------------------------------------------------------------- + /** Merges two or more meshes + * + * The meshes should have equal vertex formats. Only components + * that are provided by ALL meshes will be present in the output mesh. + * An exception is made for VColors - they are set to black. The + * meshes should have the same material indices, too. The output + * material index is always the material index of the first mesh. + * + * @param dest Destination mesh. Must be empty. + * @param flags Currently no parameters + * @param begin First mesh to be processed + * @param end Points to the mesh after the last mesh to be processed + */ + static void MergeMeshes(aiMesh** dest,unsigned int flags, + std::vector::const_iterator begin, + std::vector::const_iterator end); + + // ------------------------------------------------------------------- + /** Merges two or more bones + * + * @param out Mesh to receive the output bone list + * @param flags Currently no parameters + * @param begin First mesh to be processed + * @param end Points to the mesh after the last mesh to be processed + */ + static void MergeBones(aiMesh* out,std::vector::const_iterator it, + std::vector::const_iterator end); + + // ------------------------------------------------------------------- + /** Merges two or more materials + * + * The materials should be complementary as much as possible. In case + * of a property present in different materials, the first occurrence + * is used. + * + * @param dest Destination material. Must be empty. + * @param begin First material to be processed + * @param end Points to the material after the last material to be processed + */ + static void MergeMaterials(aiMaterial** dest, + std::vector::const_iterator begin, + std::vector::const_iterator end); + + // ------------------------------------------------------------------- + /** Builds a list of uniquely named bones in a mesh list + * + * @param asBones Receives the output list + * @param it First mesh to be processed + * @param end Last mesh to be processed + */ + static void BuildUniqueBoneList(std::list& asBones, + std::vector::const_iterator it, + std::vector::const_iterator end); + + // ------------------------------------------------------------------- + /** Add a name prefix to all nodes in a scene. + * + * @param Current node. This function is called recursively. + * @param prefix Prefix to be added to all nodes + * @param len STring length + */ + static void AddNodePrefixes(aiNode* node, const char* prefix, + unsigned int len); + + // ------------------------------------------------------------------- + /** Add an offset to all mesh indices in a node graph + * + * @param Current node. This function is called recursively. + * @param offset Offset to be added to all mesh indices + */ + static void OffsetNodeMeshIndices (aiNode* node, unsigned int offset); + + // ------------------------------------------------------------------- + /** Attach a list of node graphs to well-defined nodes in a master + * graph. This is a helper for MergeScenes() + * + * @param master Master scene + * @param srcList List of source scenes along with their attachment + * points. If an attachment point is NULL (or does not exist in + * the master graph), a scene is attached to the root of the master + * graph (as an additional child node) + * @duplicates List of duplicates. If elem[n] == n the scene is not + * a duplicate. Otherwise elem[n] links scene n to its first occurrence. + */ + static void AttachToGraph ( aiScene* master, + std::vector& srcList); + + static void AttachToGraph (aiNode* attach, + std::vector& srcList); + + + // ------------------------------------------------------------------- + /** Get a deep copy of a scene + * + * @param dest Receives a pointer to the destination scene + * @param src Source scene - remains unmodified. + */ + static void CopyScene(aiScene** dest,const aiScene* source,bool allocate = true); + + + // ------------------------------------------------------------------- + /** Get a flat copy of a scene + * + * Only the first hierarchy layer is copied. All pointer members of + * aiScene are shared by source and destination scene. If the + * pointer doesn't point to NULL when the function is called, the + * existing scene is cleared and refilled. + * @param dest Receives a pointer to the destination scene + * @param src Source scene - remains unmodified. + */ + static void CopySceneFlat(aiScene** dest,const aiScene* source); + + + // ------------------------------------------------------------------- + /** Get a deep copy of a mesh + * + * @param dest Receives a pointer to the destination mesh + * @param src Source mesh - remains unmodified. + */ + static void Copy (aiMesh** dest, const aiMesh* src); + + // similar to Copy(): + static void Copy (aiMaterial** dest, const aiMaterial* src); + static void Copy (aiTexture** dest, const aiTexture* src); + static void Copy (aiAnimation** dest, const aiAnimation* src); + static void Copy (aiCamera** dest, const aiCamera* src); + static void Copy (aiBone** dest, const aiBone* src); + static void Copy (aiLight** dest, const aiLight* src); + static void Copy (aiNodeAnim** dest, const aiNodeAnim* src); + static void Copy (aiMetadata** dest, const aiMetadata* src); + + // recursive, of course + static void Copy (aiNode** dest, const aiNode* src); + + +private: + + // ------------------------------------------------------------------- + // Same as AddNodePrefixes, but with an additional check + static void AddNodePrefixesChecked(aiNode* node, const char* prefix, + unsigned int len, + std::vector& input, + unsigned int cur); + + // ------------------------------------------------------------------- + // Add node identifiers to a hashing set + static void AddNodeHashes(aiNode* node, std::set& hashes); + + + // ------------------------------------------------------------------- + // Search for duplicate names + static bool FindNameMatch(const aiString& name, + std::vector& input, unsigned int cur); +}; + +} + +#endif // !! AI_SCENE_COMBINER_H_INC diff --git a/engine/inc/assimp/SkeletonMeshBuilder.h b/engine/inc/assimp/SkeletonMeshBuilder.h new file mode 100644 index 00000000..993d9c84 --- /dev/null +++ b/engine/inc/assimp/SkeletonMeshBuilder.h @@ -0,0 +1,125 @@ +/** Helper class to construct a dummy mesh for file formats containing only motion data */ + +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above +copyright notice, this list of conditions and the +following disclaimer. + +* Redistributions in binary form must reproduce the above +copyright notice, this list of conditions and the +following disclaimer in the documentation and/or other +materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its +contributors may be used to endorse or promote products +derived from this software without specific prior +written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +/** @file SkeletonMeshBuilder.h + * Declares SkeletonMeshBuilder, a tiny utility to build dummy meshes + * for animation skeletons. + */ + +#ifndef AI_SKELETONMESHBUILDER_H_INC +#define AI_SKELETONMESHBUILDER_H_INC + +#include +#include + +struct aiMaterial; +struct aiScene; +struct aiNode; + +namespace Assimp { + +// --------------------------------------------------------------------------- +/** + * This little helper class constructs a dummy mesh for a given scene + * the resembles the node hierarchy. This is useful for file formats + * that don't carry any mesh data but only animation data. + */ +class ASSIMP_API SkeletonMeshBuilder +{ +public: + + // ------------------------------------------------------------------- + /** The constructor processes the given scene and adds a mesh there. + * + * Does nothing if the scene already has mesh data. + * @param pScene The scene for which a skeleton mesh should be constructed. + * @param root The node to start with. NULL is the scene root + * @param bKnobsOnly Set this to true if you don't want the connectors + * between the knobs representing the nodes. + */ + SkeletonMeshBuilder( aiScene* pScene, aiNode* root = NULL, + bool bKnobsOnly = false); + +protected: + + // ------------------------------------------------------------------- + /** Recursively builds a simple mesh representation for the given node + * and also creates a joint for the node that affects this part of + * the mesh. + * @param pNode The node to build geometry for. + */ + void CreateGeometry( const aiNode* pNode); + + // ------------------------------------------------------------------- + /** Creates the mesh from the internally accumulated stuff and returns it. + */ + aiMesh* CreateMesh(); + + // ------------------------------------------------------------------- + /** Creates a dummy material and returns it. */ + aiMaterial* CreateMaterial(); + +protected: + /** space to assemble the mesh data: points */ + std::vector mVertices; + + /** faces */ + struct Face + { + unsigned int mIndices[3]; + Face(); + Face( unsigned int p0, unsigned int p1, unsigned int p2) + { mIndices[0] = p0; mIndices[1] = p1; mIndices[2] = p2; } + }; + std::vector mFaces; + + /** bones */ + std::vector mBones; + + bool mKnobsOnly; +}; + +} // end of namespace Assimp + +#endif // AI_SKELETONMESHBUILDER_H_INC diff --git a/engine/inc/assimp/SmoothingGroups.h b/engine/inc/assimp/SmoothingGroups.h new file mode 100644 index 00000000..cdae578d --- /dev/null +++ b/engine/inc/assimp/SmoothingGroups.h @@ -0,0 +1,110 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +/** @file Defines the helper data structures for importing 3DS files. +http://www.jalix.org/ressources/graphics/3DS/_unofficials/3ds-unofficial.txt */ + +#ifndef AI_SMOOTHINGGROUPS_H_INC +#define AI_SMOOTHINGGROUPS_H_INC + +#include +#include +#include + +// --------------------------------------------------------------------------- +/** Helper structure representing a face with smoothing groups assigned */ +struct FaceWithSmoothingGroup +{ + FaceWithSmoothingGroup() + : mIndices(), + iSmoothGroup(0) + { + // in debug builds set all indices to a common magic value +#ifdef ASSIMP_BUILD_DEBUG + this->mIndices[0] = 0xffffffff; + this->mIndices[1] = 0xffffffff; + this->mIndices[2] = 0xffffffff; +#endif + } + + + //! Indices. .3ds is using uint16. However, after + //! an unique vertex set has been generated, + //! individual index values might exceed 2^16 + uint32_t mIndices[3]; + + //! specifies to which smoothing group the face belongs to + uint32_t iSmoothGroup; +}; + +// --------------------------------------------------------------------------- +/** Helper structure representing a mesh whose faces have smoothing + groups assigned. This allows us to reuse the code for normal computations + from smoothings groups for several loaders (3DS, ASE). All of them + use face structures which inherit from #FaceWithSmoothingGroup, + but as they add extra members and need to be copied by value we + need to use a template here. + */ +template +struct MeshWithSmoothingGroups +{ + //! Vertex positions + std::vector mPositions; + + //! Face lists + std::vector mFaces; + + //! List of normal vectors + std::vector mNormals; +}; + +// --------------------------------------------------------------------------- +/** Computes normal vectors for the mesh + */ +template +void ComputeNormalsWithSmoothingsGroups(MeshWithSmoothingGroups& sMesh); + + +// include implementations +#include "SmoothingGroups.inl" + +#endif // !! AI_SMOOTHINGGROUPS_H_INC diff --git a/engine/inc/assimp/SmoothingGroups.inl b/engine/inc/assimp/SmoothingGroups.inl new file mode 100644 index 00000000..84ea4a1b --- /dev/null +++ b/engine/inc/assimp/SmoothingGroups.inl @@ -0,0 +1,138 @@ +/* +--------------------------------------------------------------------------- +Open Asset Import Library (assimp) +--------------------------------------------------------------------------- + +Copyright (c) 2006-2012, assimp team + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the following +conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. +--------------------------------------------------------------------------- +*/ + +/** @file Generation of normal vectors basing on smoothing groups */ + +#ifndef AI_SMOOTHINGGROUPS_INL_INCLUDED +#define AI_SMOOTHINGGROUPS_INL_INCLUDED + +// internal headers +#include + +// CRT header +#include + +using namespace Assimp; + +// ------------------------------------------------------------------------------------------------ +template +void ComputeNormalsWithSmoothingsGroups(MeshWithSmoothingGroups& sMesh) +{ + // First generate face normals + sMesh.mNormals.resize(sMesh.mPositions.size(),aiVector3D()); + for( unsigned int a = 0; a < sMesh.mFaces.size(); a++) + { + T& face = sMesh.mFaces[a]; + + aiVector3D* pV1 = &sMesh.mPositions[face.mIndices[0]]; + aiVector3D* pV2 = &sMesh.mPositions[face.mIndices[1]]; + aiVector3D* pV3 = &sMesh.mPositions[face.mIndices[2]]; + + aiVector3D pDelta1 = *pV2 - *pV1; + aiVector3D pDelta2 = *pV3 - *pV1; + aiVector3D vNor = pDelta1 ^ pDelta2; + + for (unsigned int c = 0; c < 3;++c) + sMesh.mNormals[face.mIndices[c]] = vNor; + } + + // calculate the position bounds so we have a reliable epsilon to check position differences against + aiVector3D minVec( 1e10f, 1e10f, 1e10f), maxVec( -1e10f, -1e10f, -1e10f); + for( unsigned int a = 0; a < sMesh.mPositions.size(); a++) + { + minVec.x = std::min( minVec.x, sMesh.mPositions[a].x); + minVec.y = std::min( minVec.y, sMesh.mPositions[a].y); + minVec.z = std::min( minVec.z, sMesh.mPositions[a].z); + maxVec.x = std::max( maxVec.x, sMesh.mPositions[a].x); + maxVec.y = std::max( maxVec.y, sMesh.mPositions[a].y); + maxVec.z = std::max( maxVec.z, sMesh.mPositions[a].z); + } + const float posEpsilon = (maxVec - minVec).Length() * 1e-5f; + std::vector avNormals; + avNormals.resize(sMesh.mNormals.size()); + + // now generate the spatial sort tree + SGSpatialSort sSort; + for( typename std::vector::iterator i = sMesh.mFaces.begin(); + i != sMesh.mFaces.end();++i) + { + for (unsigned int c = 0; c < 3;++c) + sSort.Add(sMesh.mPositions[(*i).mIndices[c]],(*i).mIndices[c],(*i).iSmoothGroup); + } + sSort.Prepare(); + + std::vector vertexDone(sMesh.mPositions.size(),false); + for( typename std::vector::iterator i = sMesh.mFaces.begin(); + i != sMesh.mFaces.end();++i) + { + std::vector poResult; + for (unsigned int c = 0; c < 3;++c) + { + unsigned int idx = (*i).mIndices[c]; + if (vertexDone[idx])continue; + + sSort.FindPositions(sMesh.mPositions[idx],(*i).iSmoothGroup, + posEpsilon,poResult); + + aiVector3D vNormals; + for (std::vector::const_iterator + a = poResult.begin(); + a != poResult.end();++a) + { + vNormals += sMesh.mNormals[(*a)]; + } + vNormals.NormalizeSafe(); + + // write back into all affected normals + for (std::vector::const_iterator + a = poResult.begin(); + a != poResult.end();++a) + { + idx = *a; + avNormals [idx] = vNormals; + vertexDone[idx] = true; + } + } + } + sMesh.mNormals = avNormals; +} + +#endif // !! AI_SMOOTHINGGROUPS_INL_INCLUDED diff --git a/engine/inc/assimp/SpatialSort.h b/engine/inc/assimp/SpatialSort.h new file mode 100644 index 00000000..4c45e95a --- /dev/null +++ b/engine/inc/assimp/SpatialSort.h @@ -0,0 +1,174 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +/** Small helper classes to optimise finding vertizes close to a given location */ +#ifndef AI_SPATIALSORT_H_INC +#define AI_SPATIALSORT_H_INC + +#include +#include + +namespace Assimp { + +// ------------------------------------------------------------------------------------------------ +/** A little helper class to quickly find all vertices in the epsilon environment of a given + * position. Construct an instance with an array of positions. The class stores the given positions + * by their indices and sorts them by their distance to an arbitrary chosen plane. + * You can then query the instance for all vertices close to a given position in an average O(log n) + * time, with O(n) worst case complexity when all vertices lay on the plane. The plane is chosen + * so that it avoids common planes in usual data sets. */ +// ------------------------------------------------------------------------------------------------ +class ASSIMP_API SpatialSort +{ +public: + + SpatialSort(); + + // ------------------------------------------------------------------------------------ + /** Constructs a spatially sorted representation from the given position array. + * Supply the positions in its layout in memory, the class will only refer to them + * by index. + * @param pPositions Pointer to the first position vector of the array. + * @param pNumPositions Number of vectors to expect in that array. + * @param pElementOffset Offset in bytes from the beginning of one vector in memory + * to the beginning of the next vector. */ + SpatialSort( const aiVector3D* pPositions, unsigned int pNumPositions, + unsigned int pElementOffset); + + /** Destructor */ + ~SpatialSort(); + +public: + + // ------------------------------------------------------------------------------------ + /** Sets the input data for the SpatialSort. This replaces existing data, if any. + * The new data receives new indices in ascending order. + * + * @param pPositions Pointer to the first position vector of the array. + * @param pNumPositions Number of vectors to expect in that array. + * @param pElementOffset Offset in bytes from the beginning of one vector in memory + * to the beginning of the next vector. + * @param pFinalize Specifies whether the SpatialSort's internal representation + * is finalized after the new data has been added. Finalization is + * required in order to use #FindPosition() or #GenerateMappingTable(). + * If you don't finalize yet, you can use #Append() to add data from + * other sources.*/ + void Fill( const aiVector3D* pPositions, unsigned int pNumPositions, + unsigned int pElementOffset, + bool pFinalize = true); + + + // ------------------------------------------------------------------------------------ + /** Same as #Fill(), except the method appends to existing data in the #SpatialSort. */ + void Append( const aiVector3D* pPositions, unsigned int pNumPositions, + unsigned int pElementOffset, + bool pFinalize = true); + + + // ------------------------------------------------------------------------------------ + /** Finalize the spatial hash data structure. This can be useful after + * multiple calls to #Append() with the pFinalize parameter set to false. + * This is finally required before one of #FindPositions() and #GenerateMappingTable() + * can be called to query the spatial sort.*/ + void Finalize(); + + // ------------------------------------------------------------------------------------ + /** Returns an iterator for all positions close to the given position. + * @param pPosition The position to look for vertices. + * @param pRadius Maximal distance from the position a vertex may have to be counted in. + * @param poResults The container to store the indices of the found positions. + * Will be emptied by the call so it may contain anything. + * @return An iterator to iterate over all vertices in the given area.*/ + void FindPositions( const aiVector3D& pPosition, ai_real pRadius, + std::vector& poResults) const; + + // ------------------------------------------------------------------------------------ + /** Fills an array with indices of all positions identical to the given position. In + * opposite to FindPositions(), not an epsilon is used but a (very low) tolerance of + * four floating-point units. + * @param pPosition The position to look for vertices. + * @param poResults The container to store the indices of the found positions. + * Will be emptied by the call so it may contain anything.*/ + void FindIdenticalPositions( const aiVector3D& pPosition, + std::vector& poResults) const; + + // ------------------------------------------------------------------------------------ + /** Compute a table that maps each vertex ID referring to a spatially close + * enough position to the same output ID. Output IDs are assigned in ascending order + * from 0...n. + * @param fill Will be filled with numPositions entries. + * @param pRadius Maximal distance from the position a vertex may have to + * be counted in. + * @return Number of unique vertices (n). */ + unsigned int GenerateMappingTable(std::vector& fill, + ai_real pRadius) const; + +protected: + /** Normal of the sorting plane, normalized. The center is always at (0, 0, 0) */ + aiVector3D mPlaneNormal; + + /** An entry in a spatially sorted position array. Consists of a vertex index, + * its position and its pre-calculated distance from the reference plane */ + struct Entry { + unsigned int mIndex; ///< The vertex referred by this entry + aiVector3D mPosition; ///< Position + ai_real mDistance; ///< Distance of this vertex to the sorting plane + + Entry() + : mIndex( 999999999 ), mPosition(), mDistance( 99999. ) { + // empty + } + Entry( unsigned int pIndex, const aiVector3D& pPosition, ai_real pDistance) + : mIndex( pIndex), mPosition( pPosition), mDistance( pDistance) { + // empty + } + + bool operator < (const Entry& e) const { return mDistance < e.mDistance; } + }; + + // all positions, sorted by distance to the sorting plane + std::vector mPositions; +}; + +} // end of namespace Assimp + +#endif // AI_SPATIALSORT_H_INC diff --git a/engine/inc/assimp/StandardShapes.h b/engine/inc/assimp/StandardShapes.h new file mode 100644 index 00000000..fdf1b034 --- /dev/null +++ b/engine/inc/assimp/StandardShapes.h @@ -0,0 +1,200 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +/** @file Declares a helper class, "StandardShapes" which generates + * vertices for standard shapes, such as cylnders, cones, spheres .. + */ +#ifndef AI_STANDARD_SHAPES_H_INC +#define AI_STANDARD_SHAPES_H_INC + +#include +#include + +struct aiMesh; + +namespace Assimp { + +// --------------------------------------------------------------------------- +/** \brief Helper class to generate vertex buffers for standard geometric + * shapes, such as cylinders, cones, boxes, spheres, elipsoids ... . + */ +class ASSIMP_API StandardShapes +{ + // class cannot be instanced + StandardShapes() {} + +public: + + + // ---------------------------------------------------------------- + /** Generates a mesh from an array of vertex positions. + * + * @param positions List of vertex positions + * @param numIndices Number of indices per primitive + * @return Output mesh + */ + static aiMesh* MakeMesh(const std::vector& positions, + unsigned int numIndices); + + + static aiMesh* MakeMesh ( unsigned int (*GenerateFunc) + (std::vector&)); + + static aiMesh* MakeMesh ( unsigned int (*GenerateFunc) + (std::vector&, bool)); + + static aiMesh* MakeMesh ( unsigned int n, void (*GenerateFunc) + (unsigned int,std::vector&)); + + // ---------------------------------------------------------------- + /** @brief Generates a hexahedron (cube) + * + * Hexahedrons can be scaled on all axes. + * @param positions Receives output triangles. + * @param polygons If you pass true here quads will be returned + * @return Number of vertices per face + */ + static unsigned int MakeHexahedron( + std::vector& positions, + bool polygons = false); + + // ---------------------------------------------------------------- + /** @brief Generates an icosahedron + * + * @param positions Receives output triangles. + * @return Number of vertices per face + */ + static unsigned int MakeIcosahedron( + std::vector& positions); + + + // ---------------------------------------------------------------- + /** @brief Generates a dodecahedron + * + * @param positions Receives output triangles + * @param polygons If you pass true here pentagons will be returned + * @return Number of vertices per face + */ + static unsigned int MakeDodecahedron( + std::vector& positions, + bool polygons = false); + + + // ---------------------------------------------------------------- + /** @brief Generates an octahedron + * + * @param positions Receives output triangles. + * @return Number of vertices per face + */ + static unsigned int MakeOctahedron( + std::vector& positions); + + + // ---------------------------------------------------------------- + /** @brief Generates a tetrahedron + * + * @param positions Receives output triangles. + * @return Number of vertices per face + */ + static unsigned int MakeTetrahedron( + std::vector& positions); + + + + // ---------------------------------------------------------------- + /** @brief Generates a sphere + * + * @param tess Number of subdivions - 0 generates a octahedron + * @param positions Receives output triangles. + */ + static void MakeSphere(unsigned int tess, + std::vector& positions); + + + // ---------------------------------------------------------------- + /** @brief Generates a cone or a cylinder, either open or closed. + * + * @code + * + * |-----| <- radius 1 + * + * __x__ <- ] ^ + * / \ | height | + * / \ | Y + * / \ | + * / \ | + * /______x______\ <- ] <- end cap + * + * |-------------| <- radius 2 + * + * @endcode + * + * @param height Height of the cone + * @param radius1 First radius + * @param radius2 Second radius + * @param tess Number of triangles. + * @param bOpened true for an open cone/cylinder. An open shape has + * no 'end caps' + * @param positions Receives output triangles + */ + static void MakeCone(ai_real height,ai_real radius1, + ai_real radius2,unsigned int tess, + std::vector& positions,bool bOpen= false); + + + // ---------------------------------------------------------------- + /** @brief Generates a flat circle + * + * The circle is constructed in the planned formed by the x,z + * axes of the cartesian coordinate system. + * + * @param radius Radius of the circle + * @param tess Number of segments. + * @param positions Receives output triangles. + */ + static void MakeCircle(ai_real radius, unsigned int tess, + std::vector& positions); + +}; +} // ! Assimp + +#endif // !! AI_STANDARD_SHAPES_H_INC diff --git a/engine/inc/assimp/StreamReader.h b/engine/inc/assimp/StreamReader.h new file mode 100644 index 00000000..3fab00ad --- /dev/null +++ b/engine/inc/assimp/StreamReader.h @@ -0,0 +1,348 @@ +/* +--------------------------------------------------------------------------- +Open Asset Import Library (assimp) +--------------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the following +conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. +--------------------------------------------------------------------------- +*/ + +/** @file Defines the StreamReader class which reads data from + * a binary stream with a well-defined endianness. + */ + +#ifndef AI_STREAMREADER_H_INCLUDED +#define AI_STREAMREADER_H_INCLUDED + +#include "ByteSwapper.h" +#include "Exceptional.h" +#include +#include +#include + +namespace Assimp { + +// -------------------------------------------------------------------------------------------- +/** Wrapper class around IOStream to allow for consistent reading of binary data in both + * little and big endian format. Don't attempt to instance the template directly. Use + * StreamReaderLE to read from a little-endian stream and StreamReaderBE to read from a + * BE stream. The class expects that the endianness of any input data is known at + * compile-time, which should usually be true (#BaseImporter::ConvertToUTF8 implements + * runtime endianness conversions for text files). + * + * XXX switch from unsigned int for size types to size_t? or ptrdiff_t?*/ +// -------------------------------------------------------------------------------------------- +template +class StreamReader +{ +public: + // FIXME: use these data types throughout the whole library, + // then change them to 64 bit values :-) + + typedef int diff; + typedef unsigned int pos; + +public: + // --------------------------------------------------------------------- + /** Construction from a given stream with a well-defined endianness. + * + * The StreamReader holds a permanent strong reference to the + * stream, which is released upon destruction. + * @param stream Input stream. The stream is not restarted if + * its file pointer is not at 0. Instead, the stream reader + * reads from the current position to the end of the stream. + * @param le If @c RuntimeSwitch is true: specifies whether the + * stream is in little endian byte order. Otherwise the + * endianness information is contained in the @c SwapEndianess + * template parameter and this parameter is meaningless. */ + StreamReader(std::shared_ptr stream, bool le = false) + : stream(stream) + , le(le) + { + ai_assert(stream); + InternBegin(); + } + + // --------------------------------------------------------------------- + StreamReader(IOStream* stream, bool le = false) + : stream(std::shared_ptr(stream)) + , le(le) + { + ai_assert(stream); + InternBegin(); + } + + // --------------------------------------------------------------------- + ~StreamReader() { + delete[] buffer; + } + +public: + + // deprecated, use overloaded operator>> instead + + // --------------------------------------------------------------------- + /** Read a float from the stream */ + float GetF4() + { + return Get(); + } + + // --------------------------------------------------------------------- + /** Read a double from the stream */ + double GetF8() { + return Get(); + } + + // --------------------------------------------------------------------- + /** Read a signed 16 bit integer from the stream */ + int16_t GetI2() { + return Get(); + } + + // --------------------------------------------------------------------- + /** Read a signed 8 bit integer from the stream */ + int8_t GetI1() { + return Get(); + } + + // --------------------------------------------------------------------- + /** Read an signed 32 bit integer from the stream */ + int32_t GetI4() { + return Get(); + } + + // --------------------------------------------------------------------- + /** Read a signed 64 bit integer from the stream */ + int64_t GetI8() { + return Get(); + } + + // --------------------------------------------------------------------- + /** Read a unsigned 16 bit integer from the stream */ + uint16_t GetU2() { + return Get(); + } + + // --------------------------------------------------------------------- + /** Read a unsigned 8 bit integer from the stream */ + uint8_t GetU1() { + return Get(); + } + + // --------------------------------------------------------------------- + /** Read an unsigned 32 bit integer from the stream */ + uint32_t GetU4() { + return Get(); + } + + // --------------------------------------------------------------------- + /** Read a unsigned 64 bit integer from the stream */ + uint64_t GetU8() { + return Get(); + } + +public: + // --------------------------------------------------------------------- + /** Get the remaining stream size (to the end of the stream) */ + unsigned int GetRemainingSize() const { + return (unsigned int)(end - current); + } + + // --------------------------------------------------------------------- + /** Get the remaining stream size (to the current read limit). The + * return value is the remaining size of the stream if no custom + * read limit has been set. */ + unsigned int GetRemainingSizeToLimit() const { + return (unsigned int)(limit - current); + } + + // --------------------------------------------------------------------- + /** Increase the file pointer (relative seeking) */ + void IncPtr(intptr_t plus) { + current += plus; + if (current > limit) { + throw DeadlyImportError("End of file or read limit was reached"); + } + } + + // --------------------------------------------------------------------- + /** Get the current file pointer */ + int8_t* GetPtr() const { + return current; + } + + // --------------------------------------------------------------------- + /** Set current file pointer (Get it from #GetPtr). This is if you + * prefer to do pointer arithmetics on your own or want to copy + * large chunks of data at once. + * @param p The new pointer, which is validated against the size + * limit and buffer boundaries. */ + void SetPtr(int8_t* p) { + current = p; + if (current > limit || current < buffer) { + throw DeadlyImportError("End of file or read limit was reached"); + } + } + + // --------------------------------------------------------------------- + /** Copy n bytes to an external buffer + * @param out Destination for copying + * @param bytes Number of bytes to copy */ + void CopyAndAdvance(void* out, size_t bytes) { + int8_t* ur = GetPtr(); + SetPtr(ur+bytes); // fire exception if eof + + ::memcpy(out,ur,bytes); + } + + // --------------------------------------------------------------------- + /** Get the current offset from the beginning of the file */ + int GetCurrentPos() const { + return (unsigned int)(current - buffer); + } + + void SetCurrentPos(size_t pos) { + SetPtr(buffer + pos); + } + + // --------------------------------------------------------------------- + /** Setup a temporary read limit + * + * @param limit Maximum number of bytes to be read from + * the beginning of the file. Specifying UINT_MAX + * resets the limit to the original end of the stream. + * Returns the previously set limit. */ + unsigned int SetReadLimit(unsigned int _limit) { + unsigned int prev = GetReadLimit(); + if (UINT_MAX == _limit) { + limit = end; + return prev; + } + + limit = buffer + _limit; + if (limit > end) { + throw DeadlyImportError("StreamReader: Invalid read limit"); + } + return prev; + } + + // --------------------------------------------------------------------- + /** Get the current read limit in bytes. Reading over this limit + * accidentally raises an exception. */ + unsigned int GetReadLimit() const { + return (unsigned int)(limit - buffer); + } + + // --------------------------------------------------------------------- + /** Skip to the read limit in bytes. Reading over this limit + * accidentally raises an exception. */ + void SkipToReadLimit() { + current = limit; + } + + // --------------------------------------------------------------------- + /** overload operator>> and allow chaining of >> ops. */ + template + StreamReader& operator >> (T& f) { + f = Get(); + return *this; + } + + // --------------------------------------------------------------------- + /** Generic read method. ByteSwap::Swap(T*) *must* be defined */ + template + T Get() { + if ( current + sizeof(T) > limit) { + throw DeadlyImportError("End of file or stream limit was reached"); + } + + T f; + ::memcpy (&f, current, sizeof(T)); + Intern::Getter() (&f,le); + current += sizeof(T); + + return f; + } + +private: + // --------------------------------------------------------------------- + void InternBegin() { + if (!stream) { + // in case someone wonders: StreamReader is frequently invoked with + // no prior validation whether the input stream is valid. Since + // no one bothers changing the error message, this message here + // is passed down to the caller and 'unable to open file' + // simply describes best what happened. + throw DeadlyImportError("StreamReader: Unable to open file"); + } + + const size_t s = stream->FileSize() - stream->Tell(); + if (!s) { + throw DeadlyImportError("StreamReader: File is empty or EOF is already reached"); + } + + current = buffer = new int8_t[s]; + const size_t read = stream->Read(current,1,s); + // (read < s) can only happen if the stream was opened in text mode, in which case FileSize() is not reliable + ai_assert(read <= s); + end = limit = &buffer[read]; + } + +private: + std::shared_ptr stream; + int8_t *buffer, *current, *end, *limit; + bool le; +}; + +// -------------------------------------------------------------------------------------------- +// `static` StreamReaders. Their byte order is fixed and they might be a little bit faster. +#ifdef AI_BUILD_BIG_ENDIAN + typedef StreamReader StreamReaderLE; + typedef StreamReader StreamReaderBE; +#else + typedef StreamReader StreamReaderBE; + typedef StreamReader StreamReaderLE; +#endif + +// `dynamic` StreamReader. The byte order of the input data is specified in the +// c'tor. This involves runtime branching and might be a little bit slower. +typedef StreamReader StreamReaderAny; + +} // end namespace Assimp + +#endif // !! AI_STREAMREADER_H_INCLUDED diff --git a/engine/inc/assimp/StreamWriter.h b/engine/inc/assimp/StreamWriter.h new file mode 100644 index 00000000..deb35fb4 --- /dev/null +++ b/engine/inc/assimp/StreamWriter.h @@ -0,0 +1,303 @@ +/* +--------------------------------------------------------------------------- +Open Asset Import Library (assimp) +--------------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the following +conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. +--------------------------------------------------------------------------- +*/ + +/** @file Defines the StreamWriter class which writes data to + * a binary stream with a well-defined endianness. */ + +#ifndef AI_STREAMWRITER_H_INCLUDED +#define AI_STREAMWRITER_H_INCLUDED + +#include "ByteSwapper.h" +#include + +#include +#include + +namespace Assimp { + +// -------------------------------------------------------------------------------------------- +/** Wrapper class around IOStream to allow for consistent writing of binary data in both + * little and big endian format. Don't attempt to instance the template directly. Use + * StreamWriterLE to write to a little-endian stream and StreamWriterBE to write to a + * BE stream. Alternatively, there is StreamWriterAny if the endianness of the output + * stream is to be determined at runtime. + */ +// -------------------------------------------------------------------------------------------- +template +class StreamWriter +{ + enum { + INITIAL_CAPACITY = 1024 + }; + +public: + + // --------------------------------------------------------------------- + /** Construction from a given stream with a well-defined endianness. + * + * The StreamReader holds a permanent strong reference to the + * stream, which is released upon destruction. + * @param stream Input stream. The stream is not re-seeked and writing + continues at the current position of the stream cursor. + * @param le If @c RuntimeSwitch is true: specifies whether the + * stream is in little endian byte order. Otherwise the + * endianness information is defined by the @c SwapEndianess + * template parameter and this parameter is meaningless. */ + StreamWriter(std::shared_ptr stream, bool le = false) + : stream(stream) + , le(le) + , cursor() + { + ai_assert(stream); + buffer.reserve(INITIAL_CAPACITY); + } + + // --------------------------------------------------------------------- + StreamWriter(IOStream* stream, bool le = false) + : stream(std::shared_ptr(stream)) + , le(le) + , cursor() + { + ai_assert(stream); + buffer.reserve(INITIAL_CAPACITY); + } + + // --------------------------------------------------------------------- + ~StreamWriter() { + stream->Write(buffer.data(), 1, buffer.size()); + stream->Flush(); + } + +public: + + // --------------------------------------------------------------------- + /** Flush the contents of the internal buffer, and the output IOStream */ + void Flush() + { + stream->Write(buffer.data(), 1, buffer.size()); + stream->Flush(); + buffer.clear(); + cursor = 0; + } + + // --------------------------------------------------------------------- + /** Seek to the given offset / origin in the output IOStream. + * + * Flushes the internal buffer and the output IOStream prior to seeking. */ + aiReturn Seek(size_t pOffset, aiOrigin pOrigin=aiOrigin_SET) + { + Flush(); + return stream->Seek(pOffset, pOrigin); + } + + // --------------------------------------------------------------------- + /** Tell the current position in the output IOStream. + * + * First flushes the internal buffer and the output IOStream. */ + size_t Tell() + { + Flush(); + return stream->Tell(); + } + +public: + + // --------------------------------------------------------------------- + /** Write a float to the stream */ + void PutF4(float f) + { + Put(f); + } + + // --------------------------------------------------------------------- + /** Write a double to the stream */ + void PutF8(double d) { + Put(d); + } + + // --------------------------------------------------------------------- + /** Write a signed 16 bit integer to the stream */ + void PutI2(int16_t n) { + Put(n); + } + + // --------------------------------------------------------------------- + /** Write a signed 8 bit integer to the stream */ + void PutI1(int8_t n) { + Put(n); + } + + // --------------------------------------------------------------------- + /** Write an signed 32 bit integer to the stream */ + void PutI4(int32_t n) { + Put(n); + } + + // --------------------------------------------------------------------- + /** Write a signed 64 bit integer to the stream */ + void PutI8(int64_t n) { + Put(n); + } + + // --------------------------------------------------------------------- + /** Write a unsigned 16 bit integer to the stream */ + void PutU2(uint16_t n) { + Put(n); + } + + // --------------------------------------------------------------------- + /** Write a unsigned 8 bit integer to the stream */ + void PutU1(uint8_t n) { + Put(n); + } + + // --------------------------------------------------------------------- + /** Write an unsigned 32 bit integer to the stream */ + void PutU4(uint32_t n) { + Put(n); + } + + // --------------------------------------------------------------------- + /** Write a unsigned 64 bit integer to the stream */ + void PutU8(uint64_t n) { + Put(n); + } + + // --------------------------------------------------------------------- + /** Write a single character to the stream */ + void PutChar(char c) { + Put(c); + } + + // --------------------------------------------------------------------- + /** Write an aiString to the stream */ + void PutString(const aiString& s) + { + // as Put(T f) below + if (cursor + s.length >= buffer.size()) { + buffer.resize(cursor + s.length); + } + void* dest = &buffer[cursor]; + ::memcpy(dest, s.C_Str(), s.length); + cursor += s.length; + } + + // --------------------------------------------------------------------- + /** Write a std::string to the stream */ + void PutString(const std::string& s) + { + // as Put(T f) below + if (cursor + s.size() >= buffer.size()) { + buffer.resize(cursor + s.size()); + } + void* dest = &buffer[cursor]; + ::memcpy(dest, s.c_str(), s.size()); + cursor += s.size(); + } + +public: + + // --------------------------------------------------------------------- + /** overload operator<< and allow chaining of MM ops. */ + template + StreamWriter& operator << (T f) { + Put(f); + return *this; + } + + // --------------------------------------------------------------------- + std::size_t GetCurrentPos() const { + return cursor; + } + + // --------------------------------------------------------------------- + void SetCurrentPos(std::size_t new_cursor) { + cursor = new_cursor; + } + + // --------------------------------------------------------------------- + /** Generic write method. ByteSwap::Swap(T*) *must* be defined */ + template + void Put(T f) { + Intern :: Getter() (&f, le); + + if (cursor + sizeof(T) >= buffer.size()) { + buffer.resize(cursor + sizeof(T)); + } + + void* dest = &buffer[cursor]; + + // reinterpret_cast + assignment breaks strict aliasing rules + // and generally causes trouble on platforms such as ARM that + // do not silently ignore alignment faults. + ::memcpy(dest, &f, sizeof(T)); + cursor += sizeof(T); + } + +private: + + std::shared_ptr stream; + bool le; + + std::vector buffer; + std::size_t cursor; +}; + + +// -------------------------------------------------------------------------------------------- +// `static` StreamWriter. Their byte order is fixed and they might be a little bit faster. +#ifdef AI_BUILD_BIG_ENDIAN + typedef StreamWriter StreamWriterLE; + typedef StreamWriter StreamWriterBE; +#else + typedef StreamWriter StreamWriterBE; + typedef StreamWriter StreamWriterLE; +#endif + +// `dynamic` StreamWriter. The byte order of the input data is specified in the +// c'tor. This involves runtime branching and might be a little bit slower. +typedef StreamWriter StreamWriterAny; + +} // end namespace Assimp + +#endif // !! AI_STREAMWriter_H_INCLUDED diff --git a/engine/inc/assimp/StringComparison.h b/engine/inc/assimp/StringComparison.h new file mode 100644 index 00000000..aea7f001 --- /dev/null +++ b/engine/inc/assimp/StringComparison.h @@ -0,0 +1,233 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +/** @file Definition of platform independent string workers: + + ASSIMP_itoa10 + ASSIMP_stricmp + ASSIMP_strincmp + + These functions are not consistently available on all platforms, + or the provided implementations behave too differently. +*/ +#ifndef INCLUDED_AI_STRING_WORKERS_H +#define INCLUDED_AI_STRING_WORKERS_H + +#include +#include +#include "StringComparison.h" + +#include +#include +#include + +namespace Assimp { + +// ------------------------------------------------------------------------------- +/** @brief itoa with a fixed base 10 + * 'itoa' is not consistently available on all platforms so it is quite useful + * to have a small replacement function here. No need to use a full sprintf() + * if we just want to print a number ... + * @param out Output buffer + * @param max Maximum number of characters to be written, including '\0'. + * This parameter may not be 0. + * @param number Number to be written + * @return Length of the output string, excluding the '\0' + */ +AI_FORCE_INLINE +unsigned int ASSIMP_itoa10( char* out, unsigned int max, int32_t number) { + ai_assert(NULL != out); + + // write the unary minus to indicate we have a negative number + unsigned int written = 1u; + if (number < 0 && written < max) { + *out++ = '-'; + ++written; + number = -number; + } + + // We begin with the largest number that is not zero. + int32_t cur = 1000000000; // 2147483648 + bool mustPrint = false; + while (written < max) { + + const unsigned int digit = number / cur; + if (mustPrint || digit > 0 || 1 == cur) { + // print all future zeroe's from now + mustPrint = true; + + *out++ = '0'+static_cast(digit); + + ++written; + number -= digit*cur; + if (1 == cur) { + break; + } + } + cur /= 10; + } + + // append a terminal zero + *out++ = '\0'; + return written-1; +} + +// ------------------------------------------------------------------------------- +/** @brief itoa with a fixed base 10 (Secure template overload) + * The compiler should choose this function if he or she is able to determine the + * size of the array automatically. + */ +template +AI_FORCE_INLINE +unsigned int ASSIMP_itoa10( char(& out)[length], int32_t number) { + return ASSIMP_itoa10(out,length,number); +} + +// ------------------------------------------------------------------------------- +/** @brief Helper function to do platform independent string comparison. + * + * This is required since stricmp() is not consistently available on + * all platforms. Some platforms use the '_' prefix, others don't even + * have such a function. + * + * @param s1 First input string + * @param s2 Second input string + * @return 0 if the given strings are identical + */ +AI_FORCE_INLINE +int ASSIMP_stricmp(const char *s1, const char *s2) { + ai_assert( NULL != s1 ); + ai_assert( NULL != s2 ); + +#if (defined _MSC_VER) + + return ::_stricmp(s1,s2); +#elif defined( __GNUC__ ) + + return ::strcasecmp(s1,s2); +#else + + char c1, c2; + do { + c1 = tolower(*s1++); + c2 = tolower(*s2++); + } + while ( c1 && (c1 == c2) ); + return c1 - c2; +#endif +} + +// ------------------------------------------------------------------------------- +/** @brief Case independent comparison of two std::strings + * + * @param a First string + * @param b Second string + * @return 0 if a == b + */ +AI_FORCE_INLINE +int ASSIMP_stricmp(const std::string& a, const std::string& b) { + int i = (int)b.length()-(int)a.length(); + return (i ? i : ASSIMP_stricmp(a.c_str(),b.c_str())); +} + +// ------------------------------------------------------------------------------- +/** @brief Helper function to do platform independent string comparison. + * + * This is required since strincmp() is not consistently available on + * all platforms. Some platforms use the '_' prefix, others don't even + * have such a function. + * + * @param s1 First input string + * @param s2 Second input string + * @param n Macimum number of characters to compare + * @return 0 if the given strings are identical + */ +AI_FORCE_INLINE +int ASSIMP_strincmp(const char *s1, const char *s2, unsigned int n) { + ai_assert( NULL != s1 ); + ai_assert( NULL != s2 ); + if ( !n ) { + return 0; + } + +#if (defined _MSC_VER) + + return ::_strnicmp(s1,s2,n); + +#elif defined( __GNUC__ ) + + return ::strncasecmp(s1,s2, n); + +#else + char c1, c2; + unsigned int p = 0; + do + { + if (p++ >= n)return 0; + c1 = tolower(*s1++); + c2 = tolower(*s2++); + } + while ( c1 && (c1 == c2) ); + + return c1 - c2; +#endif +} + + +// ------------------------------------------------------------------------------- +/** @brief Evaluates an integer power + * + * todo: move somewhere where it fits better in than here + */ +AI_FORCE_INLINE +unsigned int integer_pow( unsigned int base, unsigned int power ) { + unsigned int res = 1; + for ( unsigned int i = 0; i < power; ++i ) { + res *= base; + } + + return res; +} + +} // end of namespace + +#endif // ! AI_STRINGCOMPARISON_H_INC diff --git a/engine/inc/assimp/StringUtils.h b/engine/inc/assimp/StringUtils.h new file mode 100644 index 00000000..906898b5 --- /dev/null +++ b/engine/inc/assimp/StringUtils.h @@ -0,0 +1,143 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above +copyright notice, this list of conditions and the +following disclaimer. + +* Redistributions in binary form must reproduce the above +copyright notice, this list of conditions and the +following disclaimer in the documentation and/or other +materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its +contributors may be used to endorse or promote products +derived from this software without specific prior +written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ +#ifndef INCLUDED_AI_STRINGUTILS_H +#define INCLUDED_AI_STRINGUTILS_H + +#include + +#include +#include +#include + +/// @fn ai_snprintf +/// @brief The portable version of the function snprintf ( C99 standard ), which works on visual studio compilers 2013 and earlier. +/// @param outBuf The buffer to write in +/// @param size The buffer size +/// @param format The format string +/// @param ap The additional arguments. +/// @return The number of written characters if the buffer size was big enough. If an encoding error occurs, a negative number is returned. +#if defined(_MSC_VER) && _MSC_VER < 1900 + + AI_FORCE_INLINE + int c99_ai_vsnprintf(char *outBuf, size_t size, const char *format, va_list ap) { + int count(-1); + if (0 != size) { + count = _vsnprintf_s(outBuf, size, _TRUNCATE, format, ap); + } + if (count == -1) { + count = _vscprintf(format, ap); + } + + return count; + } + + AI_FORCE_INLINE + int ai_snprintf(char *outBuf, size_t size, const char *format, ...) { + int count; + va_list ap; + + va_start(ap, format); + count = c99_ai_vsnprintf(outBuf, size, format, ap); + va_end(ap); + + return count; + } + +#else +# define ai_snprintf snprintf +#endif + +/// @fn to_string +/// @brief The portable version of to_string ( some gcc-versions on embedded devices are not supporting this). +/// @param value The value to write into the std::string. +/// @return The value as a std::string +template +AI_FORCE_INLINE +std::string to_string( T value ) { + std::ostringstream os; + os << value; + + return os.str(); +} + +/// @fn ai_strtof +/// @brief The portable version of strtof. +/// @param begin The first character of the string. +/// @param end The last character +/// @return The float value, 0.0f in cas of an error. +AI_FORCE_INLINE +float ai_strtof( const char *begin, const char *end ) { + if ( nullptr == begin ) { + return 0.0f; + } + float val( 0.0f ); + if ( nullptr == end ) { + val = static_cast< float >( ::atof( begin ) ); + } else { + std::string::size_type len( end - begin ); + std::string token( begin, len ); + val = static_cast< float >( ::atof( token.c_str() ) ); + } + + return val; +} + +/// @fn DecimalToHexa +/// @brief The portable to convert a decimal value into a hexadecimal string. +/// @param toConvert Value to convert +/// @return The hexadecimal string, is empty in case of an error. +template +AI_FORCE_INLINE +std::string DecimalToHexa( T toConvert ) { + std::string result; + std::stringstream ss; + ss << std::hex << toConvert; + ss >> result; + + for ( size_t i = 0; i < result.size(); ++i ) { + result[ i ] = toupper( result[ i ] ); + } + + return result; +} + +#endif // INCLUDED_AI_STRINGUTILS_H diff --git a/engine/inc/assimp/Subdivision.h b/engine/inc/assimp/Subdivision.h new file mode 100644 index 00000000..84aff68f --- /dev/null +++ b/engine/inc/assimp/Subdivision.h @@ -0,0 +1,131 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +/** @file Defines a helper class to evaluate subdivision surfaces.*/ +#pragma once +#ifndef AI_SUBDISIVION_H_INC +#define AI_SUBDISIVION_H_INC + +#include +#include + +struct aiMesh; + +namespace Assimp { + +// ------------------------------------------------------------------------------ +/** Helper class to evaluate subdivision surfaces. Different algorithms + * are provided for choice. */ +// ------------------------------------------------------------------------------ +class ASSIMP_API Subdivider { +public: + + /** Enumerates all supported subvidision algorithms */ + enum Algorithm { + CATMULL_CLARKE = 0x1 + }; + + virtual ~Subdivider(); + + // --------------------------------------------------------------- + /** Create a subdivider of a specific type + * + * @param algo Algorithm to be used for subdivision + * @return Subdivider instance. */ + static Subdivider* Create (Algorithm algo); + + // --------------------------------------------------------------- + /** Subdivide a mesh using the selected algorithm + * + * @param mesh First mesh to be subdivided. Must be in verbose + * format. + * @param out Receives the output mesh, allocated by me. + * @param num Number of subdivisions to perform. + * @param discard_input If true is passed, the input mesh is + * deleted after the subdivision is complete. This can + * improve performance because it allows the optimization + * to reuse the existing mesh for intermediate results. + * @pre out!=mesh*/ + virtual void Subdivide ( aiMesh* mesh, + aiMesh*& out, unsigned int num, + bool discard_input = false) = 0; + + // --------------------------------------------------------------- + /** Subdivide multiple meshes using the selected algorithm. This + * avoids erroneous smoothing on objects consisting of multiple + * per-material meshes. Usually, most 3d modellers smooth on a + * per-object base, regardless the materials assigned to the + * meshes. + * + * @param smesh Array of meshes to be subdivided. Must be in + * verbose format. + * @param nmesh Number of meshes in smesh. + * @param out Receives the output meshes. The array must be + * sufficiently large (at least @c nmesh elements) and may not + * overlap the input array. Output meshes map one-to-one to + * their corresponding input meshes. The meshes are allocated + * by the function. + * @param discard_input If true is passed, input meshes are + * deleted after the subdivision is complete. This can + * improve performance because it allows the optimization + * of reusing existing meshes for intermediate results. + * @param num Number of subdivisions to perform. + * @pre nmesh != 0, smesh and out may not overlap*/ + virtual void Subdivide ( + aiMesh** smesh, + size_t nmesh, + aiMesh** out, + unsigned int num, + bool discard_input = false) = 0; + +}; + +inline +Subdivider::~Subdivider() { + // empty +} + +} // end namespace Assimp + + +#endif // !! AI_SUBDISIVION_H_INC + diff --git a/engine/inc/assimp/TinyFormatter.h b/engine/inc/assimp/TinyFormatter.h new file mode 100644 index 00000000..2ddc227e --- /dev/null +++ b/engine/inc/assimp/TinyFormatter.h @@ -0,0 +1,166 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ + +/** @file TinyFormatter.h + * @brief Utility to format log messages more easily. Introduced + * to get rid of the boost::format dependency. Much slinker, + * basically just extends stringstream. + */ +#ifndef INCLUDED_TINY_FORMATTER_H +#define INCLUDED_TINY_FORMATTER_H + +#include + +namespace Assimp { +namespace Formatter { + +// ------------------------------------------------------------------------------------------------ +/** stringstream utility. Usage: + * @code + * void writelog(const std::string&s); + * void writelog(const std::wstring&s); + * ... + * writelog(format()<< "hi! this is a number: " << 4); + * writelog(wformat()<< L"hi! this is a number: " << 4); + * + * @endcode */ +template < typename T, + typename CharTraits = std::char_traits, + typename Allocator = std::allocator +> +class basic_formatter +{ + +public: + + typedef class std::basic_string< + T,CharTraits,Allocator + > string; + + typedef class std::basic_ostringstream< + T,CharTraits,Allocator + > stringstream; + +public: + + basic_formatter() {} + + /* Allow basic_formatter's to be used almost interchangeably + * with std::(w)string or const (w)char* arguments because the + * conversion c'tor is called implicitly. */ + template + basic_formatter(const TT& sin) { + underlying << sin; + } + + + // The problem described here: + // https://sourceforge.net/tracker/?func=detail&atid=1067632&aid=3358562&group_id=226462 + // can also cause trouble here. Apparently, older gcc versions sometimes copy temporaries + // being bound to const ref& function parameters. Copying streams is not permitted, though. + // This workaround avoids this by manually specifying a copy ctor. +#if !defined(__GNUC__) || !defined(__APPLE__) || __GNUC__ > 4 || (__GNUC__ == 4 && __GNUC_MINOR__ >= 6) + explicit basic_formatter(const basic_formatter& other) { + underlying << (string)other; + } +#endif + + +public: + + operator string () const { + return underlying.str(); + } + + + /* note - this is declared const because binding temporaries does only + * work for const references, so many function prototypes will + * include const basic_formatter& s but might still want to + * modify the formatted string without the need for a full copy.*/ + template + const basic_formatter& operator << (const TToken& s) const { + underlying << s; + return *this; + } + + template + basic_formatter& operator << (const TToken& s) { + underlying << s; + return *this; + } + + + // comma operator overloaded as well, choose your preferred way. + template + const basic_formatter& operator, (const TToken& s) const { + underlying << s; + return *this; + } + + template + basic_formatter& operator, (const TToken& s) { + underlying << s; + return *this; + } + + // Fix for MSVC8 + // See https://sourceforge.net/projects/assimp/forums/forum/817654/topic/4372824 + template + basic_formatter& operator, (TToken& s) { + underlying << s; + return *this; + } + + +private: + mutable stringstream underlying; +}; + + +typedef basic_formatter< char > format; +typedef basic_formatter< wchar_t > wformat; + +} // ! namespace Formatter + +} // ! namespace Assimp + +#endif diff --git a/engine/inc/assimp/Vertex.h b/engine/inc/assimp/Vertex.h new file mode 100644 index 00000000..02ae3c0f --- /dev/null +++ b/engine/inc/assimp/Vertex.h @@ -0,0 +1,324 @@ +/* +Open Asset Import Library (assimp) +---------------------------------------------------------------------- + +Copyright (c) 2006-2018, assimp team + + +All rights reserved. + +Redistribution and use of this software in source and binary forms, +with or without modification, are permitted provided that the +following conditions are met: + +* Redistributions of source code must retain the above + copyright notice, this list of conditions and the + following disclaimer. + +* Redistributions in binary form must reproduce the above + copyright notice, this list of conditions and the + following disclaimer in the documentation and/or other + materials provided with the distribution. + +* Neither the name of the assimp team, nor the names of its + contributors may be used to endorse or promote products + derived from this software without specific prior + written permission of the assimp team. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +---------------------------------------------------------------------- +*/ +/** @file Defines a helper class to represent an interleaved vertex + along with arithmetic operations to support vertex operations + such as subdivision, smoothing etc. + + While the code is kept as general as possible, arithmetic operations + that are not currently well-defined (and would cause compile errors + due to missing operators in the math library), are commented. + */ +#ifndef AI_VERTEX_H_INC +#define AI_VERTEX_H_INC + +#include +#include +#include +#include + +namespace Assimp { + + /////////////////////////////////////////////////////////////////////////// + // std::plus-family operates on operands with identical types - we need to + // support all the (vectype op float) combinations in vector maths. + // Providing T(float) would open the way to endless implicit conversions. + /////////////////////////////////////////////////////////////////////////// + namespace Intern { + template struct plus { + TRES operator() (const T0& t0, const T1& t1) const { + return t0+t1; + } + }; + template struct minus { + TRES operator() (const T0& t0, const T1& t1) const { + return t0-t1; + } + }; + template struct multiplies { + TRES operator() (const T0& t0, const T1& t1) const { + return t0*t1; + } + }; + template struct divides { + TRES operator() (const T0& t0, const T1& t1) const { + return t0/t1; + } + }; + } + +// ------------------------------------------------------------------------------------------------ +/** Intermediate description a vertex with all possible components. Defines a full set of + * operators, so you may use such a 'Vertex' in basic arithmetics. All operators are applied + * to *all* vertex components equally. This is useful for stuff like interpolation + * or subdivision, but won't work if special handling is required for some vertex components. */ +// ------------------------------------------------------------------------------------------------ +class Vertex +{ + friend Vertex operator + (const Vertex&,const Vertex&); + friend Vertex operator - (const Vertex&,const Vertex&); + +// friend Vertex operator + (const Vertex&,ai_real); +// friend Vertex operator - (const Vertex&,ai_real); + friend Vertex operator * (const Vertex&,ai_real); + friend Vertex operator / (const Vertex&,ai_real); + +// friend Vertex operator + (ai_real, const Vertex&); +// friend Vertex operator - (ai_real, const Vertex&); + friend Vertex operator * (ai_real, const Vertex&); +// friend Vertex operator / (ai_real, const Vertex&); + +public: + + Vertex() {} + + // ---------------------------------------------------------------------------- + /** Extract a particular vertex from a mesh and interleave all components */ + explicit Vertex(const aiMesh* msh, unsigned int idx) { + ai_assert(idx < msh->mNumVertices); + position = msh->mVertices[idx]; + + if (msh->HasNormals()) { + normal = msh->mNormals[idx]; + } + + if (msh->HasTangentsAndBitangents()) { + tangent = msh->mTangents[idx]; + bitangent = msh->mBitangents[idx]; + } + + for (unsigned int i = 0; msh->HasTextureCoords(i); ++i) { + texcoords[i] = msh->mTextureCoords[i][idx]; + } + + for (unsigned int i = 0; msh->HasVertexColors(i); ++i) { + colors[i] = msh->mColors[i][idx]; + } + } + +public: + + Vertex& operator += (const Vertex& v) { + *this = *this+v; + return *this; + } + + Vertex& operator -= (const Vertex& v) { + *this = *this-v; + return *this; + } + + +/* + Vertex& operator += (ai_real v) { + *this = *this+v; + return *this; + } + + Vertex& operator -= (ai_real v) { + *this = *this-v; + return *this; + } +*/ + Vertex& operator *= (ai_real v) { + *this = *this*v; + return *this; + } + + Vertex& operator /= (ai_real v) { + *this = *this/v; + return *this; + } + +public: + + // ---------------------------------------------------------------------------- + /** Convert back to non-interleaved storage */ + void SortBack(aiMesh* out, unsigned int idx) const { + + ai_assert(idxmNumVertices); + out->mVertices[idx] = position; + + if (out->HasNormals()) { + out->mNormals[idx] = normal; + } + + if (out->HasTangentsAndBitangents()) { + out->mTangents[idx] = tangent; + out->mBitangents[idx] = bitangent; + } + + for(unsigned int i = 0; out->HasTextureCoords(i); ++i) { + out->mTextureCoords[i][idx] = texcoords[i]; + } + + for(unsigned int i = 0; out->HasVertexColors(i); ++i) { + out->mColors[i][idx] = colors[i]; + } + } + +private: + + // ---------------------------------------------------------------------------- + /** Construct from two operands and a binary operation to combine them */ + template